BLASTP 7.6.0


Query=fugu4_746472 |jgi|Takru4|746472|fgh5_pg.C_scaffold_3718000001
        (231 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002jxo |17|NM_001079803|P10253|LYAG_HUMAN|GAA|NM_0010798...     29   4.891
hg18||uc002jxp |17|NM_000152|P10253|LYAG_HUMAN|GAA|NM_000152|NP_...     29   4.891
hg18||uc002jxq |17|NM_001079804|P10253|LYAG_HUMAN|GAA|NM_0010798...     29   4.891
hg18||uc002mkp |19|NM_024690|NA|NA|MUC16|NM_024690|NP_078966|muc...     29   4.891
hg18||uc003isb |4|NM_012224|Q96PY6|NEK1_HUMAN|NEK1|NM_012224|NP_...     29   4.891
hg18||uc003isc |4|CR936672|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_0...     29   4.891
hg18||uc003isd |4|CR933642|Q5H9T1|Q5H9T1_HUMAN|NEK1|NM_012224|NP...     29   4.891
hg18||uc003ise |4|AL050385|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_0...     29   4.891
hg18||uc003isf |4|BC114491|Q14CB7|Q14CB7_HUMAN|NEK1|NM_012224|NP...     29   4.891
hg18||uc003isb |4|NM_012224|Q96PY6|NEK1_HUMAN|NEK1|NM_012224|NP_...     28   8.343
hg18||uc003isc |4|CR936672|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_0...     28   8.343
hg18||uc003isd |4|CR933642|Q5H9T1|Q5H9T1_HUMAN|NEK1|NM_012224|NP...     28   8.343
hg18||uc003ise |4|AL050385|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_0...     28   8.343
hg18||uc003isf |4|BC114491|Q14CB7|Q14CB7_HUMAN|NEK1|NM_012224|NP...     28   8.343

>hg18||uc002jxo
        |17|NM_001079803|P10253|LYAG_HUMAN|GAA|NM_001079803|NP_001073271|acid
        alpha-glucosidase preproprotein

          Length = 952

 Score =  29 bits (63), Expect = 4.891
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query:  41 LDINVQLETSS-THSAIEIPDDLDFDVPLETSSTHSAIEIPNDLDINVQLETSSTHSAIE 99
           | ..| .|| .  |  |. | .  ..|||||   ||    |        .| |     . 
Sbjct: 167 LRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSP-----LYSVEFSEEPFGVI 221

Query: 100 IPNDLDINVQLETS 113
           .   ||  | | |.
Sbjct: 222 VRRQLDGRVLLNTT 235

>hg18||uc002jxp |17|NM_000152|P10253|LYAG_HUMAN|GAA|NM_000152|NP_000143|acid
        alpha-glucosidase preproprotein

          Length = 952

 Score =  29 bits (63), Expect = 4.891
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query:  41 LDINVQLETSS-THSAIEIPDDLDFDVPLETSSTHSAIEIPNDLDINVQLETSSTHSAIE 99
           | ..| .|| .  |  |. | .  ..|||||   ||    |        .| |     . 
Sbjct: 167 LRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSP-----LYSVEFSEEPFGVI 221

Query: 100 IPNDLDINVQLETS 113
           .   ||  | | |.
Sbjct: 222 VRRQLDGRVLLNTT 235

>hg18||uc002jxq
        |17|NM_001079804|P10253|LYAG_HUMAN|GAA|NM_001079804|NP_001073272|acid
        alpha-glucosidase preproprotein

          Length = 952

 Score =  29 bits (63), Expect = 4.891
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query:  41 LDINVQLETSS-THSAIEIPDDLDFDVPLETSSTHSAIEIPNDLDINVQLETSSTHSAIE 99
           | ..| .|| .  |  |. | .  ..|||||   ||    |        .| |     . 
Sbjct: 167 LRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSP-----LYSVEFSEEPFGVI 221

Query: 100 IPNDLDINVQLETS 113
           .   ||  | | |.
Sbjct: 222 VRRQLDGRVLLNTT 235

>hg18||uc002mkp |19|NM_024690|NA|NA|MUC16|NM_024690|NP_078966|mucin 16

          Length = 14507

 Score =  29 bits (63), Expect = 4.891
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query:    7 TSSKHIVIEIPDDLDIDVQLETSSTHSAIEIPNDLDINVQLETSSTHSAIEIPDDLDFDV 66
            | |   . |. . .  |   | .|. | .   | ||||..  |.|. |    |   .   
Sbjct: 3876 TPSAPWITEMMNSVSEDTIKEVTSSSSVLRTLNTLDINLESGTTSSPSWKSSP--YERIA 3933

Query:   67 PLETSSTHSAIEIPNDLDINVQLETSSTHSA 97
            | |...   ||    .        ||| |..
Sbjct: 3934 PSESTTDKEAIHPSTNTVETTGWVTSSEHAS 3964

>hg18||uc003isb |4|NM_012224|Q96PY6|NEK1_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1258

 Score =  29 bits (63), Expect = 4.891
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  14 IEIPDDLDIDVQLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 58
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 892 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 939

>hg18||uc003isc |4|CR936672|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1214

 Score =  29 bits (63), Expect = 4.891
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  14 IEIPDDLDIDVQLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 58
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 848 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 895

>hg18||uc003isd |4|CR933642|Q5H9T1|Q5H9T1_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1286

 Score =  29 bits (63), Expect = 4.891
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  14 IEIPDDLDIDVQLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 58
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 920 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 967

>hg18||uc003ise |4|AL050385|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1242

 Score =  29 bits (63), Expect = 4.891
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  14 IEIPDDLDIDVQLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 58
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 876 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 923

>hg18||uc003isf |4|BC114491|Q14CB7|Q14CB7_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1189

 Score =  29 bits (63), Expect = 4.891
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  14 IEIPDDLDIDVQLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 58
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 823 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 870

>hg18||uc003isb |4|NM_012224|Q96PY6|NEK1_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1258

 Score =  28 bits (61), Expect = 8.343
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  56 IEIPDDLDFDVPLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 100
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 892 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 939

>hg18||uc003isc |4|CR936672|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1214

 Score =  28 bits (61), Expect = 8.343
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  56 IEIPDDLDFDVPLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 100
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 848 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 895

>hg18||uc003isd |4|CR933642|Q5H9T1|Q5H9T1_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1286

 Score =  28 bits (61), Expect = 8.343
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  56 IEIPDDLDFDVPLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 100
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 920 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 967

>hg18||uc003ise |4|AL050385|Q96PY6-2|Q96PY6-2|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1242

 Score =  28 bits (61), Expect = 8.343
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  56 IEIPDDLDFDVPLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 100
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 876 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 923

>hg18||uc003isf |4|BC114491|Q14CB7|Q14CB7_HUMAN|NEK1|NM_012224|NP_036356|NIMA
        (never in mitosis gene a)-related kinase 1

          Length = 1189

 Score =  28 bits (61), Expect = 8.343
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query:  56 IEIPDDLDFDVPLETSSTHSAIEIP---NDLDINVQLETSSTHSAIEI 100
           .| ||||. ..  | | |.    .|    |. |. . ||  | ||  |
Sbjct: 823 LEEPDDLETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRI 870

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0