BLASTP 7.6.0


Query=fugu4_746402 |jgi|Takru4|746402|fgh5_pg.C_scaffold_3625000001
        (294 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001zis |15|NM_020660|Q9UKL4|CXA9_HUMAN|GJA9|NM_020660|NP...    255   8e-068
hg18||uc002ihj |17|AK124339|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_005497|N...    199   5e-051
hg18||uc002ihk |17|NM_005497|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_005497|...    199   5e-051
hg18||uc002ihl |17|NM_001080383|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_0010...    199   5e-051
hg18||uc001zis |15|NM_020660|Q9UKL4|CXA9_HUMAN|GJA9|NM_020660|NP...    180   2e-045
hg18||uc001umx |13|NM_021954|Q0VAB7|Q0VAB7_HUMAN|GJA3|NM_021954|...    117   2e-026
hg18||uc001hsk |1|NM_020435|Q5T442|CXA12_HUMAN|GJA12|NM_020435|N...    111   1e-024
hg18||uc002huo |17|NM_152219|Q6ZUW6|Q6ZUW6_HUMAN|GJC1|NM_152219|...    110   3e-024
hg18||uc001epu |1|NM_005267|P48165|CXA8_HUMAN|GJA8|NM_005267|NP_...    107   3e-023
hg18||uc001hsk |1|NM_020435|Q5T442|CXA12_HUMAN|GJA12|NM_020435|N...    106   6e-023
hg18||uc001eps |1|NM_181703|P36382|CXA5_HUMAN|GJA5|NM_181703|NP_...    103   3e-022
hg18||uc001ept |1|NM_005266|P36382|CXA5_HUMAN|GJA5|NM_005266|NP_...    103   3e-022
hg18||uc001epu |1|NM_005267|P48165|CXA8_HUMAN|GJA8|NM_005267|NP_...    102   7e-022
hg18||uc001bya |1|NM_002060|P35212|CXA4_HUMAN|GJA4|NM_002060|NP_...    102   9e-022
hg18||uc001cct |1|NM_030772|P57773|CXA10_HUMAN|GJA10|NM_030772|N...    100   3e-021
hg18||uc003pnu |6|NM_032602|Q969M2|Q969M2_HUMAN|CX62|NM_032602|N...    100   3e-021
hg18||uc001eps |1|NM_181703|P36382|CXA5_HUMAN|GJA5|NM_181703|NP_...     99   7e-021
hg18||uc001ept |1|NM_005266|P36382|CXA5_HUMAN|GJA5|NM_005266|NP_...     99   7e-021
hg18||uc003pyr |6|NM_000165|P17302|CXA1_HUMAN|GJA1|NM_000165|NP_...     98   1e-020
hg18||uc004dzf |X|X04325|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000...     97   2e-020
hg18||uc004dzg |X|NM_000166|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_...     97   2e-020
hg18||uc003pnu |6|NM_032602|Q969M2|Q969M2_HUMAN|CX62|NM_032602|N...     97   2e-020
hg18||uc001umx |13|NM_021954|Q0VAB7|Q0VAB7_HUMAN|GJA3|NM_021954|...     97   3e-020
hg18||uc001cct |1|NM_030772|P57773|CXA10_HUMAN|GJA10|NM_030772|N...     95   8e-020
hg18||uc001bxv |1|AK057628|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_6...     91   2e-018
hg18||uc001bxw |1|NM_153212|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_...     91   2e-018
hg18||uc001umy |13|NM_004004|P29033|CXB2_HUMAN|GJB2|NM_004004|NP...     91   2e-018
hg18||uc001bya |1|NM_002060|P35212|CXA4_HUMAN|GJA4|NM_002060|NP_...     91   2e-018
hg18||uc003pyr |6|NM_000165|P17302|CXA1_HUMAN|GJA1|NM_000165|NP_...     90   3e-018
hg18||uc004dzf |X|X04325|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000...     90   3e-018
hg18||uc004dzg |X|NM_000166|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_...     90   3e-018
hg18||uc001umz |13|NM_006783|O95452|CXB6_HUMAN|GJB6|NM_006783|NP...     89   6e-018
hg18||uc001una |13|AY789475|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     89   6e-018
hg18||uc001unb |13|AY789476|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     89   6e-018
hg18||uc001unc |13|AK075247|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     89   6e-018
hg18||uc001und |13|AY789474|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     89   6e-018
hg18||uc001umy |13|NM_004004|P29033|CXB2_HUMAN|GJB2|NM_004004|NP...     87   3e-017
hg18||uc001bxu |1|NM_005268|O95377|CXB5_HUMAN|GJB5|NM_005268|NP_...     85   8e-017
hg18||uc001bxx |1|NM_024009|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_...     85   8e-017
hg18||uc001bxy |1|NM_001005752|O75712|CXB3_HUMAN|GJB3|NM_0010057...     85   8e-017
hg18||uc001bxz |1|AF052692|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_0...     85   8e-017
hg18||uc001iyy |10|NM_153368|Q96KN9|Q96KN9_HUMAN|CX40.1|NM_15336...     85   8e-017
hg18||uc002huo |17|NM_152219|Q6ZUW6|Q6ZUW6_HUMAN|GJC1|NM_152219|...     85   1e-016
hg18||uc003plo |6|NM_198568|Q6PEY0|CXB7_HUMAN|GJB7|NM_198568|NP_...     85   1e-016
hg18||uc003plo |6|NM_198568|Q6PEY0|CXB7_HUMAN|GJB7|NM_198568|NP_...     82   5e-016
hg18||uc003usg |7|NM_181538|Q8NFK1|CXE1_HUMAN|GJE1|NM_181538|NP_...     82   5e-016
hg18||uc001umz |13|NM_006783|O95452|CXB6_HUMAN|GJB6|NM_006783|NP...     79   5e-015
hg18||uc001una |13|AY789475|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     79   5e-015
hg18||uc001unb |13|AY789476|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     79   5e-015
hg18||uc001unc |13|AK075247|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     79   5e-015
hg18||uc001und |13|AY789474|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_...     79   5e-015
hg18||uc003usg |7|NM_181538|Q8NFK1|CXE1_HUMAN|GJE1|NM_181538|NP_...     78   1e-014
hg18||uc001iyy |10|NM_153368|Q96KN9|Q96KN9_HUMAN|CX40.1|NM_15336...     76   4e-014
hg18||uc001bxv |1|AK057628|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_6...     73   4e-013
hg18||uc001bxw |1|NM_153212|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_...     73   4e-013
hg18||uc001bxx |1|NM_024009|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_...     64   3e-010
hg18||uc001bxy |1|NM_001005752|O75712|CXB3_HUMAN|GJB3|NM_0010057...     64   3e-010
hg18||uc001bxz |1|AF052692|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_0...     64   3e-010

>hg18||uc001zis
        |15|NM_020660|Q9UKL4|CXA9_HUMAN|GJA9|NM_020660|NP_065711|connexin-36

          Length = 321

 Score =  255 bits (649), Expect = 8e-068
 Identities = 128/180 (71%), Positives = 145/180 (80%), Gaps = 5/180 (2%)

Query: 117 GGRDGTRKLRN--INGILVQHXXXXXXXKEEPDCLEVKEIPNAPRGLTHGKSSKVRRQEG 174
           ||.   .||.|  .||.|          . |||||||||.   | ||     ||.|||||
Sbjct: 137 GGKREDKKLQNAIVNGVL--QNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEG 194

Query: 175 ISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFL 234
           |||||.|||||||||||||| ||||||||||||..||.||||.|||||||||||||||||
Sbjct: 195 ISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEVECYVSRPTEKTVFL 254

Query: 235 VFMFAVSGICVVLNLAELNHLGWRKIKAAIRGVQARRKSICEIRKKDMAHLSQPPNLGRT 294
           ||||||||||||||||||||||||||| |.|| ||.|||| ||| ||.  .|  || |||
Sbjct: 255 VFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVS-VPNFGRT 313

>hg18||uc002ihj
        |17|AK124339|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_005497|NP_005488|connexin 45

          Length = 396

 Score =  199 bits (504), Expect = 5e-051
 Identities = 97/250 (38%), Positives = 154/250 (61%), Gaps = 16/250 (6%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |||...|||.. |. ||..| |||. |.||| ||||   |||   |.||.|.||||||
Sbjct:  23 IWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQII 82

Query:  81 LVCTPSLCFITYSVHQSAK------QKDRRYSFLYPIMERDYGGRDGTRKLRNINGILVQ 134
           || |||. .. |..|. ||       |    |  | .  . .   . | .  |    .. 
Sbjct:  83 LVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEE-DNEEDPMMY 141

Query: 135 HXXXXXXXKEEPDCLEVKEIPNAPRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFL 194
                   ||  .  . |   .  | .         |..|. . ||.|.. |   |.|||
Sbjct: 142 PEMELESDKENKEQSQPKPKHDGRRRI---------REDGLMKIYVLQLLARTVFEVGFL 192

Query: 195 AGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNH 254
            |||||||| |   . | | ||  ...|..|||||||.||. |. |.|.|..||. |. |
Sbjct: 193 IGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLH 252

Query: 255 LGWRKIKAAI 264
           ||.  |. ..
Sbjct: 253 LGFGTIRDSL 262

>hg18||uc002ihk
        |17|NM_005497|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_005497|NP_005488|connexin 45

          Length = 396

 Score =  199 bits (504), Expect = 5e-051
 Identities = 97/250 (38%), Positives = 154/250 (61%), Gaps = 16/250 (6%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |||...|||.. |. ||..| |||. |.||| ||||   |||   |.||.|.||||||
Sbjct:  23 IWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQII 82

Query:  81 LVCTPSLCFITYSVHQSAK------QKDRRYSFLYPIMERDYGGRDGTRKLRNINGILVQ 134
           || |||. .. |..|. ||       |    |  | .  . .   . | .  |    .. 
Sbjct:  83 LVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEE-DNEEDPMMY 141

Query: 135 HXXXXXXXKEEPDCLEVKEIPNAPRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFL 194
                   ||  .  . |   .  | .         |..|. . ||.|.. |   |.|||
Sbjct: 142 PEMELESDKENKEQSQPKPKHDGRRRI---------REDGLMKIYVLQLLARTVFEVGFL 192

Query: 195 AGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNH 254
            |||||||| |   . | | ||  ...|..|||||||.||. |. |.|.|..||. |. |
Sbjct: 193 IGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLH 252

Query: 255 LGWRKIKAAI 264
           ||.  |. ..
Sbjct: 253 LGFGTIRDSL 262

>hg18||uc002ihl
        |17|NM_001080383|Q4VAY0|Q4VAY0_HUMAN|GJA7|NM_001080383|NP_001073852|con
        nexin 45

          Length = 396

 Score =  199 bits (504), Expect = 5e-051
 Identities = 97/250 (38%), Positives = 154/250 (61%), Gaps = 16/250 (6%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |||...|||.. |. ||..| |||. |.||| ||||   |||   |.||.|.||||||
Sbjct:  23 IWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQII 82

Query:  81 LVCTPSLCFITYSVHQSAK------QKDRRYSFLYPIMERDYGGRDGTRKLRNINGILVQ 134
           || |||. .. |..|. ||       |    |  | .  . .   . | .  |    .. 
Sbjct:  83 LVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEE-DNEEDPMMY 141

Query: 135 HXXXXXXXKEEPDCLEVKEIPNAPRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFL 194
                   ||  .  . |   .  | .         |..|. . ||.|.. |   |.|||
Sbjct: 142 PEMELESDKENKEQSQPKPKHDGRRRI---------REDGLMKIYVLQLLARTVFEVGFL 192

Query: 195 AGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNH 254
            |||||||| |   . | | ||  ...|..|||||||.||. |. |.|.|..||. |. |
Sbjct: 193 IGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLH 252

Query: 255 LGWRKIKAAI 264
           ||.  |. ..
Sbjct: 253 LGFGTIRDSL 262

>hg18||uc001zis
        |15|NM_020660|Q9UKL4|CXA9_HUMAN|GJA9|NM_020660|NP_065711|connexin-36

          Length = 321

 Score =  180 bits (456), Expect = 2e-045
 Identities = 86/106 (81%), Positives = 96/106 (90%), Gaps = 4/106 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           ||||||||||||||||||||||.||||||.||||||||||||||.|||||||||||||||
Sbjct:  25 ILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQPGCNQACYDRAFPISHIRYWVFQII 84

Query:  81 LVCTPSLCFITYSVHQSAKQKDRRYSFLYPIMERD----YGGRDGT 122
           .|||||||||||||||||||..|||| ..  ..||     ||  ||
Sbjct:  85 MVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDPPESIGGPGGT 130

>hg18||uc001umx |13|NM_021954|Q0VAB7|Q0VAB7_HUMAN|GJA3|NM_021954|NP_068773|gap
        junction protein, alpha 3, 46kDa (connexin

          Length = 435

 Score =  117 bits (293), Expect = 2e-026
 Identities = 46/97 (47%), Positives = 71/97 (73%)

Query: 168 KVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRP 227
           .||    . | ||  ..|.   |.||.||||||||| .  .. |||.||   |.|..|||
Sbjct: 138 RVRMAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFELKPLYRCDRWPCPNTVDCFISRP 197

Query: 228 TEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAI 264
           ||||.|..|| ||.   ..||. |. ||||.|.|  .
Sbjct: 198 TEKTIFIIFMLAVACASLLLNMLEIYHLGWKKLKQGV 234

>hg18||uc001hsk
        |1|NM_020435|Q5T442|CXA12_HUMAN|GJA12|NM_020435|NP_065168|connexin46.6

          Length = 439

 Score =  111 bits (277), Expect = 1e-024
 Identities = 52/96 (54%), Positives = 67/96 (69%)

Query: 171 RQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEK 230
           ..||. | || |.| | | |. || ||| |||| |   | | | ||   |.|.|||||||
Sbjct: 205 QREGLMRVYVAQLVARAAFEVAFLVGQYLLYGFEVRPFFPCSRQPCPHVVDCFVSRPTEK 264

Query: 231 TVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIRG 266
           ||||. |. || .|..||| |. |||    . |.||
Sbjct: 265 TVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRG 300

>hg18||uc002huo |17|NM_152219|Q6ZUW6|Q6ZUW6_HUMAN|GJC1|NM_152219|NP_689343|gap
        junction protein, chi 1, 31.9kDa (connexin

          Length = 295

 Score =  110 bits (273), Expect = 3e-024
 Identities = 44/78 (56%), Positives = 62/78 (79%)

Query:  23 LTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQIILV 82
           | |..|||||..| ||  |.||||  |.|||||||| | |||.|||.|| |.|.| |.|.
Sbjct:  26 LVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLL 85

Query:  83 CTPSLCFITYSVHQSAKQ 100
             | . |. ||.|.. |.
Sbjct:  86 SAPPVLFVVYSMHRAGKE 103

>hg18||uc001epu |1|NM_005267|P48165|CXA8_HUMAN|GJA8|NM_005267|NP_005258|gap
        junction protein, alpha 8, 50kDa (connexin

          Length = 433

 Score =  107 bits (265), Expect = 3e-023
 Identities = 45/102 (44%), Positives = 72/102 (70%), Gaps = 1/102 (0%)

Query: 165 KSSKVRRQEG-ISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECY 223
           | .|  | || . | |.  ..|.   |.||. | |||||| .  .. | |.||   |.|.
Sbjct: 136 KGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCF 195

Query: 224 VSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIR 265
           ||||||||.|..|| .|. . . ||. || ||| . |..|..
Sbjct: 196 VSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALK 237

>hg18||uc001hsk
        |1|NM_020435|Q5T442|CXA12_HUMAN|GJA12|NM_020435|NP_065168|connexin46.6

          Length = 439

 Score =  106 bits (262), Expect = 6e-023
 Identities = 41/83 (49%), Positives = 63/83 (75%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |||.|.|||.. |. || .| |||  | ||| ||||.  |||   |.||.|.|||||.
Sbjct:  26 VWLTVLVVFRIVLTAVGGEAIYSDEQAKFTCNTRQPGCDNVCYDAFAPLSHVRFWVFQIV 85

Query:  81 LVCTPSLCFITYSVHQSAKQKDR 103
           .. |||. .. |.||. |.  ..
Sbjct:  86 VISTPSVMYLGYAVHRLARASEQ 108

>hg18||uc001eps |1|NM_181703|P36382|CXA5_HUMAN|GJA5|NM_181703|NP_859054|connexin
        40

          Length = 358

 Score =  103 bits (256), Expect = 3e-022
 Identities = 45/96 (46%), Positives = 65/96 (67%)

Query: 166 SSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVS 225
           . ..  |  .   ||  .. |  .|.||. ||||.||  .  .  | | ||   | ||||
Sbjct: 140 NGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVS 199

Query: 226 RPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIK 261
           ||||| ||.||| ||. . ..|.|||| ||||.||.
Sbjct: 200 RPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIR 235

>hg18||uc001ept |1|NM_005266|P36382|CXA5_HUMAN|GJA5|NM_005266|NP_005257|connexin
        40

          Length = 358

 Score =  103 bits (256), Expect = 3e-022
 Identities = 45/96 (46%), Positives = 65/96 (67%)

Query: 166 SSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVS 225
           . ..  |  .   ||  .. |  .|.||. ||||.||  .  .  | | ||   | ||||
Sbjct: 140 NGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVS 199

Query: 226 RPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIK 261
           ||||| ||.||| ||. . ..|.|||| ||||.||.
Sbjct: 200 RPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIR 235

>hg18||uc001epu |1|NM_005267|P48165|CXA8_HUMAN|GJA8|NM_005267|NP_005258|gap
        junction protein, alpha 8, 50kDa (connexin

          Length = 433

 Score =  102 bits (253), Expect = 7e-022
 Identities = 46/84 (54%), Positives = 60/84 (71%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |||. ||||||.    | |. |||. |.||| ||||   |||.|||||||| || |||
Sbjct:  24 VWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQII 83

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            | |||| .. ..||    .. |.
Sbjct:  84 FVSTPSLMYVGHAVHYVRMEEKRK 107

>hg18||uc001bya |1|NM_002060|P35212|CXA4_HUMAN|GJA4|NM_002060|NP_002051|connexin
        37

          Length = 333

 Score =  102 bits (252), Expect = 9e-022
 Identities = 45/84 (53%), Positives = 62/84 (73%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |||. ||||||. . ||.|. |||. | ||| ||||   |||.||||||||||| | .
Sbjct:  24 IWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFL 83

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            | ||.| .. . .. | ...  |
Sbjct:  84 FVSTPTLVYLGHVIYLSRREERLR 107

>hg18||uc001cct
        |1|NM_030772|P57773|CXA10_HUMAN|GJA10|NM_030772|NP_110399|connexin 59

          Length = 515

 Score =  100 bits (248), Expect = 3e-021
 Identities = 43/94 (45%), Positives = 67/94 (71%)

Query: 179 YVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVFMF 238
           ||| .  |. .|.||. ||| |||| .  .|.|  .||   ..|.||||||||.||.|| 
Sbjct: 157 YVIHIFTRSVVEVGFMIGQYLLYGFHLEPLFKCHGHPCPNIIDCFVSRPTEKTIFLLFMQ 216

Query: 239 AVSGICVVLNLAELNHLGWRKIKAAIRGVQARRK 272
           ... | . ||. |. |||..|||  . |    .|
Sbjct: 217 SIATISLFLNILEIFHLGFKKIKRGLWGKYKLKK 250

>hg18||uc003pnu
        |6|NM_032602|Q969M2|Q969M2_HUMAN|CX62|NM_032602|NP_115991|connexin 62

          Length = 543

 Score =  100 bits (247), Expect = 3e-021
 Identities = 50/121 (41%), Positives = 79/121 (65%), Gaps = 5/121 (4%)

Query: 144 EEPDCLEVKEIPNAPRGL----THGKSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYF 199
           | || |...|     | |       .  ||  .  . | ||. .. |. ||.||. ||| 
Sbjct: 119 ENPD-LDLEEQQRIDRELRRLEEQKRIHKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYI 177

Query: 200 LYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRK 259
           |||| .  ...| . ||   |.|.||||||||.|..|| ... | ..||. |. ||| ||
Sbjct: 178 LYGFQMHPLYKCTQPPCPNAVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRK 237

Query: 260 I 260
           |
Sbjct: 238 I 238

>hg18||uc001eps |1|NM_181703|P36382|CXA5_HUMAN|GJA5|NM_181703|NP_859054|connexin
        40

          Length = 358

 Score =  99 bits (244), Expect = 7e-021
 Identities = 43/84 (51%), Positives = 60/84 (71%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |||. |||.|..    |. . |||  | |.|.||||   |||.||||||||||| |||
Sbjct:  24 VWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQII 83

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            | |||| .. ...|    |. |.
Sbjct:  84 FVSTPSLVYMGHAMHTVRMQEKRK 107

>hg18||uc001ept |1|NM_005266|P36382|CXA5_HUMAN|GJA5|NM_005266|NP_005257|connexin
        40

          Length = 358

 Score =  99 bits (244), Expect = 7e-021
 Identities = 43/84 (51%), Positives = 60/84 (71%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |||. |||.|..    |. . |||  | |.|.||||   |||.||||||||||| |||
Sbjct:  24 VWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQII 83

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            | |||| .. ...|    |. |.
Sbjct:  84 FVSTPSLVYMGHAMHTVRMQEKRK 107

>hg18||uc003pyr |6|NM_000165|P17302|CXA1_HUMAN|GJA1|NM_000165|NP_000156|connexin
        43

          Length = 382

 Score =  98 bits (242), Expect = 1e-020
 Identities = 39/99 (39%), Positives = 71/99 (71%)

Query: 168 KVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRP 227
           ||. . |. | |.| ..|..  |. ||  |...||||.  .. | | ||  .|.|..|||
Sbjct: 144 KVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRP 203

Query: 228 TEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIRG 266
           ||||.|..||  || . . ||. || .. .. .|  ..|
Sbjct: 204 TEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKG 242

>hg18||uc004dzf |X|X04325|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000157|gap
        junction protein, beta 1, 32kDa (connexin

          Length = 283

 Score =  97 bits (241), Expect = 2e-020
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |.|. ||||... .  |.|. ||.. |||||||||||  |||. |||||.| |  |.|
Sbjct:  23 VWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQK 101
           || ||.|    .  ||   .|
Sbjct:  83 LVSTPALLVAMHVAHQQHIEK 103

>hg18||uc004dzg |X|NM_000166|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000157|gap
        junction protein, beta 1, 32kDa (connexin

          Length = 283

 Score =  97 bits (241), Expect = 2e-020
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |.|. ||||... .  |.|. ||.. |||||||||||  |||. |||||.| |  |.|
Sbjct:  23 VWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQK 101
           || ||.|    .  ||   .|
Sbjct:  83 LVSTPALLVAMHVAHQQHIEK 103

>hg18||uc003pnu
        |6|NM_032602|Q969M2|Q969M2_HUMAN|CX62|NM_032602|NP_115991|connexin 62

          Length = 543

 Score =  97 bits (240), Expect = 2e-020
 Identities = 44/85 (51%), Positives = 64/85 (75%), Gaps = 1/85 (1%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | ||.. |||.|.. .  | |..|||. | ||| |||||  ||| ||||| ||.|| |||
Sbjct:  24 IWLTILFIFRMLVLRVAAEDVWDDEQSAFACNTRQPGCNNICYDDAFPISLIRFWVLQII 83

Query:  81 LVCTPSLCFITYSVHQ-SAKQKDRR 104
            | .||| .. .....  | .|||.
Sbjct:  84 FVSSPSLVYMGHALYRLRAFEKDRQ 108

>hg18||uc001umx |13|NM_021954|Q0VAB7|Q0VAB7_HUMAN|GJA3|NM_021954|NP_068773|gap
        junction protein, alpha 3, 46kDa (connexin

          Length = 435

 Score =  97 bits (239), Expect = 3e-020
 Identities = 44/86 (51%), Positives = 59/86 (68%), Gaps = 3/86 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |||. |||||..    | |. |||. | ||| ||||   |||.||||||||.|  |||
Sbjct:  24 VWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPGCENVCYDRAFPISHIRFWALQII 83

Query:  81 LVCTPSLCFITYSVH---QSAKQKDR 103
            | ||.| .. . .|      |.|.|
Sbjct:  84 FVSTPTLIYLGHVLHIVRMEEKKKER 109

>hg18||uc001cct
        |1|NM_030772|P57773|CXA10_HUMAN|GJA10|NM_030772|NP_110399|connexin 59

          Length = 515

 Score =  95 bits (235), Expect = 8e-020
 Identities = 41/84 (48%), Positives = 61/84 (72%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | ||.. |||.|.. .  | |. |||. ||||| ||||   |||.||||| ||||| |.|
Sbjct:  24 IWLTILFIFRMLVLGVAAEDVWNDEQSGFICNTEQPGCRNVCYDQAFPISLIRYWVLQVI 83

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            | .||| .. .....    .. |
Sbjct:  84 FVSSPSLVYMGHALYRLRVLEEER 107

>hg18||uc001bxv |1|AK057628|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_694944|gap
        junction protein, beta 4

          Length = 266

 Score =  91 bits (224), Expect = 2e-018
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |.|| |||.|.  .  | |..|||  |.||| ||||   |||. ||.||.| |  |.|
Sbjct:  23 IWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQK 101
           ||  |||  . .  ..  ...
Sbjct:  83 LVTCPSLLVVMHVAYREERER 103

>hg18||uc001bxw |1|NM_153212|Q9NTQ9|CXB4_HUMAN|GJB4|NM_153212|NP_694944|gap
        junction protein, beta 4

          Length = 266

 Score =  91 bits (224), Expect = 2e-018
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |.|| |||.|.  .  | |..|||  |.||| ||||   |||. ||.||.| |  |.|
Sbjct:  23 IWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQK 101
           ||  |||  . .  ..  ...
Sbjct:  83 LVTCPSLLVVMHVAYREERER 103

>hg18||uc001umy |13|NM_004004|P29033|CXB2_HUMAN|GJB2|NM_004004|NP_003995|gap
        junction protein beta 2

          Length = 226

 Score =  91 bits (224), Expect = 2e-018
 Identities = 41/88 (46%), Positives = 59/88 (67%), Gaps = 3/88 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |||. ||||.|. .  . |. |||  |.||||||||   |||  ||||||| |  |.|
Sbjct:  23 IWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRRYSFL 108
            | ||.|     ..| . .. ...  |.
Sbjct:  83 FVSTPAL---LVAMHVAYRRHEKKRKFI 107

>hg18||uc001bya |1|NM_002060|P35212|CXA4_HUMAN|GJA4|NM_002060|NP_002051|connexin
        37

          Length = 333

 Score =  91 bits (223), Expect = 2e-018
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 165 KSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYV 224
           .  ..| .  .   ||  |. .. || ||| ||. |||...  .| | | ||   |.|.|
Sbjct: 141 EDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV 200

Query: 225 SRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIRGVQARR 271
           |||||||.|..||  |  | .|||| || ||  | .    ||..||.
Sbjct: 201 SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLS---RGMRARQ 244

>hg18||uc003pyr |6|NM_000165|P17302|CXA1_HUMAN|GJA1|NM_000165|NP_000156|connexin
        43

          Length = 382

 Score =  90 bits (222), Expect = 3e-018
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . |.|. |||||..    |. . |||. | ||| ||||   ||||.|||||.|.|| |||
Sbjct:  24 VWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQII 83

Query:  81 LVCTPSLCFITYSVHQSAKQK 101
            |  |.| .. .  .   |..
Sbjct:  84 FVSVPTLLYLAHVFYVMRKEE 104

>hg18||uc004dzf |X|X04325|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000157|gap
        junction protein, beta 1, 32kDa (connexin

          Length = 283

 Score =  90 bits (222), Expect = 3e-018
 Identities = 53/114 (46%), Positives = 68/114 (59%), Gaps = 4/114 (3%)

Query: 158 PRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPC 216
           |  |   |  ||     .   ||| ||||   |  |.   | || |...  . .|| |||
Sbjct: 114 PLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPC 173

Query: 217 LKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIRGVQAR 270
              |.|.|||||||||| ||| | ||||..||.||. .|    |.|  |  | |
Sbjct: 174 PNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYL---IIRACARRAQRR 224

>hg18||uc004dzg |X|NM_000166|P08034|CXB1_HUMAN|GJB1|NM_000166|NP_000157|gap
        junction protein, beta 1, 32kDa (connexin

          Length = 283

 Score =  90 bits (222), Expect = 3e-018
 Identities = 53/114 (46%), Positives = 68/114 (59%), Gaps = 4/114 (3%)

Query: 158 PRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPC 216
           |  |   |  ||     .   ||| ||||   |  |.   | || |...  . .|| |||
Sbjct: 114 PLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPC 173

Query: 217 LKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKAAIRGVQAR 270
              |.|.|||||||||| ||| | ||||..||.||. .|    |.|  |  | |
Sbjct: 174 PNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYL---IIRACARRAQRR 224

>hg18||uc001umz |13|NM_006783|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  89 bits (219), Expect = 6e-018
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . .||. |||..|. .  . |. |||  |.||||||||   |||  ||.|||| |  |.|
Sbjct:  23 VWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLI 82

Query:  81 LVCTPSL---CFITYSVHQSAKQ 100
            | ||.|     . |  |.. ..
Sbjct:  83 FVSTPALLVAMHVAYYRHETTRK 105

>hg18||uc001una |13|AY789475|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  89 bits (219), Expect = 6e-018
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . .||. |||..|. .  . |. |||  |.||||||||   |||  ||.|||| |  |.|
Sbjct:  23 VWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLI 82

Query:  81 LVCTPSL---CFITYSVHQSAKQ 100
            | ||.|     . |  |.. ..
Sbjct:  83 FVSTPALLVAMHVAYYRHETTRK 105

>hg18||uc001unb |13|AY789476|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  89 bits (219), Expect = 6e-018
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . .||. |||..|. .  . |. |||  |.||||||||   |||  ||.|||| |  |.|
Sbjct:  23 VWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLI 82

Query:  81 LVCTPSL---CFITYSVHQSAKQ 100
            | ||.|     . |  |.. ..
Sbjct:  83 FVSTPALLVAMHVAYYRHETTRK 105

>hg18||uc001unc |13|AK075247|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  89 bits (219), Expect = 6e-018
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . .||. |||..|. .  . |. |||  |.||||||||   |||  ||.|||| |  |.|
Sbjct:  23 VWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLI 82

Query:  81 LVCTPSL---CFITYSVHQSAKQ 100
            | ||.|     . |  |.. ..
Sbjct:  83 FVSTPALLVAMHVAYYRHETTRK 105

>hg18||uc001und |13|AY789474|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  89 bits (219), Expect = 6e-018
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           . .||. |||..|. .  . |. |||  |.||||||||   |||  ||.|||| |  |.|
Sbjct:  23 VWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLI 82

Query:  81 LVCTPSL---CFITYSVHQSAKQ 100
            | ||.|     . |  |.. ..
Sbjct:  83 FVSTPALLVAMHVAYYRHETTRK 105

>hg18||uc001umy |13|NM_004004|P29033|CXB2_HUMAN|GJB2|NM_004004|NP_003995|gap
        junction protein beta 2

          Length = 226

 Score =  87 bits (213), Expect = 3e-017
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 153 EIPNAPRGLTHGKSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFEC 211
           || .  . .   |. ||| .  .   |   . ||   |  |.   | .| |||.  . .|
Sbjct: 110 EIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKC 169

Query: 212 DRYPCLKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHL 255
           . .||   |.|.|||||||||| ||| ||||||..||. || .|
Sbjct: 170 NAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213

>hg18||uc001bxu |1|NM_005268|O95377|CXB5_HUMAN|GJB5|NM_005268|NP_005259|gap
        junction protein, beta 5 (connexin 31.1)

          Length = 273

 Score =  85 bits (209), Expect = 8e-017
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |..| |||.|.  .  | |. |.   | ||| ||||.  |.|. ||.||.| |  |.|
Sbjct:  23 IWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGCSNVCFDEFFPVSHVRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
           ||  |||  . .  ..  ..|  |
Sbjct:  83 LVTCPSLLVVMHVAYREVQEKRHR 106

>hg18||uc001bxx |1|NM_024009|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_076872|connexin
        31

          Length = 270

 Score =  85 bits (209), Expect = 8e-017
 Identities = 38/84 (45%), Positives = 52/84 (61%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |.|| .||.|.  .  | |. |||  | ||| ||||   |||  ||||.|| |  |.|
Sbjct:  23 IWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFPISNIRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            |  |||  | .  ..  ...  |
Sbjct:  83 FVTCPSLLVILHVAYREERERRHR 106

>hg18||uc001bxy
        |1|NM_001005752|O75712|CXB3_HUMAN|GJB3|NM_001005752|NP_001005752|connex
        in 31

          Length = 270

 Score =  85 bits (209), Expect = 8e-017
 Identities = 38/84 (45%), Positives = 52/84 (61%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |.|| .||.|.  .  | |. |||  | ||| ||||   |||  ||||.|| |  |.|
Sbjct:  23 IWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFPISNIRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            |  |||  | .  ..  ...  |
Sbjct:  83 FVTCPSLLVILHVAYREERERRHR 106

>hg18||uc001bxz |1|AF052692|O75712|CXB3_HUMAN|GJB3|NM_024009|NP_076872|connexin
        31

          Length = 270

 Score =  85 bits (209), Expect = 8e-017
 Identities = 38/84 (45%), Positives = 52/84 (61%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | |.|| .||.|.  .  | |. |||  | ||| ||||   |||  ||||.|| |  |.|
Sbjct:  23 IWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFPISNIRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
            |  |||  | .  ..  ...  |
Sbjct:  83 FVTCPSLLVILHVAYREERERRHR 106

>hg18||uc001iyy
        |10|NM_153368|Q96KN9|Q96KN9_HUMAN|CX40.1|NM_153368|NP_699199|connexin40
        .1

          Length = 370

 Score =  85 bits (209), Expect = 8e-017
 Identities = 33/74 (44%), Positives = 49/74 (66%)

Query:  25 VVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQIILVCT 84
           . .. |.|.. . |  ||.|||  |.||||||||   |||   |.||.|.|. | . |  
Sbjct:  28 LTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPGCANVCYDVFSPVSHLRFWLIQGVCVLL 87

Query:  85 PSLCFITYSVHQSA 98
           ||  |  | .|. |
Sbjct:  88 PSAVFSVYVLHRGA 101

>hg18||uc002huo |17|NM_152219|Q6ZUW6|Q6ZUW6_HUMAN|GJC1|NM_152219|NP_689343|gap
        junction protein, chi 1, 31.9kDa (connexin

          Length = 295

 Score =  85 bits (208), Expect = 1e-016
 Identities = 47/113 (41%), Positives = 62/113 (54%), Gaps = 5/113 (4%)

Query: 177 RFYVIQVVFRNALEIGFLAGQYFLYGFSVPGIFECDRYPCLKEVECYVSRPTEKTVFLVF 236
           | |.. |  |   |. || ||  |||| |   | |   ||   |.|.||||||||||..|
Sbjct: 134 RCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLF 193

Query: 237 MFAVSGICVVLNLAELNHLGWRKIKAAIRGVQARRKSICEIRKKDMAHLSQPP 289
            |||  .  .|..||| || |.      |     | . |    ..   |  ||
Sbjct: 194 YFAVGLLSALLSVAELGHLLWKG-----RPRAGERDNRCNRAHEEAQKLLPPP 241

>hg18||uc003plo |6|NM_198568|Q6PEY0|CXB7_HUMAN|GJB7|NM_198568|NP_940970|gap
        junction protein, beta 7

          Length = 223

 Score =  85 bits (208), Expect = 1e-016
 Identities = 36/84 (42%), Positives = 52/84 (61%)

Query:  21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
           | | || .||.|.  .  | |..|||  | ||. ||||   |.|  |||| .| |  |.|
Sbjct:  23 IWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLI 82

Query:  81 LVCTPSLCFITYSVHQSAKQKDRR 104
           .| ||||  . .  .   ..|  |
Sbjct:  83 MVSTPSLLVVLHVAYHEGREKRHR 106

>hg18||uc003plo |6|NM_198568|Q6PEY0|CXB7_HUMAN|GJB7|NM_198568|NP_940970|gap
        junction protein, beta 7

          Length = 223

 Score =  82 bits (202), Expect = 5e-016
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)

Query: 174 GISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPCLKEVECYVSRPTEKTV 232
           |.   |.| .. .   |||||   | || ||||| . .||  ||   |.|..|.|||||.
Sbjct: 119 GLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTI 178

Query: 233 FLVFMFAVSGICVVLNLAELNHL 255
           |..|.   | .|.|||  ||. |
Sbjct: 179 FILFLVITSCLCIVLNFIELSFL 201

>hg18||uc003usg |7|NM_181538|Q8NFK1|CXE1_HUMAN|GJE1|NM_181538|NP_853516|gap
        junction protein, epsilon 1, 29kDa

          Length = 279

 Score =  82 bits (202), Expect = 5e-016
 Identities = 34/75 (45%), Positives = 55/75 (73%)

Query: 21 ILLTVVVIFRILIVAIVGETVYEDEQTMFICNTLQPGCNQACYDKAFPISHIRYWVFQII 80
          .|| |.. ||....|  |  || |||. |.|.| ||||  ||.|   |.| .|.||||.|
Sbjct: 23 LLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVI 82

Query: 81 LVCTPSLCFITYSVH 95
          ||  ||  .. ....
Sbjct: 83 LVAVPSALYMGFTLY 97

>hg18||uc001umz |13|NM_006783|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  79 bits (194), Expect = 5e-015
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 165 KSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPCLKEVECY 223
           |  ||| .  .   |   . ||   |  |.   |||| |. .| . .|   ||   |.|.
Sbjct: 122 KKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCF 181

Query: 224 VSRPTEKTVFLVFMFAVSGICVVLNLAELNHL 255
           .||||||||| .|| . | ||..||.||| .|
Sbjct: 182 ISRPTEKTVFTIFMISASVICMLLNVAELCYL 213

>hg18||uc001una |13|AY789475|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  79 bits (194), Expect = 5e-015
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 165 KSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPCLKEVECY 223
           |  ||| .  .   |   . ||   |  |.   |||| |. .| . .|   ||   |.|.
Sbjct: 122 KKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCF 181

Query: 224 VSRPTEKTVFLVFMFAVSGICVVLNLAELNHL 255
           .||||||||| .|| . | ||..||.||| .|
Sbjct: 182 ISRPTEKTVFTIFMISASVICMLLNVAELCYL 213

>hg18||uc001unb |13|AY789476|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  79 bits (194), Expect = 5e-015
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 165 KSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPCLKEVECY 223
           |  ||| .  .   |   . ||   |  |.   |||| |. .| . .|   ||   |.|.
Sbjct: 122 KKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCF 181

Query: 224 VSRPTEKTVFLVFMFAVSGICVVLNLAELNHL 255
           .||||||||| .|| . | ||..||.||| .|
Sbjct: 182 ISRPTEKTVFTIFMISASVICMLLNVAELCYL 213

>hg18||uc001unc |13|AK075247|O95452|CXB6_HUMAN|GJB6|NM_006783|NP_006774|gap
        junction protein, beta 6 (connexin 30)

          Length = 261

 Score =  79 bits (194), Expect = 5e-015
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 165 KSSKVRRQEGISRFYVIQVVFRNALEIGFLAGQYFLY-GFSVPGIFECDRYPCLKEVECY 223
           |  ||| .  .   |   . ||   |  |.   |||| |. .| . .|   ||   |.|.
Sbjct: 122 KKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCF 181

Query: 224 VSRPTEKTVFLVFMFAVSGICVVLNLAELNHL 255
           .||||||||| .|| . | ||..||.||| .|
Sbjct: 182 ISRPTEKTVFTIFMISASVICMLLNVAELCYL 213

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0