BLASTP 7.6.0


Query=fugu4_746465 |jgi|Takru4|746465|fgh5_pg.C_scaffold_3705000001
        (554 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...    121   4e-027
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    121   4e-027
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...    120   5e-027
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    120   5e-027
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    120   5e-027
hg18||uc002qcg |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|...    115   2e-025
hg18||uc002qcg |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|...    115   2e-025
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...    115   2e-025
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    115   2e-025
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    115   2e-025
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    115   2e-025
hg18||uc001lpk |11|AL161967|P13489|RINI_HUMAN|RNH1|NM_203389|NP_...    115   2e-025
hg18||uc001lpl |11|NM_002939|P13489|RINI_HUMAN|RNH1|NM_002939|NP...    115   2e-025
hg18||uc001lpm |11|NM_203385|P13489|RINI_HUMAN|RNH1|NM_203385|NP...    115   2e-025
hg18||uc001lpn |11|NM_203383|P13489|RINI_HUMAN|RNH1|NM_203383|NP...    115   2e-025
hg18||uc001lpo |11|NM_203384|P13489|RINI_HUMAN|RNH1|NM_203384|NP...    115   2e-025
hg18||uc001lpp |11|NM_203387|P13489|RINI_HUMAN|RNH1|NM_203387|NP...    115   2e-025
hg18||uc001lpq |11|NM_203389|P13489|RINI_HUMAN|RNH1|NM_203389|NP...    115   2e-025
hg18||uc001lpr |11|NM_203386|P13489|RINI_HUMAN|RNH1|NM_203386|NP...    115   2e-025
hg18||uc001lps |11|NM_203388|P13489|RINI_HUMAN|RNH1|NM_203388|NP...    115   2e-025
hg18||uc002gcg |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001...    111   2e-024
hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP...    111   2e-024
hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|...    111   2e-024
hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|N...    111   2e-024
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...    111   2e-024
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...    111   2e-024
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...    111   3e-024
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...    111   3e-024
hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822...    110   7e-024
hg18||uc002qly |19|NM_176820|Q7RTR0|Q7RTR0_HUMAN|NLRP9|NM_176820...    106   1e-022
hg18||uc002qly |19|NM_176820|Q7RTR0|Q7RTR0_HUMAN|NLRP9|NM_176820...    105   2e-022
hg18||uc002qmi |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|...    101   3e-021
hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|N...    101   3e-021
hg18||uc002qmg |19|NM_176810|Q86W25|NAL13_HUMAN|NLRP13|NM_176810...    101   4e-021
hg18||uc002qmi |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|...     99   1e-020
hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|N...     99   1e-020
hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822...     99   2e-020
hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|N...     98   2e-020
hg18||uc002qme |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|...     98   2e-020
hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP...     98   2e-020
hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_...     96   1e-019
hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822...     95   2e-019
hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822...     95   2e-019
hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|N...     95   2e-019
hg18||uc002qme |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|...     95   2e-019
hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP...     95   2e-019
hg18||uc001icr |1|NM_001079821|Q96P20|CIAS1_HUMAN|NLRP3|NM_00107...     94   5e-019
hg18||uc001icu |1|NM_004895|Q96P20|CIAS1_HUMAN|NLRP3|NM_004895|N...     94   5e-019
hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_...     92   1e-018
hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|N...     92   2e-018
hg18||uc002qma |19|NM_145007|P59045|NAL11_HUMAN|NLRP11|NM_145007...     92   2e-018
hg18||uc002qmb |19|AY168968|Q2TV85|Q2TV85_HUMAN|NLRP11|NM_145007...     92   2e-018
hg18||uc001icr |1|NM_001079821|Q96P20|CIAS1_HUMAN|NLRP3|NM_00107...     90   6e-018
hg18||uc001icu |1|NM_004895|Q96P20|CIAS1_HUMAN|NLRP3|NM_004895|N...     90   6e-018
hg18||uc001icw |1|BC117211|Q96P20-4|Q96P20-4|NLRP3|NM_004895|NP_...     90   6e-018
hg18||uc002qmi |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|...     87   4e-017
hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|N...     87   4e-017
hg18||uc002qmh |19|NM_176811|Q7RTR4|Q7RTR4_HUMAN|NLRP8|NM_176811...     87   7e-017
hg18||uc001icw |1|BC117211|Q96P20-4|Q96P20-4|NLRP3|NM_004895|NP_...     86   1e-016
hg18||uc001lpk |11|AL161967|P13489|RINI_HUMAN|RNH1|NM_203389|NP_...     86   1e-016
hg18||uc001lpl |11|NM_002939|P13489|RINI_HUMAN|RNH1|NM_002939|NP...     86   1e-016
hg18||uc001lpm |11|NM_203385|P13489|RINI_HUMAN|RNH1|NM_203385|NP...     86   1e-016
hg18||uc001lpn |11|NM_203383|P13489|RINI_HUMAN|RNH1|NM_203383|NP...     86   1e-016
hg18||uc001lpo |11|NM_203384|P13489|RINI_HUMAN|RNH1|NM_203384|NP...     86   1e-016
hg18||uc001lpp |11|NM_203387|P13489|RINI_HUMAN|RNH1|NM_203387|NP...     86   1e-016
hg18||uc001lpq |11|NM_203389|P13489|RINI_HUMAN|RNH1|NM_203389|NP...     86   1e-016
hg18||uc001lpr |11|NM_203386|P13489|RINI_HUMAN|RNH1|NM_203386|NP...     86   1e-016
hg18||uc001lps |11|NM_203388|P13489|RINI_HUMAN|RNH1|NM_203388|NP...     86   1e-016
hg18||uc001icv |1|NM_183395|Q96P20-2|Q96P20-2|NLRP3|NM_183395|NP...     85   2e-016
hg18||uc002qmg |19|NM_176810|Q86W25|NAL13_HUMAN|NLRP13|NM_176810...     84   3e-016
hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|N...     82   1e-015
hg18||uc002qme |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|...     82   1e-015
hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP...     82   1e-015
hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|N...     82   2e-015
hg18||uc002qma |19|NM_145007|P59045|NAL11_HUMAN|NLRP11|NM_145007...     82   2e-015
hg18||uc002qmb |19|AY168968|Q2TV85|Q2TV85_HUMAN|NLRP11|NM_145007...     82   2e-015
hg18||uc002qcg |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|...     81   3e-015
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     81   3e-015
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     81   4e-015
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...     79   1e-014
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     79   1e-014
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     76   9e-014
hg18||uc002gcg |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001...     75   2e-013
hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP...     75   2e-013
hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|...     75   2e-013
hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|N...     75   2e-013
hg18||uc001lpt |11|CR596248|Q59GB3|Q59GB3_HUMAN|DKFZp434K249|NA|...     74   3e-013
hg18||uc001icv |1|NM_183395|Q96P20-2|Q96P20-2|NLRP3|NM_183395|NP...     73   8e-013
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...     72   2e-012
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...     72   2e-012
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...     72   2e-012
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...     72   2e-012
hg18||uc002qmh |19|NM_176811|Q7RTR4|Q7RTR4_HUMAN|NLRP8|NM_176811...     72   2e-012
hg18||uc002qmh |19|NM_176811|Q7RTR4|Q7RTR4_HUMAN|NLRP8|NM_176811...     70   8e-012
hg18||uc002qmg |19|NM_176810|Q86W25|NAL13_HUMAN|NLRP13|NM_176810...     68   2e-011
hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|N...     67   7e-011
hg18||uc002qme |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|...     67   7e-011
hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP...     67   7e-011
hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|N...     57   6e-008
hg18||uc002qma |19|NM_145007|P59045|NAL11_HUMAN|NLRP11|NM_145007...     57   6e-008

>hg18||uc002qch
        |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-conta
        ining APAF1-like protein 7 isoform 2

          Length = 1061

 Score =  121 bits (301), Expect = 4e-027
 Identities = 73/196 (37%), Positives = 112/196 (57%), Gaps = 4/196 (2%)

Query: 292 YKTSDEGRRRLIPAVRNCRKAELSGSVLSTSHWDVVASAMTSNPSHLRELSLSWNQSLTD 351
           |    | | |               .||  .. . .|.|. .|| .| |||| .  .|  
Sbjct: 670 YSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNP-NLIELSL-YRNALGS 727

Query: 352 ADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSG 411
             ||||   . ||||.|. |||. | .|  .|. |..|| .|  .|  ..||   .   |
Sbjct: 728 RGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIAN-KNLTRMDLSGNGVGFPG 786

Query: 412 MKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVK 471
           | ||| ||    |.|. ..|  |.|   .|  .|| | .|| ||  |||.|| |.|  ..
Sbjct: 787 MMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLR 845

Query: 472 LLCGFLQDPLCELEIL 487
           |||  |. |.| |  |
Sbjct: 846 LLCQGLRHPVCRLRTL 861

>hg18||uc002qci
        |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1004

 Score =  121 bits (301), Expect = 4e-027
 Identities = 73/196 (37%), Positives = 112/196 (57%), Gaps = 4/196 (2%)

Query: 292 YKTSDEGRRRLIPAVRNCRKAELSGSVLSTSHWDVVASAMTSNPSHLRELSLSWNQSLTD 351
           |    | | |               .||  .. . .|.|. .|| .| |||| .  .|  
Sbjct: 670 YSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNP-NLIELSL-YRNALGS 727

Query: 352 ADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSG 411
             ||||   . ||||.|. |||. | .|  .|. |..|| .|  .|  ..||   .   |
Sbjct: 728 RGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIAN-KNLTRMDLSGNGVGFPG 786

Query: 412 MKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVK 471
           | ||| ||    |.|. ..|  |.|   .|  .|| | .|| ||  |||.|| |.|  ..
Sbjct: 787 MMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLR 845

Query: 472 LLCGFLQDPLCELEIL 487
           |||  |. |.| |  |
Sbjct: 846 LLCQGLRHPVCRLRTL 861

>hg18||uc002qch
        |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-conta
        ining APAF1-like protein 7 isoform 2

          Length = 1061

 Score =  120 bits (300), Expect = 5e-027
 Identities = 89/228 (39%), Positives = 123/228 (53%), Gaps = 9/228 (3%)

Query: 264 RLSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CR--KAELSGSVL 319
           |.|   |  |.  | .. . |  ..|        |   |   .|.  ||    .|    |
Sbjct: 753 RISSSACEDLSAAL-IANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQL 811

Query: 320 STSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLS 379
            .     .|| . .|| || || |. | .| |  ..||   . || ||| || |. | |.
Sbjct: 812 ESGACQEMASVLGTNP-HLVELDLTGN-ALEDLGLRLLCQGLRHPVCRLRTLWLKICRLT 869

Query: 380 EISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEI 439
             .|| ||| |  | | || |.||   | | |. ||| ||    |.|.||||  |||   
Sbjct: 870 AAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSA 928

Query: 440 SCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           .|. |.  |..|  .|| |||| | | |  . ||   || | | |. |
Sbjct: 929 ACEGLSVVLQAN-HNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKL 975

>hg18||uc002qcj
        |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1062

 Score =  120 bits (300), Expect = 5e-027
 Identities = 89/228 (39%), Positives = 123/228 (53%), Gaps = 9/228 (3%)

Query: 264 RLSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CR--KAELSGSVL 319
           |.|   |  |.  | .. . |  ..|        |   |   .|.  ||    .|    |
Sbjct: 754 RISSSACEDLSAAL-IANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQL 812

Query: 320 STSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLS 379
            .     .|| . .|| || || |. | .| |  ..||   . || ||| || |. | |.
Sbjct: 813 ESGACQEMASVLGTNP-HLVELDLTGN-ALEDLGLRLLCQGLRHPVCRLRTLWLKICRLT 870

Query: 380 EISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEI 439
             .|| ||| |  | | || |.||   | | |. ||| ||    |.|.||||  |||   
Sbjct: 871 AAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSA 929

Query: 440 SCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           .|. |.  |..|  .|| |||| | | |  . ||   || | | |. |
Sbjct: 930 ACEGLSVVLQAN-HNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKL 976

>hg18||uc002qcj
        |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1062

 Score =  120 bits (300), Expect = 5e-027
 Identities = 69/171 (40%), Positives = 108/171 (63%), Gaps = 4/171 (2%)

Query: 317 SVLSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHC 376
           .||  .. . .|.|. .|| .| |||| .  .|    ||||   . ||||.|. |||. |
Sbjct: 696 TVLLDAYSEHLAAALCTNP-NLIELSL-YRNALGSRGVKLLCQGLRHPNCKLQNLRLKRC 753

Query: 377 SLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRL 436
            .|  .|. |..|| .|  .|  ..||   .   || ||| ||    |.|. ..|  |.|
Sbjct: 754 RISSSACEDLSAALIAN-KNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQL 812

Query: 437 SEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
              .|  .|| | .|| ||  |||.|| |.|  ..|||  |. |.| |  |
Sbjct: 813 ESGACQEMASVLGTNP-HLVELDLTGNALEDLGLRLLCQGLRHPVCRLRTL 862

>hg18||uc002qcg
        |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|NP_150639|PYRIN-contai
        ning APAF1-like protein 7 isoform 1

          Length = 287

 Score =  115 bits (287), Expect = 2e-025
 Identities = 86/228 (37%), Positives = 121/228 (53%), Gaps = 9/228 (3%)

Query: 264 RLSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CR--KAELSGSVL 319
           |.|   |  |.  | .. . |  ..|        |   |   .|.  ||    .|    |
Sbjct:  36 RISSSACEDLSAAL-IANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQL 94

Query: 320 STSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLS 379
            .     .|| . .|| || || |. | .| |  ..||   . || ||| || |. | |.
Sbjct:  95 ESGACQEMASVLGTNP-HLVELDLTGN-ALEDLGLRLLCQGLRHPVCRLRTLWLKICRLT 152

Query: 380 EISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEI 439
             .|| ||| |  | | || |.||   | | |. ||| ||    |.|.||||  | |.  
Sbjct: 153 AAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLDSCGLTAK 211

Query: 440 SCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           .|..|   |  | . |  | |. | | |  |.|||  |  | |.| .|
Sbjct: 212 ACENLYFTLGINQT-LTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVL 258

>hg18||uc002qcg
        |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|NP_150639|PYRIN-contai
        ning APAF1-like protein 7 isoform 1

          Length = 287

 Score =  115 bits (287), Expect = 2e-025
 Identities = 65/133 (48%), Positives = 84/133 (63%), Gaps = 2/133 (1%)

Query: 356 LLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLL 415
           ||   . || |||. ..|| | |   .|  .|| | .|| ||  |.|.  .||| |..||
Sbjct:  72 LLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLRLL 130

Query: 416 CSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCG 475
           | ||    |.| || |  |||.  .|| ||| |  | | || |||| |.| |  | ||| 
Sbjct: 131 CQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCE 189

Query: 476 FLQDPLCELEILR 488
            |. | |.|. ||
Sbjct: 190 GLRHPTCKLQTLR 202

>hg18||uc002qch
        |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-conta
        ining APAF1-like protein 7 isoform 2

          Length = 1061

 Score =  115 bits (287), Expect = 2e-025
 Identities = 65/133 (48%), Positives = 84/133 (63%), Gaps = 2/133 (1%)

Query: 356 LLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLL 415
           ||   . || |||. ..|| | |   .|  .|| | .|| ||  |.|.  .||| |..||
Sbjct: 789 LLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLRLL 847

Query: 416 CSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCG 475
           | ||    |.| || |  |||.  .|| ||| |  | | || |||| |.| |  | ||| 
Sbjct: 848 CQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCE 906

Query: 476 FLQDPLCELEILR 488
            |. | |.|. ||
Sbjct: 907 GLRHPTCKLQTLR 919

>hg18||uc002qci
        |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1004

 Score =  115 bits (287), Expect = 2e-025
 Identities = 86/228 (37%), Positives = 121/228 (53%), Gaps = 9/228 (3%)

Query: 264 RLSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CR--KAELSGSVL 319
           |.|   |  |.  | .. . |  ..|        |   |   .|.  ||    .|    |
Sbjct: 753 RISSSACEDLSAAL-IANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQL 811

Query: 320 STSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLS 379
            .     .|| . .|| || || |. | .| |  ..||   . || ||| || |. | |.
Sbjct: 812 ESGACQEMASVLGTNP-HLVELDLTGN-ALEDLGLRLLCQGLRHPVCRLRTLWLKICRLT 869

Query: 380 EISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEI 439
             .|| ||| |  | | || |.||   | | |. ||| ||    |.|.||||  | |.  
Sbjct: 870 AAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLDSCGLTAK 928

Query: 440 SCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           .|..|   |  | . |  | |. | | |  |.|||  |  | |.| .|
Sbjct: 929 ACENLYFTLGINQT-LTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVL 975

>hg18||uc002qci
        |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1004

 Score =  115 bits (287), Expect = 2e-025
 Identities = 65/133 (48%), Positives = 84/133 (63%), Gaps = 2/133 (1%)

Query: 356 LLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLL 415
           ||   . || |||. ..|| | |   .|  .|| | .|| ||  |.|.  .||| |..||
Sbjct: 789 LLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLRLL 847

Query: 416 CSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCG 475
           | ||    |.| || |  |||.  .|| ||| |  | | || |||| |.| |  | ||| 
Sbjct: 848 CQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCE 906

Query: 476 FLQDPLCELEILR 488
            |. | |.|. ||
Sbjct: 907 GLRHPTCKLQTLR 919

>hg18||uc002qcj
        |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1062

 Score =  115 bits (287), Expect = 2e-025
 Identities = 65/133 (48%), Positives = 84/133 (63%), Gaps = 2/133 (1%)

Query: 356 LLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLL 415
           ||   . || |||. ..|| | |   .|  .|| | .|| ||  |.|.  .||| |..||
Sbjct: 790 LLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNP-HLVELDLTGNALEDLGLRLL 848

Query: 416 CSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCG 475
           | ||    |.| || |  |||.  .|| ||| |  | | || |||| |.| |  | ||| 
Sbjct: 849 CQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQS-LRELDLSLNELGDLGVLLLCE 907

Query: 476 FLQDPLCELEILR 488
            |. | |.|. ||
Sbjct: 908 GLRHPTCKLQTLR 920

>hg18||uc001lpk
        |11|AL161967|P13489|RINI_HUMAN|RNH1|NM_203389|NP_976323|ribonuclease/an
        giogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpl
        |11|NM_002939|P13489|RINI_HUMAN|RNH1|NM_002939|NP_002930|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpm
        |11|NM_203385|P13489|RINI_HUMAN|RNH1|NM_203385|NP_976319|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpn
        |11|NM_203383|P13489|RINI_HUMAN|RNH1|NM_203383|NP_976317|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpo
        |11|NM_203384|P13489|RINI_HUMAN|RNH1|NM_203384|NP_976318|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpp
        |11|NM_203387|P13489|RINI_HUMAN|RNH1|NM_203387|NP_976321|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpq
        |11|NM_203389|P13489|RINI_HUMAN|RNH1|NM_203389|NP_976323|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lpr
        |11|NM_203386|P13489|RINI_HUMAN|RNH1|NM_203386|NP_976320|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc001lps
        |11|NM_203388|P13489|RINI_HUMAN|RNH1|NM_203388|NP_976322|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  115 bits (286), Expect = 2e-025
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR--NCR--KAELSGSVLS 320
           |.|  |  ..  |...   | |||||  .  | |   ..  ..  .|.  |  |    |.
Sbjct:  40 LTEARCKDISSALRVN-PALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT 98

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
            .   |..| . . |. |.|| || |  | || ..||   .. | |||| |.| .|||| 
Sbjct:  99 GAGCGVLSSTLRTLPT-LQELHLSDN-LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSA 156

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
            ||. ||| ||. |   . | .|   . ..|...|| ||.   |||| |.|  | ..  .
Sbjct: 157 ASCEPLASVLRAKPD-FKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDN 215

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |   . |  | || | |  |.| |  .  ||  |  |   |  |
Sbjct: 216 CRDLCGIVASKAS-LRELALGSNKLGDVGMAELCPGLLHPSSRLRTL 261

>hg18||uc002gcg
        |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001033053|NP_001028225|NL
        R family, pyrin domain containing 1 isoform 5

          Length = 1375

 Score =  111 bits (277), Expect = 2e-024
 Identities = 77/205 (37%), Positives = 111/205 (54%), Gaps = 9/205 (4%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVRDDPVLSQ 498
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|  .|   |   || 
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL--IRLGLDQTTLSD 965

Query: 499 AGHKTAQTFRPIKNGSSCLLKIRRK 523
              .  |  | ..     ||   |.
Sbjct: 966 ---EMRQELRALEQEKPQLLIFSRR 987

>hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP_055737|NLR
        family, pyrin domain containing 1 isoform 2

          Length = 1429

 Score =  111 bits (277), Expect = 2e-024
 Identities = 77/205 (37%), Positives = 111/205 (54%), Gaps = 9/205 (4%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVRDDPVLSQ 498
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|  .|   |   || 
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL--IRLGLDQTTLSD 965

Query: 499 AGHKTAQTFRPIKNGSSCLLKIRRK 523
              .  |  | ..     ||   |.
Sbjct: 966 ---EMRQELRALEQEKPQLLIFSRR 987

>hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|NP_127497|NLR
        family, pyrin domain containing 1 isoform 1

          Length = 1473

 Score =  111 bits (277), Expect = 2e-024
 Identities = 77/205 (37%), Positives = 111/205 (54%), Gaps = 9/205 (4%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVRDDPVLSQ 498
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|  .|   |   || 
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL--IRLGLDQTTLSD 965

Query: 499 AGHKTAQTFRPIKNGSSCLLKIRRK 523
              .  |  | ..     ||   |.
Sbjct: 966 ---EMRQELRALEQEKPQLLIFSRR 987

>hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP_055737|NLR
        family, pyrin domain containing 1 isoform 2

          Length = 1429

 Score =  111 bits (277), Expect = 2e-024
 Identities = 77/205 (37%), Positives = 111/205 (54%), Gaps = 9/205 (4%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVRDDPVLSQ 498
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|  .|   |   || 
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL--IRLGLDQTTLSD 965

Query: 499 AGHKTAQTFRPIKNGSSCLLKIRRK 523
              .  |  | ..     ||   |.
Sbjct: 966 ---EMRQELRALEQEKPQLLIFSRR 987

>hg18||uc002qch
        |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-conta
        ining APAF1-like protein 7 isoform 2

          Length = 1061

 Score =  111 bits (277), Expect = 2e-024
 Identities = 83/222 (37%), Positives = 122/222 (54%), Gaps = 9/222 (4%)

Query:  270 CSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CRKAELSGSV--LSTSHWD 325
            |  .| .|  .  .. ||.|      | | | |   .|.  ||   |   .  |. .  |
Sbjct:  816 CQEMASVLGTNPHLV-ELDLTGNALEDLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACD 874

Query:  326 VVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDS 385
             .|| .. | | |||| || |. | |  | ||   . || |.|.||||  | |   .|. 
Sbjct:  875 ELASTLSVNQS-LRELDLSLNE-LGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEG 932

Query:  386 LASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLA 445
            |.  |..|  .|| |.||.  | | |. ||  ||.   |.|. | |  | |.  .|..| 
Sbjct:  933 LSVVLQAN-HNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLY 991

Query:  446 SALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
              |  | . |  | |. | | |  |.|||  |  | |.| .|
Sbjct:  992 FTLGINQT-LTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVL 1032

>hg18||uc002qcj
        |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1062

 Score =  111 bits (277), Expect = 2e-024
 Identities = 83/222 (37%), Positives = 122/222 (54%), Gaps = 9/222 (4%)

Query:  270 CSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CRKAELSGSV--LSTSHWD 325
            |  .| .|  .  .. ||.|      | | | |   .|.  ||   |   .  |. .  |
Sbjct:  817 CQEMASVLGTNPHLV-ELDLTGNALEDLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACD 875

Query:  326 VVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDS 385
             .|| .. | | |||| || |. | |  | ||   . || |.|.||||  | |   .|. 
Sbjct:  876 ELASTLSVNQS-LRELDLSLNE-LGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEG 933

Query:  386 LASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLA 445
            |.  |..|  .|| |.||.  | | |. ||  ||.   |.|. | |  | |.  .|..| 
Sbjct:  934 LSVVLQAN-HNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLY 992

Query:  446 SALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
              |  | . |  | |. | | |  |.|||  |  | |.| .|
Sbjct:  993 FTLGINQT-LTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVL 1033

>hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|NP_127499|NLR
        family, pyrin domain containing 1 isoform 3

          Length = 1443

 Score =  111 bits (276), Expect = 3e-024
 Identities = 68/166 (40%), Positives = 97/166 (58%), Gaps = 4/166 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCEL 484
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL 953

>hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|NP_127500|NLR
        family, pyrin domain containing 1 isoform 4

          Length = 1399

 Score =  111 bits (276), Expect = 3e-024
 Identities = 68/166 (40%), Positives = 97/166 (58%), Gaps = 4/166 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .. ..| .. | .     .|.|| || | ||. . || |   .  | | ||||||  | |
Sbjct: 792 VTDAYWQILFSVLKVT-RNLKELDLSGN-SLSHSAVKSLCKTLRRPRCLLETLRLAGCGL 849

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |  ||  ||.| . |  |.||.  | |.| | ||  |   .|.|. |.|  | |. 
Sbjct: 850 TAEDCKDLAFGLRANQT-LTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTS 908

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCEL 484
             |  ||| | ..|| |. |||  | | |  |.|||  |. | |.|
Sbjct: 909 DCCQDLASVLSASPS-LKELDLQQNNLDDVGVRLLCEGLRHPACKL 953

>hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822|NP_789792|NLR
        family, pyrin domain containing 14

          Length = 1093

 Score =  110 bits (273), Expect = 7e-024
 Identities = 75/205 (36%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 287 LNLRQYKTSDEGRRRLIPAVRN----CRKAELSGSVLSTSHWDVVASAMTSNPSHLRELS 342
           |||      |.| . |  |.|.      .  |    |. .  . .. |. ||   |  | 
Sbjct: 791 LNLSTNNLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEYLSLALISN-KRLTHLC 849

Query: 343 LSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRVLEL 402
           |. |  | |  |||.| |. |  | |..| || |  . .| . |...|  | | |  |.|
Sbjct: 850 LADN-VLGDGGVKLMSDALQHAQCTLKSLVLRRCHFTSLSSEYLSTSLLHNKS-LTHLDL 907

Query: 403 SYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLDLSG 462
               |.|.|.||||      .| |. | | || |.   |  ||| . .|| .|| |||  
Sbjct: 908 GSNWLQDNGVKLLCDVFRHPSCNLQDLELMGCVLTNACCLDLASVILNNP-NLRSLDLGN 966

Query: 463 NQLKDPAVKLLCGFLQDPLCELEIL 487
           | |.|  ||.||  |. | | .. |
Sbjct: 967 NDLQDDGVKILCDALRYPNCNIQRL 991

>hg18||uc002qly |19|NM_176820|Q7RTR0|Q7RTR0_HUMAN|NLRP9|NM_176820|NP_789790|NLR
        family, pyrin domain containing 9

          Length = 991

 Score =  106 bits (263), Expect = 1e-022
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 4/179 (2%)

Query: 309 CRKAELSGSVLSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRL 368
           |.  .|  . .   |   .  |.  || ||. ||| .  ||. .|.. |   . || |..
Sbjct: 659 CKLRKLIFTSVYFGHDSELFKAVLHNP-HLKLLSL-YGTSLSQSDIRHLCETLKHPMCKI 716

Query: 369 ETLRLRHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLET 428
           | | |  | .|   |. .|| |  | | |. | |    | | || |||  |.  .| || 
Sbjct: 717 EELILGKCDISSEVCEDIASVLACN-SKLKHLSLVENPLRDEGMTLLCEALKHSHCALER 775

Query: 429 LRLSGCRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           | |  | |. .||||..  |  . | | .|||  | |.|  |  ||  |. | | .  |
Sbjct: 776 LMLMYCCLTSVSCDSISEVLLCSKS-LSLLDLGSNALEDNGVASLCAALKHPGCSIREL 833

>hg18||uc002qly |19|NM_176820|Q7RTR0|Q7RTR0_HUMAN|NLRP9|NM_176820|NP_789790|NLR
        family, pyrin domain containing 9

          Length = 991

 Score =  105 bits (260), Expect = 2e-022
 Identities = 65/169 (38%), Positives = 96/169 (56%), Gaps = 4/169 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           .|.   . .|| .  | | |. |||  |  | |  . ||  |. | .| || | | .| |
Sbjct: 726 ISSEVCEDIASVLACN-SKLKHLSLVEN-PLRDEGMTLLCEALKHSHCALERLMLMYCCL 783

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           . .||||..  |  . | | .|.|   .|||.|.  ||. |.   | .  | | || |. 
Sbjct: 784 TSVSCDSISEVLLCSKS-LSLLDLGSNALEDNGVASLCAALKHPGCSIRELWLMGCFLTS 842

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
            ||  .|. |  |   |. | |  |.. |  |. ||  || | |.|| |
Sbjct: 843 DSCKDIAAVLICN-GKLKTLKLGHNEIGDTGVRQLCAALQHPHCKLECL 890

>hg18||uc002qmi
        |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|NP_703148|NACHT, LRR
        and PYD containing protein 5

          Length = 1181

 Score =  101 bits (251), Expect = 3e-021
 Identities = 79/217 (36%), Positives = 112/217 (51%), Gaps = 8/217 (3%)

Query:  279 MSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CRKAELSGSVLSTSH--WDVVASAMTSN 334
            |.   |  |||      .|  |    |...  |    |       .|  .  ..  .|..
Sbjct:  815 MANRNLRSLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTS 874

Query:  335 PSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNP 394
            || |. |||. |. .||  |  || |.    | |. | |  | ..   | |||||| || 
Sbjct:  875 PS-LKSLSLAGNK-VTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNR 932

Query:  395 SHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSH 454
            | |  | ||  || . |. |||  .   .| |. | |. | |    |  || ||  | | 
Sbjct:  933 S-LTHLCLSNNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGN-SW 990

Query:  455 LRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVR 491
            |  | || | ..|  |||||  ...| | |. |  |.
Sbjct:  991 LTHLSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVK 1027

>hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|NP_703148|NACHT,
        LRR and PYD containing protein 5

          Length = 1200

 Score =  101 bits (251), Expect = 3e-021
 Identities = 79/217 (36%), Positives = 112/217 (51%), Gaps = 8/217 (3%)

Query:  279 MSEEVLDELNLRQYKTSDEGRRRLIPAVRN--CRKAELSGSVLSTSH--WDVVASAMTSN 334
            |.   |  |||      .|  |    |...  |    |       .|  .  ..  .|..
Sbjct:  834 MANRNLRSLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTS 893

Query:  335 PSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNP 394
            || |. |||. |. .||  |  || |.    | |. | |  | ..   | |||||| || 
Sbjct:  894 PS-LKSLSLAGNK-VTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNR 951

Query:  395 SHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSH 454
            | |  | ||  || . |. |||  .   .| |. | |. | |    |  || ||  | | 
Sbjct:  952 S-LTHLCLSNNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGN-SW 1009

Query:  455 LRVLDLSGNQLKDPAVKLLCGFLQDPLCELEILRSVR 491
            |  | || | ..|  |||||  ...| | |. |  |.
Sbjct: 1010 LTHLSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVK 1046

>hg18||uc002qmg
        |19|NM_176810|Q86W25|NAL13_HUMAN|NLRP13|NM_176810|NP_789780|NACHT,
        leucine rich repeat and PYD containing

          Length = 1043

 Score =  101 bits (249), Expect = 4e-021
 Identities = 61/142 (42%), Positives = 82/142 (57%), Gaps = 3/142 (2%)

Query: 337 HLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSH 396
           |.  | | .|. | |  .||| .|. || | || | |  | |.  .|  |. ||  | | 
Sbjct: 839 HVTRLCLGFNR-LQDDGIKLLCAALTHPKCALERLELWFCQLAAPACKHLSDALLQNRS- 896

Query: 397 LRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLR 456
           |  | ||  || | |.| ||  |   .  |..| ||||  .   |  ||.||  |  ...
Sbjct: 897 LTHLNLSKNSLRDEGVKFLCEALGRPDGNLQSLNLSGCSFTREGCGELANALSHN-HNVK 955

Query: 457 VLDLSGNQLKDPAVKLLCGFLQ 478
           .|||  | |.|  |||||  |.
Sbjct: 956 ILDLGENDLQDDGVKLLCEALK 977

>hg18||uc002qmi
        |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|NP_703148|NACHT, LRR
        and PYD containing protein 5

          Length = 1181

 Score =  99 bits (245), Expect = 1e-020
 Identities = 76/195 (38%), Positives = 101/195 (51%), Gaps = 8/195 (4%)

Query:  284 LDELNLRQYKTSDEGRRRLIPAVR--NC--RKAELSGSVLSTSHWDVVASAMTSNPSHLR 339
            |  |.|   | .|.|   |  |.|   |  .|  |    .. .    .|||. || | | 
Sbjct:  877 LKSLSLAGNKVTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNRS-LT 935

Query:  340 ELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRV 399
             | || | || .  | ||  .|  |.| |. | |  | |    |  || ||  | | |  
Sbjct:  936 HLCLS-NNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGN-SWLTH 993

Query:  400 LELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLD 459
            | ||   .||.|.||||  .   .| |. | |  | |.   |.|| | . |   ||. ||
Sbjct:  994 LSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESL-SCVISRSRHLKSLD 1052

Query:  460 LSGNQLKDPAVKLLC 474
            |. | | |  |  ||
Sbjct: 1053 LTDNALGDGGVAALC 1067

>hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|NP_703148|NACHT,
        LRR and PYD containing protein 5

          Length = 1200

 Score =  99 bits (245), Expect = 1e-020
 Identities = 76/195 (38%), Positives = 101/195 (51%), Gaps = 8/195 (4%)

Query:  284 LDELNLRQYKTSDEGRRRLIPAVR--NC--RKAELSGSVLSTSHWDVVASAMTSNPSHLR 339
            |  |.|   | .|.|   |  |.|   |  .|  |    .. .    .|||. || | | 
Sbjct:  896 LKSLSLAGNKVTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNRS-LT 954

Query:  340 ELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRV 399
             | || | || .  | ||  .|  |.| |. | |  | |    |  || ||  | | |  
Sbjct:  955 HLCLS-NNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGN-SWLTH 1012

Query:  400 LELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLD 459
            | ||   .||.|.||||  .   .| |. | |  | |.   |.|| | . |   ||. ||
Sbjct: 1013 LSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESL-SCVISRSRHLKSLD 1071

Query:  460 LSGNQLKDPAVKLLC 474
            |. | | |  |  ||
Sbjct: 1072 LTDNALGDGGVAALC 1086

>hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822|NP_789792|NLR
        family, pyrin domain containing 14

          Length = 1093

 Score =  99 bits (244), Expect = 2e-020
 Identities = 75/230 (32%), Positives = 114/230 (49%), Gaps = 15/230 (6%)

Query:  265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVRNCRKAELSGSVLSTSHW 324
            |.|  |  |.  | .| . |  | |      | | . .  |...  .  |   ||   |.
Sbjct:  827 LTEAGCEYLSLAL-ISNKRLTHLCLADNVLGDGGVKLMSDALQHA-QCTLKSLVLRRCHF 884

Query:  325 DVVASAMTSNP-------SHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCS 377
              ..|   |         .|| .|  .|   | |  ||||     ||.| |. | |  | 
Sbjct:  885 TSLSSEYLSTSLLHNKSLTHL-DLGSNW---LQDNGVKLLCDVFRHPSCNLQDLELMGCV 940

Query:  378 LSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLS 437
            |.   |  ||| . .|| .|| |.|    |.| |.|.||  |   || .. | |  | |.
Sbjct:  941 LTNACCLDLASVILNNP-NLRSLDLGNNDLQDDGVKILCDALRYPNCNIQRLGLEYCGLT 999

Query:  438 EISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
             . |  |.|||  |   |  ..|. | |    .  |   |. | |.|..|
Sbjct: 1000 SLCCQDLSSALICN-KRLIKMNLTQNTLGYEGIVKLYKVLKSPKCKLQVL 1048

>hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  98 bits (243), Expect = 2e-020
 Identities = 77/221 (34%), Positives = 114/221 (51%), Gaps = 9/221 (4%)

Query: 271 SALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLSTSHWDV 326
           | | . .   .  |  |.    | | .  | |  |.     | ..  |    ||    .|
Sbjct: 683 SVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEV 742

Query: 327 VASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSL 386
           .|  .|.|   |  |..| ||   |  | ||  |.  |.  |  | |  | |||  |. .
Sbjct: 743 LAGLLTNN-KKLTYLNVSCNQ--LDTGVPLLCEALCSPDTVLVYLMLAFCHLSEQCCEYI 799

Query: 387 ASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLAS 446
           .  |  | | .| |.||   |.| |.| ||  |.  .| |..| |  | ..   |. |||
Sbjct: 800 SEMLLRNKS-VRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITAAGCEDLAS 858

Query: 447 ALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           || ||  .|..| .  |.. |  |.|||  |    | ||||
Sbjct: 859 ALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEIL 898

>hg18||uc002qme
        |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  98 bits (243), Expect = 2e-020
 Identities = 77/221 (34%), Positives = 114/221 (51%), Gaps = 9/221 (4%)

Query: 271 SALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLSTSHWDV 326
           | | . .   .  |  |.    | | .  | |  |.     | ..  |    ||    .|
Sbjct: 683 SVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEV 742

Query: 327 VASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSL 386
           .|  .|.|   |  |..| ||   |  | ||  |.  |.  |  | |  | |||  |. .
Sbjct: 743 LAGLLTNN-KKLTYLNVSCNQ--LDTGVPLLCEALCSPDTVLVYLMLAFCHLSEQCCEYI 799

Query: 387 ASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLAS 446
           .  |  | | .| |.||   |.| |.| ||  |.  .| |..| |  | ..   |. |||
Sbjct: 800 SEMLLRNKS-VRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITAAGCEDLAS 858

Query: 447 ALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           || ||  .|..| .  |.. |  |.|||  |    | ||||
Sbjct: 859 ALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEIL 898

>hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 919

 Score =  98 bits (243), Expect = 2e-020
 Identities = 77/221 (34%), Positives = 114/221 (51%), Gaps = 9/221 (4%)

Query: 271 SALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLSTSHWDV 326
           | | . .   .  |  |.    | | .  | |  |.     | ..  |    ||    .|
Sbjct: 608 SVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEV 667

Query: 327 VASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSL 386
           .|  .|.|   |  |..| ||   |  | ||  |.  |.  |  | |  | |||  |. .
Sbjct: 668 LAGLLTNN-KKLTYLNVSCNQ--LDTGVPLLCEALCSPDTVLVYLMLAFCHLSEQCCEYI 724

Query: 387 ASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLAS 446
           .  |  | | .| |.||   |.| |.| ||  |.  .| |..| |  | ..   |. |||
Sbjct: 725 SEMLLRNKS-VRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITAAGCEDLAS 783

Query: 447 ALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           || ||  .|..| .  |.. |  |.|||  |    | ||||
Sbjct: 784 ALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEIL 823

>hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_899632|NLR
        family, pyrin domain containing 3 isoform b

          Length = 977

 Score =  96 bits (237), Expect = 1e-019
 Identities = 67/174 (38%), Positives = 97/174 (55%), Gaps = 4/174 (2%)

Query: 314 LSGSVLSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRL 373
           |  | |..|    . | .... | | || || | || |  ...|   . || | .  | |
Sbjct: 718 LVNSHLTSSFCRGLFSVLSTSQS-LTELDLSDN-SLGDPGMRVLCETLQHPGCNIRRLWL 775

Query: 374 RHCSLSEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSG 433
             | ||   |  ..  | ||   |  |.||  .| | |..||| ||. | | |. | |  
Sbjct: 776 GRCGLSHECCFDISLVLSSN-QKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVN 834

Query: 434 CRLSEISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
             |. . | .|.| | .|  .|  | | || | |  .||||  |  | |.|..|
Sbjct: 835 SGLTSVCCSALSSVLSTN-QNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVL 887

>hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822|NP_789792|NLR
        family, pyrin domain containing 14

          Length = 1093

 Score =  95 bits (234), Expect = 2e-019
 Identities = 74/208 (35%), Positives = 106/208 (50%), Gaps = 8/208 (3%)

Query: 284 LDELNLRQYKTSDEGRRRLIPAVRNCRKAELSGSVLSTSHWDVVASAMTSN----PSHLR 339
           |  |.|.     | | . |  |...  . .|    | . .  |      ||       | 
Sbjct: 731 LMHLDLKGSDIGDNGVKSLCEALKH-PECKLQTLRLESCNLTVFCCLNISNALIRSQSLI 789

Query: 340 ELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSEISCDSLASALRSNPSHLRV 399
            |.|| | .| |  |.||  |. || | || | |  | |.|  |. |. || ||   |  
Sbjct: 790 FLNLSTN-NLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEYLSLALISN-KRLTH 847

Query: 400 LELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEISCDSLASALRSNPSHLRVLD 459
           | |.   | | |.||.   |.   | |..| |  |  . .| . |...|  | | |  ||
Sbjct: 848 LCLADNVLGDGGVKLMSDALQHAQCTLKSLVLRRCHFTSLSSEYLSTSLLHNKS-LTHLD 906

Query: 460 LSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  | |.|  |||||   . | | |. |
Sbjct: 907 LGSNWLQDNGVKLLCDVFRHPSCNLQDL 934

>hg18||uc001mfb |11|NM_176822|Q86W24|NAL14_HUMAN|NLRP14|NM_176822|NP_789792|NLR
        family, pyrin domain containing 14

          Length = 1093

 Score =  95 bits (234), Expect = 2e-019
 Identities = 60/167 (35%), Positives = 96/167 (57%), Gaps = 5/167 (2%)

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
           |  |  . | . .|  ||||| | .. .|  . . .|   . ||||.|. | |.  .  .
Sbjct: 659 THCWQDLCSVLHTN-EHLRELDL-YHSNLDKSAMNILHHELRHPNCKLQKLLLKFITFPD 716

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
             |  ....|  |  .|  |.|    . |.|.| ||  |.   |.|.||||  | |.   
Sbjct: 717 -GCQDISTSLIHN-KNLMHLDLKGSDIGDNGVKSLCEALKHPECKLQTLRLESCNLTVFC 774

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           | ....||  . | |  |.|| | | |  |.|||  |. | | || |
Sbjct: 775 CLNISNALIRSQS-LIFLNLSTNNLLDDGVQLLCEALRHPKCYLERL 820

>hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  95 bits (234), Expect = 2e-019
 Identities = 62/169 (36%), Positives = 95/169 (56%), Gaps = 4/169 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           ||    . ..  .  | | .| | || |  | |  .| |  |. ||.| |..| |  | .
Sbjct: 791 LSEQCCEYISEMLLRNKS-VRYLDLSAN-VLKDEGLKTLCEALKHPDCCLDSLCLVKCFI 848

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |. ||||| ||  .|..|..    . | |..|||  |   .|.|| | |  | |. 
Sbjct: 849 TAAGCEDLASALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTS 907

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
             |  ||| |  . . |. |.|. | |    | .||  |. | | |..|
Sbjct: 908 TCCKDLASVLTCSKT-LQQLNLTLNTLDHTGVVVLCEALRHPECALQVL 955

>hg18||uc002qme
        |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  95 bits (234), Expect = 2e-019
 Identities = 62/169 (36%), Positives = 95/169 (56%), Gaps = 4/169 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           ||    . ..  .  | | .| | || |  | |  .| |  |. ||.| |..| |  | .
Sbjct: 791 LSEQCCEYISEMLLRNKS-VRYLDLSAN-VLKDEGLKTLCEALKHPDCCLDSLCLVKCFI 848

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |. ||||| ||  .|..|..    . | |..|||  |   .|.|| | |  | |. 
Sbjct: 849 TAAGCEDLASALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTS 907

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
             |  ||| |  . . |. |.|. | |    | .||  |. | | |..|
Sbjct: 908 TCCKDLASVLTCSKT-LQQLNLTLNTLDHTGVVVLCEALRHPECALQVL 955

>hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 919

 Score =  95 bits (234), Expect = 2e-019
 Identities = 62/169 (36%), Positives = 95/169 (56%), Gaps = 4/169 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           ||    . ..  .  | | .| | || |  | |  .| |  |. ||.| |..| |  | .
Sbjct: 716 LSEQCCEYISEMLLRNKS-VRYLDLSAN-VLKDEGLKTLCEALKHPDCCLDSLCLVKCFI 773

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .   |. ||||| ||  .|..|..    . | |..|||  |   .|.|| | |  | |. 
Sbjct: 774 TAAGCEDLASALISN-QNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTS 832

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
             |  ||| |  . . |. |.|. | |    | .||  |. | | |..|
Sbjct: 833 TCCKDLASVLTCSKT-LQQLNLTLNTLDHTGVVVLCEALRHPECALQVL 880

>hg18||uc001icr
        |1|NM_001079821|Q96P20|CIAS1_HUMAN|NLRP3|NM_001079821|NP_001073289|NLR
        family, pyrin domain containing 3 isoform a

          Length = 1036

 Score =  94 bits (231), Expect = 5e-019
 Identities = 77/227 (33%), Positives = 113/227 (49%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLS 320
           |.   |  |  .|  |.  | ||.|      | | | |   ..    | |.  |    ||
Sbjct: 725 LTSSFCRGLFSVLSTSQS-LTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLS 783

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
                 ..  ..||   | || || | .| |  ..||   . |  | |. | |  | |. 
Sbjct: 784 HECCFDISLVLSSN-QKLVELDLSDN-ALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTS 841

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
             |  ||| | .. |  | | .   .| |||. .||   ..  | |. | |    |. . 
Sbjct: 842 ACCQDLASVLSTSHSLTR-LYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC 900

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           | .|.| | .|  .|  | | || | |  .||||  |  | |.|..|
Sbjct: 901 CSALSSVLSTN-QNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVL 946

>hg18||uc001icu |1|NM_004895|Q96P20|CIAS1_HUMAN|NLRP3|NM_004895|NP_004886|NLR
        family, pyrin domain containing 3 isoform a

          Length = 1036

 Score =  94 bits (231), Expect = 5e-019
 Identities = 77/227 (33%), Positives = 113/227 (49%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLS 320
           |.   |  |  .|  |.  | ||.|      | | | |   ..    | |.  |    ||
Sbjct: 725 LTSSFCRGLFSVLSTSQS-LTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLS 783

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
                 ..  ..||   | || || | .| |  ..||   . |  | |. | |  | |. 
Sbjct: 784 HECCFDISLVLSSN-QKLVELDLSDN-ALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTS 841

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
             |  ||| | .. |  | | .   .| |||. .||   ..  | |. | |    |. . 
Sbjct: 842 ACCQDLASVLSTSHSLTR-LYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC 900

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           | .|.| | .|  .|  | | || | |  .||||  |  | |.|..|
Sbjct: 901 CSALSSVLSTN-QNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVL 946

>hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_899632|NLR
        family, pyrin domain containing 3 isoform b

          Length = 977

 Score =  92 bits (228), Expect = 1e-018
 Identities = 77/227 (33%), Positives = 112/227 (49%), Gaps = 9/227 (3%)

Query: 265 LSEIHCSALAYLLQMSEEVLDELNLRQYKTSDEGRRRLIPAVR----NCRKAELSGSVLS 320
           |.   |  |  .|  |.  | ||.|      | | | |   ..    | |.  |    ||
Sbjct: 723 LTSSFCRGLFSVLSTSQS-LTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLS 781

Query: 321 TSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSLSE 380
                 ..  ..||   | || || | .| |  ..||   . |  | |. | | .  |. 
Sbjct: 782 HECCFDISLVLSSN-QKLVELDLSDN-ALGDFGIRLLCVGLKHLLCNLKKLWLVNSGLTS 839

Query: 381 ISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSEIS 440
           . | .|.| | .|  .|  | |   .| | |.|||| ||   .|.|. | |  | |.   
Sbjct: 840 VCCSALSSVLSTN-QNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHC 898

Query: 441 CDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCELEIL 487
           |  |.. | |. | || | |  | | |  | . |  |.   | |. |
Sbjct: 899 CWDLSTLLTSSQS-LRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNL 944

>hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|NP_659444|NACHT,
        leucine rich repeat and PYD containing

          Length = 880

 Score =  92 bits (227), Expect = 2e-018
 Identities = 62/166 (37%), Positives = 93/166 (56%), Gaps = 4/166 (2%)

Query: 319 LSTSHWDVVASAMTSNPSHLRELSLSWNQSLTDADVKLLSSAMMHPNCRLETLRLRHCSL 378
           |  |  . .|| . |  | ||.|.|| |   .|  . .|  |..|||| | .| |  | |
Sbjct: 577 LRASECEEIASLLISGGS-LRKLTLSSNPLRSDG-MNILCDALLHPNCTLISLVLVFCCL 634

Query: 379 SEISCDSLASALRSNPSHLRVLELSYISLEDSGMKLLCSGLESLNCQLETLRLSGCRLSE 438
           .|  | .|   |  .|. || |.|    |.. |.  .   |    |||| | ||||  | 
Sbjct: 635 TENCCSALGRVLLFSPT-LRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLSGCFFSS 693

Query: 439 ISCDSLASALRSNPSHLRVLDLSGNQLKDPAVKLLCGFLQDPLCEL 484
             |  .|  . .|   || |..  |...|  ..|||| |. | | |
Sbjct: 694 DICQYIAIVIATN-EKLRSLEIGSNKIEDAGMQLLCGGLRHPNCML 738

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,198,093
Number of Sequences: 45480
Number of Extensions: 193198093
Number of Successful Extensions: 11050774
Number of sequences better than 0.0: 0
BLASTP 7.6.0