BLASTP 7.6.0


Query=fugu4_746386 |jgi|Takru4|746386|fgh5_pg.C_scaffold_3605000003
        (287 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003ytk |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|N...    236   3e-062
hg18||uc002ima |17|NM_033413|Q96FV0|LRC46_HUMAN|LRRC46|NM_033413...     74   2e-013
hg18||uc001qrp |12|NM_201650|Q53EV4|LRC23_HUMAN|LRRC23|NM_201650...     67   2e-011
hg18||uc001qrr |12|CR595324|NA|NA|B7|NA|NA|Homo sapiens mRNA for...     67   2e-011
hg18||uc001qrt |12|AK223535|Q53EV4|LRC23_HUMAN|LRRC23|NM_201650|...     67   2e-011
hg18||uc004bkw |9|BC089415|Q5JVD3|Q5JVD3_HUMAN|CEP1|NA|NA|Centro...     64   1e-010
hg18||uc004bkx |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018...     64   1e-010
hg18||uc002wat |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|...     64   2e-010
hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP...     64   2e-010
hg18||uc002wav |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|N...     64   2e-010
hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP...     63   3e-010
hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     63   4e-010
hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     63   4e-010
hg18||uc002wat |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|...     63   4e-010
hg18||uc002wav |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|N...     63   4e-010
hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     60   4e-009
hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     60   4e-009
hg18||uc002wat |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|...     60   4e-009
hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP...     60   4e-009
hg18||uc002wav |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|N...     60   4e-009
hg18||uc002imb |17|AK027206|NA|NA|LRRC46|NA|NA|Homo sapiens cDNA...     59   6e-009
hg18||uc002asu |15|AK123672|Q8IUZ0|LRC49_HUMAN|LRRC49|NM_017691|...     58   1e-008
hg18||uc002asw |15|NM_017691|Q8IUZ0|LRC49_HUMAN|LRRC49|NM_017691...     58   1e-008
hg18||uc002asx |15|BC026157|NA|NA|LRRC49|NA|NA|Homo sapiens cDNA...     58   1e-008
hg18||uc002asz |15|AK097752|NA|NA|LRRC49|NA|NA|Homo sapiens cDNA...     58   1e-008
hg18||uc003xxc |8|NM_001013626|Q7Z4L9|Q7Z4L9_HUMAN|LOC286187|NM_...     57   2e-008
hg18||uc002gsa |17|BC050665|NA|NA|LRRC48|NM_031294|NP_112584|leu...     57   3e-008
hg18||uc002gsb |17|NM_031294|NA|NA|LRRC48|NM_031294|NP_112584|le...     57   3e-008
hg18||uc002fhl |16|NM_178452|Q8NEP3|LRC50_HUMAN|LRRC50|NM_178452...     54   2e-007
hg18||uc002arl |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305...     54   3e-007
hg18||uc002fhl |16|NM_178452|Q8NEP3|LRC50_HUMAN|LRRC50|NM_178452...     52   8e-007
hg18||uc003xxc |8|NM_001013626|Q7Z4L9|Q7Z4L9_HUMAN|LOC286187|NM_...     52   8e-007
hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     50   3e-006
hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     50   3e-006
hg18||uc003dvk |3|NM_024548|Q8IW35|LRIQ2_HUMAN|LRRIQ2|NM_024548|...     50   3e-006
hg18||uc004aya |9|NM_006401|Q92688|AN32B_HUMAN|ANP32B|NM_006401|...     49   8e-006
hg18||uc001xoq |14|NM_031427|Q9BS43|Q9BS43_HUMAN|DNAL1|NM_031427...     47   2e-005
hg18||uc001dsw |1|NM_144620|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|...     45   1e-004
hg18||uc001dsx |1|AY358131|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|N...     45   1e-004
hg18||uc001dsy |1|AL833417|Q96DD0-2|Q96DD0-2|LRRC39|NA|NA|Leucin...     45   1e-004
hg18||uc001dsz |1|BC022420|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|N...     45   1e-004
hg18||uc004bkw |9|BC089415|Q5JVD3|Q5JVD3_HUMAN|CEP1|NA|NA|Centro...     45   1e-004
hg18||uc004bkx |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018...     45   1e-004
hg18||uc003ytk |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|N...     44   3e-004
hg18||uc001tab |12|NM_032165|Q96JM4|Q96JM4_HUMAN|LRRIQ1|NM_03216...     43   5e-004
hg18||uc001tac |12|NM_001079910|NA|NA|LRRIQ1|NM_001079910|NP_001...     43   5e-004
hg18||uc001dnh |1|BC030607|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|N...     42   8e-004
hg18||uc001dni |1|BC060782|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|N...     42   8e-004
hg18||uc001dnj |1|NM_015350|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|...     42   8e-004
hg18||uc003dec |3|BC050552|NA|NA|KIAA0975|NA|NA|Homo sapiens mRN...     40   0.002
hg18||uc003ded |3|NM_007184|Q9UES6|Q9UES6_HUMAN|NISCH|NM_007184|...     40   0.002
hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP...     39   0.005
hg18||uc002wat |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|...     39   0.005
hg18||uc003fgb |3|NM_001080460|NA|NA|LOC344657|NM_001080460|NP_0...     36   0.043
hg18||uc002fhl |16|NM_178452|Q8NEP3|LRC50_HUMAN|LRRC50|NM_178452...     36   0.056
hg18||uc003juh |5|BC050692|NA|NA|ERBB2IP|NM_001006600|NP_0010066...     36   0.056
hg18||uc003jui |5|NM_018695|Q96RT1-2|Q96RT1-2|ERBB2IP|NM_018695|...     36   0.056
hg18||uc003juj |5|NM_001006600|Q96RT1-7|Q96RT1-7|ERBB2IP|NM_0010...     36   0.056
hg18||uc003juk |5|AF276423|Q96RT1|LAP2_HUMAN|ERBB2IP|NM_018695|N...     36   0.056
hg18||uc003jul |5|BC115015|Q96RT1-2|Q96RT1-2|ERBB2IP|NM_018695|N...     36   0.056
hg18||uc003qbi |6|NM_001010923|Q8N1K5|CF190_HUMAN|C6orf190|NM_00...     34   0.212
hg18||uc001mxa |11|NM_020929|Q9HCJ2|NGL1_HUMAN|LRRC4C|NM_020929|...     33   0.472
hg18||uc001mxb |11|BC041374|Q9HCJ2|NGL1_HUMAN|LRRC4C|NM_020929|N...     33   0.472
hg18||uc001mxc |11|DQ084201|Q9HCJ2|NGL1_HUMAN|LRRC4C|NM_020929|N...     33   0.472
hg18||uc001mxd |11|DQ084202|Q9HCJ2|NGL1_HUMAN|LRRC4C|NM_020929|N...     33   0.472
hg18||uc001sqr |12|NM_153377|Q6UXM1|LRIG3_HUMAN|LRIG3|NM_153377|...     32   0.617
hg18||uc002ima |17|NM_033413|Q96FV0|LRC46_HUMAN|LRRC46|NM_033413...     32   0.617
hg18||uc003yew |8|AK097393|NA|NA|AK097393|NA|NA|Homo sapiens cDN...     32   1.052
hg18||uc001kzl |10|AF054828|Q9UQ13|SHOC2_HUMAN|SHOC2|NM_007373|N...     31   1.374
hg18||uc001kzm |10|NM_007373|Q9UQ13|SHOC2_HUMAN|SHOC2|NM_007373|...     31   1.374
hg18||uc001kzn |10|AX746632|Q5VZS9|Q5VZS9_HUMAN|SHOC2|NM_007373|...     31   1.374
hg18||uc004bjz |9|NM_138554|O00206|TLR4_HUMAN|TLR4|NM_138554|NP_...     31   1.374
hg18||uc004bka |9|U88880|Q5VZI8|Q5VZI8_HUMAN|TLR4|NM_138554|NP_6...     31   1.374
hg18||uc003yew |8|AK097393|NA|NA|AK097393|NA|NA|Homo sapiens cDN...     30   3.061
hg18||uc002pss |19|NM_001080457|Q9NT99|LRC4B_HUMAN|LRRC4B|NM_001...     30   3.998
hg18||uc003ceu |3|AB209872|Q59ED9|Q59ED9_HUMAN|OSBPL10|NM_017784...     30   3.998
hg18||uc003cev |3|NM_017784|Q9BXB5|OSB10_HUMAN|OSBPL10|NM_017784...     30   3.998
hg18||uc003ycw |8|NM_033402|Q8N768|Q8N768_HUMAN|LRRCC1|NM_033402...     29   5.221
hg18||uc003ycx |8|NM_001077501|Q9C099|Q9C099_HUMAN|LRRCC1|NM_001...     29   5.221
hg18||uc003ycy |8|AB051551|Q9C099|Q9C099_HUMAN|LRRCC1|NM_0010775...     29   5.221
hg18||uc001dga |1|NM_145258|Q8WUE0|Q8WUE0_HUMAN|LRRC44|NM_145258...     28   8.906
hg18||uc002qyp |2|NM_080657|Q8WXG1|Q8WXG1_HUMAN|RSAD2|NM_080657|...     28   8.906

>hg18||uc003ytk
        |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|NP_036604|leucine rich
        repeat containing 6

          Length = 466

 Score =  236 bits (601), Expect = 3e-062
 Identities = 113/160 (70%), Positives = 134/160 (83%)

Query:   1 MVFITEEMIRMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRME 60
           | .|||..||  |||||  | ||||.||||| ||..||.|.|||.||||||||||| ..|
Sbjct:   1 MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE 60

Query:  61 NLGHLKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFL 120
           |.  ||||.|||||||||| |||||||| | ||||||||.| |||.. |.|| || ||||
Sbjct:  61 NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL 120

Query: 121 VGNPCTKFQGYREYVVVTLPQLKWLDGAKISRSERIRACQ 160
           .||||  |  |||.|| |||||||||| .|  ||||.| |
Sbjct: 121 MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQ 160

>hg18||uc002ima
        |17|NM_033413|Q96FV0|LRC46_HUMAN|LRRC46|NM_033413|NP_219481|leucine
        rich repeat containing 46

          Length = 321

 Score =  74 bits (179), Expect = 2e-013
 Identities = 52/129 (40%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           |. | | .. |  | .|.   .||  |||| | | ..|||  .  |..|.|| | |  .|
Sbjct:  46 LQTVRLDREGITTIRNLE-GLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVE 104

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERLKHNPH-LTELFLVGNPCTKFQGYREYVVVTLPQ 141
           ||     |. |||. | .  |    .|   |  |  | | || ||   |||| |   || 
Sbjct: 105 NLLDLPCLQFLDLSENLIETL----KLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPL 160

Query: 142 LKWLDGAKI 150
           |  |||  .
Sbjct: 161 LLDLDGQPV 169

>hg18||uc001qrp
        |12|NM_201650|Q53EV4|LRC23_HUMAN|LRRC23|NM_201650|NP_964013|leucine-ric
        h repeat-containing protein 23

          Length = 343

 Score =  67 bits (162), Expect = 2e-011
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 3/151 (1%)

Query:   9 IRMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKL 68
           | |    . ... ||  | |    .|    ..     || |||  |.. ..| |  |  |
Sbjct: 167 IHMVTGLDPEKLISLHTVELRGNQLESTLGIN--LPKLKNLYLAQNMLKKVEGLEDLSNL 224

Query:  69 QYLNLALNNIEVIENL-EGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTK 127
             |.|  | |. .       .||. |.|  | |  |  . .|.  | |  | |. |||| 
Sbjct: 225 TTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTD 284

Query: 128 FQGYREYVVVTLPQLKWLDGAKISRSERIRA 158
              ||.  .| .| |. ||       ||  |
Sbjct: 285 ETSYRQEALVQMPYLERLDKEFYEEEERAEA 315

>hg18||uc001qrr |12|CR595324|NA|NA|B7|NA|NA|Homo sapiens mRNA for leucine-rich
        B7 protein isoform 1 variant, clone: FCC124H12

          Length = 292

 Score =  67 bits (162), Expect = 2e-011
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 3/151 (1%)

Query:   9 IRMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKL 68
           | |    . ... ||  | |    .|    ..     || |||  |.. ..| |  |  |
Sbjct: 116 IHMVTGLDPEKLISLHTVELRGNQLESTLGIN--LPKLKNLYLAQNMLKKVEGLEDLSNL 173

Query:  69 QYLNLALNNIEVIENL-EGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTK 127
             |.|  | |. .       .||. |.|  | |  |  . .|.  | |  | |. |||| 
Sbjct: 174 TTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTD 233

Query: 128 FQGYREYVVVTLPQLKWLDGAKISRSERIRA 158
              ||.  .| .| |. ||       ||  |
Sbjct: 234 ETSYRQEALVQMPYLERLDKEFYEEEERAEA 264

>hg18||uc001qrt
        |12|AK223535|Q53EV4|LRC23_HUMAN|LRRC23|NM_201650|NP_964013|leucine-rich
        repeat-containing protein 23

          Length = 343

 Score =  67 bits (162), Expect = 2e-011
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 3/151 (1%)

Query:   9 IRMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKL 68
           | |    . ... ||  | |    .|    ..     || |||  |.. ..| |  |  |
Sbjct: 167 IHMVTGLDPEKLISLHTVELRGNQLESTLGIN--LPKLKNLYLAQNMLKKVEGLEDLSNL 224

Query:  69 QYLNLALNNIEVIENL-EGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTK 127
             |.|  | |. .       .||. |.|  | |  |  . .|.  | |  | |. |||| 
Sbjct: 225 TTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTD 284

Query: 128 FQGYREYVVVTLPQLKWLDGAKISRSERIRA 158
              ||.  .| .| |. ||       ||  |
Sbjct: 285 ETSYRQEALVQMPYLERLDKEFYEEEERAEA 315

>hg18||uc004bkw |9|BC089415|Q5JVD3|Q5JVD3_HUMAN|CEP1|NA|NA|Centrosomal protein
        1

          Length = 448

 Score =  64 bits (155), Expect = 1e-010
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 3/148 (2%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | ..   || ..|    | ||| ||.  . |. | |  | | ..| . ..  || |||| 
Sbjct: 120 NLEKCVKLEVLNLSYNLIGKIEKLDKLLK-LRELNLSYNKISKIEGIENMCNLQKLNLAG 178

Query:  76 NNIEVIENLEG--CESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQGYRE 133
           | || |    |   .||  |.|  | .  |  . .||    |  | || ||      | .
Sbjct: 179 NEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQ 238

Query: 134 YVVVTLPQLKWLDGAKISRSERIRACQR 161
           . .  |  |. |.|  ..  .|  | .|
Sbjct: 239 FTIFHLRSLESLEGQPVTTQDRQEAFER 266

>hg18||uc004bkx
        |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018|NP_008949|centrosomal
        protein 110kDa

          Length = 2325

 Score =  64 bits (155), Expect = 1e-010
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 3/148 (2%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | ..   || ..|    | ||| ||.  . |. | |  | | ..| . ..  || |||| 
Sbjct: 120 NLEKCVKLEVLNLSYNLIGKIEKLDKLLK-LRELNLSYNKISKIEGIENMCNLQKLNLAG 178

Query:  76 NNIEVIENLEG--CESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQGYRE 133
           | || |    |   .||  |.|  | .  |  . .||    |  | || ||      | .
Sbjct: 179 NEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQ 238

Query: 134 YVVVTLPQLKWLDGAKISRSERIRACQR 161
           . .  |  |. |.|  ..  .|  | .|
Sbjct: 239 FTIFHLRSLESLEGQPVTTQDRQEAFER 266

>hg18||uc002wat
        |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 360

 Score =  64 bits (153), Expect = 2e-010
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query:  10 RMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQ 69
           |.||  |   . .|| . | .  | |...||    || .| .|.| . ..| | .|  |.
Sbjct: 197 RIRAIENIDTLTNLESLFLGKNKITKLQNLDA-LTNLTVLSMQSNRLTKIEGLQNLVNLR 255

Query:  70 YLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
            | |. | ||||| ||    |  ||.  |   |.  .| . |   | | ..  |
Sbjct: 256 ELYLSHNGIEVIEGLENNNKLTMLDIASN---RIKKIENISHLTELQEFWMNDN 306

>hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 317

 Score =  64 bits (153), Expect = 2e-010
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query:  10 RMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQ 69
           |.||  |   . .|| . | .  | |...||    || .| .|.| . ..| | .|  |.
Sbjct: 154 RIRAIENIDTLTNLESLFLGKNKITKLQNLDA-LTNLTVLSMQSNRLTKIEGLQNLVNLR 212

Query:  70 YLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
            | |. | ||||| ||    |  ||.  |   |.  .| . |   | | ..  |
Sbjct: 213 ELYLSHNGIEVIEGLENNNKLTMLDIASN---RIKKIENISHLTELQEFWMNDN 263

>hg18||uc002wav
        |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 286

 Score =  64 bits (153), Expect = 2e-010
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query:  10 RMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQ 69
           |.||  |   . .|| . | .  | |...||    || .| .|.| . ..| | .|  |.
Sbjct: 123 RIRAIENIDTLTNLESLFLGKNKITKLQNLDA-LTNLTVLSMQSNRLTKIEGLQNLVNLR 181

Query:  70 YLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
            | |. | ||||| ||    |  ||.  |   |.  .| . |   | | ..  |
Sbjct: 182 ELYLSHNGIEVIEGLENNNKLTMLDIASN---RIKKIENISHLTELQEFWMNDN 232

>hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 317

 Score =  63 bits (152), Expect = 3e-010
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query:  11 MRAEHN---DKEICSL----EEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLG 63
           |  ||    | |  .|    |.| |.   | |||  .   . .| | |. |||  .||| 
Sbjct:  16 MEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFE-VLKKVKTLCLRQNLIKCIENLE 74

Query:  64 HLKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
            |. |. |.|  | |. |||||    || ||.. | .  .  |..|     | .|||| |
Sbjct:  75 ELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNN 131

Query: 124 PCTKFQ 129
             .| .
Sbjct: 132 KISKIE 137

>hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 274

 Score =  63 bits (151), Expect = 4e-010
 Identities = 49/139 (35%), Positives = 72/139 (51%), Gaps = 19/139 (13%)

Query:  24 EEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIEN 83
           |.| |.   | |||  .  |       |. |||  .|||  |. |. |.|  | |. |||
Sbjct:  79 EDVDLNHYRIGKIEGFETLC-------LRQNLIKCIENLEELQSLRELDLYDNQIKKIEN 131

Query:  84 LEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQGYREYVVVTLPQLK 143
           ||    || ||.. | .  .  |..|     | .|||| |  .| .      .  | ||.
Sbjct: 132 LEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN-----LSNLHQLQ 183

Query: 144 WLDGAKISRSERIRACQRM 162
            |.      | |||| . .
Sbjct: 184 MLE----LGSNRIRAIENI 198

>hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 280

 Score =  63 bits (151), Expect = 4e-010
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  24 EEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIEN 83
           |.| |.   | |||  .   . .| | |. |||  .|||  |. |. |.|  | |. |||
Sbjct:  79 EDVDLNHYRIGKIEGFE-VLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIEN 137

Query:  84 LEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           ||    || ||.. | .  .  |..|     | .|||| |  .| .
Sbjct: 138 LEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIE 180

>hg18||uc002wat
        |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 360

 Score =  63 bits (151), Expect = 4e-010
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  24 EEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIEN 83
           |.| |.   | |||  .   . .| | |. |||  .|||  |. |. |.|  | |. |||
Sbjct:  79 EDVDLNHYRIGKIEGFE-VLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIEN 137

Query:  84 LEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           ||    || ||.. | .  .  |..|     | .|||| |  .| .
Sbjct: 138 LEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIE 180

>hg18||uc002wav
        |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 286

 Score =  63 bits (151), Expect = 4e-010
 Identities = 49/139 (35%), Positives = 72/139 (51%), Gaps = 19/139 (13%)

Query:  24 EEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIEN 83
           |.| |.   | |||  .  |       |. |||  .|||  |. |. |.|  | |. |||
Sbjct:  11 EDVDLNHYRIGKIEGFETLC-------LRQNLIKCIENLEELQSLRELDLYDNQIKKIEN 63

Query:  84 LEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQGYREYVVVTLPQLK 143
           ||    || ||.. | .  .  |..|     | .|||| |  .| .      .  | ||.
Sbjct:  64 LEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN-----LSNLHQLQ 115

Query: 144 WLDGAKISRSERIRACQRM 162
            |.      | |||| . .
Sbjct: 116 MLE----LGSNRIRAIENI 130

>hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 274

 Score =  60 bits (143), Expect = 4e-009
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|. || |. |.   |.|||.|.     |.|| .  ||.  .| .  | .|. | |  
Sbjct: 109 NLEELQSLRELDLYDNQIKKIENLEA-LTELEILDISFNLLRNIEGVDKLTRLKKLFLVN 167

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           | |  ||||     |. |.|  |   |. ..| .    .|  |||  |  || |
Sbjct: 168 NKISKIENLSNLHQLQMLELGSN---RIRAIENIDTLTNLESLFLGKNKITKLQ 218

>hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 280

 Score =  60 bits (143), Expect = 4e-009
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|. || |. |.   |.|||.|.     |.|| .  ||.  .| .  | .|. | |  
Sbjct: 115 NLEELQSLRELDLYDNQIKKIENLEA-LTELEILDISFNLLRNIEGVDKLTRLKKLFLVN 173

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           | |  ||||     |. |.|  |   |. ..| .    .|  |||  |  || |
Sbjct: 174 NKISKIENLSNLHQLQMLELGSN---RIRAIENIDTLTNLESLFLGKNKITKLQ 224

>hg18||uc002wat
        |2|NM_002712|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 360

 Score =  60 bits (143), Expect = 4e-009
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|. || |. |.   |.|||.|.     |.|| .  ||.  .| .  | .|. | |  
Sbjct: 115 NLEELQSLRELDLYDNQIKKIENLEA-LTELEILDISFNLLRNIEGVDKLTRLKKLFLVN 173

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           | |  ||||     |. |.|  |   |. ..| .    .|  |||  |  || |
Sbjct: 174 NKISKIENLSNLHQLQMLELGSN---RIRAIENIDTLTNLESLFLGKNKITKLQ 224

>hg18||uc002wau |2|BC051689|Q15435-2|Q15435-2|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 317

 Score =  60 bits (143), Expect = 4e-009
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|. || |. |.   |.|||.|.     |.|| .  ||.  .| .  | .|. | |  
Sbjct:  72 NLEELQSLRELDLYDNQIKKIENLEA-LTELEILDISFNLLRNIEGVDKLTRLKKLFLVN 130

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           | |  ||||     |. |.|  |   |. ..| .    .|  |||  |  || |
Sbjct: 131 NKISKIENLSNLHQLQMLELGSN---RIRAIENIDTLTNLESLFLGKNKITKLQ 181

>hg18||uc002wav
        |2|CR611666|Q15435|PP1R7_HUMAN|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 286

 Score =  60 bits (143), Expect = 4e-009
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|. || |. |.   |.|||.|.     |.|| .  ||.  .| .  | .|. | |  
Sbjct:  41 NLEELQSLRELDLYDNQIKKIENLEA-LTELEILDISFNLLRNIEGVDKLTRLKKLFLVN 99

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQ 129
           | |  ||||     |. |.|  |   |. ..| .    .|  |||  |  || |
Sbjct: 100 NKISKIENLSNLHQLQMLELGSN---RIRAIENIDTLTNLESLFLGKNKITKLQ 150

>hg18||uc002imb |17|AK027206|NA|NA|LRRC46|NA|NA|Homo sapiens cDNA: FLJ23553 fis,
        clone LNG09301

          Length = 274

 Score =  59 bits (141), Expect = 6e-009
 Identities = 42/102 (41%), Positives = 55/102 (53%), Gaps = 6/102 (5%)

Query:  50 YLQNNLIPRMENLGHLKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSSVERL 109
           .|||  | ..|||  .  |..|.|| | |  .|||     |. |||. | .  |    .|
Sbjct:  26 FLQNK-IQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETL----KL 80

Query: 110 KHNPH-LTELFLVGNPCTKFQGYREYVVVTLPQLKWLDGAKI 150
              |  |  | | || ||   |||| |   || |  |||  .
Sbjct:  81 DEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPV 122

>hg18||uc002asu
        |15|AK123672|Q8IUZ0|LRC49_HUMAN|LRRC49|NM_017691|NP_060161|leucine rich
        repeat containing 49

          Length = 676

 Score =  58 bits (139), Expect = 1e-008
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           |  . | .  |.|| .|.   ..| .| |  | | ..||. || .|. |||| | .  ..
Sbjct: 148 LRVLLLGKNRIKKISNLEN-LKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVD 206

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKF 128
           || | .|| .|.|  | .  .  |. |   | |  |||  |  . |
Sbjct: 207 NLNGLDSLTELNLRHNQITFVRDVDNL---PCLQHLFLSFNNISSF 249

>hg18||uc002asw
        |15|NM_017691|Q8IUZ0|LRC49_HUMAN|LRRC49|NM_017691|NP_060161|leucine
        rich repeat containing 49

          Length = 686

 Score =  58 bits (139), Expect = 1e-008
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           |  . | .  |.|| .|.   ..| .| |  | | ..||. || .|. |||| | .  ..
Sbjct: 158 LRVLLLGKNRIKKISNLEN-LKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVD 216

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKF 128
           || | .|| .|.|  | .  .  |. |   | |  |||  |  . |
Sbjct: 217 NLNGLDSLTELNLRHNQITFVRDVDNL---PCLQHLFLSFNNISSF 259

>hg18||uc002asx |15|BC026157|NA|NA|LRRC49|NA|NA|Homo sapiens cDNA FLJ20156 fis,
        clone COL08823

          Length = 642

 Score =  58 bits (139), Expect = 1e-008
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           |  . | .  |.|| .|.   ..| .| |  | | ..||. || .|. |||| | .  ..
Sbjct: 114 LRVLLLGKNRIKKISNLEN-LKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVD 172

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKF 128
           || | .|| .|.|  | .  .  |. |   | |  |||  |  . |
Sbjct: 173 NLNGLDSLTELNLRHNQITFVRDVDNL---PCLQHLFLSFNNISSF 215

>hg18||uc002asz |15|AK097752|NA|NA|LRRC49|NA|NA|Homo sapiens cDNA FLJ20156 fis,
        clone COL08823

          Length = 658

 Score =  58 bits (139), Expect = 1e-008
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           |  . | .  |.|| .|.   ..| .| |  | | ..||. || .|. |||| | .  ..
Sbjct: 130 LRVLLLGKNRIKKISNLEN-LKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVD 188

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKF 128
           || | .|| .|.|  | .  .  |. |   | |  |||  |  . |
Sbjct: 189 NLNGLDSLTELNLRHNQITFVRDVDNL---PCLQHLFLSFNNISSF 231

>hg18||uc003xxc
        |8|NM_001013626|Q7Z4L9|Q7Z4L9_HUMAN|LOC286187|NM_001013626|NP_001013648
        |hypothetical protein LOC286187

          Length = 228

 Score =  57 bits (137), Expect = 2e-008
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIE 82
           .  ..   .||. || |   |.|| .||| .| | .. || .   | .| |  | |  ||
Sbjct:  30 ITHINFSDKNIDAIEDLS-LCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIE 88

Query:  83 NLEGCESLEKLDLTVNFVGRLSSVERL 109
           ||   . |||| |  |..  .  .| |
Sbjct:  89 NLRSLKKLEKLYLGGNYIAVIEGLEGL 115

>hg18||uc002gsa |17|BC050665|NA|NA|LRRC48|NM_031294|NP_112584|leucine rich
        repeat containing 48

          Length = 274

 Score =  57 bits (135), Expect = 3e-008
 Identities = 35/92 (38%), Positives = 59/92 (64%), Gaps = 4/92 (4%)

Query:  18 KEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNN 77
           |.. ||.   |  .|| .|..| ..  ||. | | ||.| ..| | .|  | .|.|. ||
Sbjct:  43 KDVLSLQ---LDFRNILRIDNLWQF-ENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNN 98

Query:  78 IEVIENLEGCESLEKLDLTVNFVGRLSSVERL 109
           || || |.   .|| | |  | . .. |.. |
Sbjct:  99 IETIEGLDTLVNLEDLSLFNNRISKIDSLDAL 130

>hg18||uc002gsb |17|NM_031294|NA|NA|LRRC48|NM_031294|NP_112584|leucine rich
        repeat containing 48

          Length = 523

 Score =  57 bits (135), Expect = 3e-008
 Identities = 35/92 (38%), Positives = 59/92 (64%), Gaps = 4/92 (4%)

Query:  18 KEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNN 77
           |.. ||.   |  .|| .|..| ..  ||. | | ||.| ..| | .|  | .|.|. ||
Sbjct:  43 KDVLSLQ---LDFRNILRIDNLWQF-ENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNN 98

Query:  78 IEVIENLEGCESLEKLDLTVNFVGRLSSVERL 109
           || || |.   .|| | |  | . .. |.. |
Sbjct:  99 IETIEGLDTLVNLEDLSLFNNRISKIDSLDAL 130

>hg18||uc002fhl
        |16|NM_178452|Q8NEP3|LRC50_HUMAN|LRRC50|NM_178452|NP_848547|leucine
        rich repeat containing 50

          Length = 725

 Score =  54 bits (129), Expect = 2e-007
 Identities = 38/108 (35%), Positives = 57/108 (52%), Gaps = 1/108 (0%)

Query:  16 NDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           | .|   |  . |    |.|||.|.     |. |.|| ||. ..|||  |.||  |||. 
Sbjct: 124 NLEEYTGLRCLWLQSNGIQKIENLEAQ-TELRCLFLQMNLLRKIENLEPLQKLDALNLSN 182

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           | |. ||||     |  | .  | .  .  .. |.    |  | |  |
Sbjct: 183 NYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHN 230

>hg18||uc002arl
        |15|NM_006305|P39687|AN32A_HUMAN|ANP32A|NM_006305|NP_006296|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 249

 Score =  54 bits (127), Expect = 3e-007
 Identities = 47/144 (32%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query:  10 RMRAEHNDKEICSLEEVSL--HQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKK 67
           |.  |  ..    ..|. |   . |  |.| |      |. |   |  .  . ||  | |
Sbjct:   6 RIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNK 65

Query:  68 LQYLNLALNNI----EVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           |. | |. | .    ||.   | | .|  |.|. | .  ||..| ||   .|  | |   
Sbjct:  66 LKKLELSDNRVSGGLEVL--AEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNC 123

Query: 124 PCTKFQGYREYVVVTLPQLKWLDG 147
             |    ||| |   |||| .|||
Sbjct: 124 EVTNLNDYRENVFKLLPQLTYLDG 147

>hg18||uc002fhl
        |16|NM_178452|Q8NEP3|LRC50_HUMAN|LRRC50|NM_178452|NP_848547|leucine
        rich repeat containing 50

          Length = 725

 Score =  52 bits (123), Expect = 8e-007
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 4/96 (4%)

Query:  28 LHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIENLEGC 87
           || .  ..||.|. .   |. |.||.| | ..|||    .|. | | .| .  |||||  
Sbjct: 114 LHFKGFDRIENLEEY-TGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPL 172

Query:  88 ESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           . |. |.|. |..    ..| |   | |  | .  |
Sbjct: 173 QKLDALNLSNNYI---KTIENLSCLPVLNTLQMAHN 205

>hg18||uc003xxc
        |8|NM_001013626|Q7Z4L9|Q7Z4L9_HUMAN|LOC286187|NM_001013626|NP_001013648
        |hypothetical protein LOC286187

          Length = 228

 Score =  52 bits (123), Expect = 8e-007
 Identities = 40/98 (40%), Positives = 54/98 (55%), Gaps = 5/98 (5%)

Query:  17 DKEIC-SLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQYLNLAL 75
           |  .| .|  . |.   | .| .|. .  ||  |||||| |  .|||  ||||. | |  
Sbjct:  45 DLSLCKNLSVLYLYDNCISQITNLN-YATNLTHLYLQNNCISCIENLRSLKKLEKLYLGG 103

Query:  76 NNIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNP 113
           | | ||| |||   | .| .      ||   |.|  .|
Sbjct: 104 NYIAVIEGLEGLGELRELHVENQ---RLPLGEKLLFDP 138

>hg18||uc002war |2|CR594406|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 274

 Score =  50 bits (118), Expect = 3e-006
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query:  10 RMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQ 69
           |.||  |   . .|| . | .  | |...||    || .| .|.| . ..| | .|  |.
Sbjct: 191 RIRAIENIDTLTNLESLFLGKNKITKLQNLDA-LTNLTVLSMQSNRLTKIEGLQNLVNLR 249

Query:  70 YLNLALNNIEVIENLE 85
            | |. | ||||| ||
Sbjct: 250 ELYLSHNGIEVIEGLE 265

>hg18||uc002was |2|BT007296|Q15435-3|Q15435-3|PPP1R7|NM_002712|NP_002703|protein
        phosphatase 1, regulatory subunit 7

          Length = 280

 Score =  50 bits (118), Expect = 3e-006
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query:  10 RMRAEHNDKEICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKKLQ 69
           |.||  |   . .|| . | .  | |...||    || .| .|.| . ..| | .|  |.
Sbjct: 197 RIRAIENIDTLTNLESLFLGKNKITKLQNLDA-LTNLTVLSMQSNRLTKIEGLQNLVNLR 255

Query:  70 YLNLALNNIEVIENLE 85
            | |. | ||||| ||
Sbjct: 256 ELYLSHNGIEVIEGLE 271

>hg18||uc003dvk
        |3|NM_024548|Q8IW35|LRIQ2_HUMAN|LRRIQ2|NM_024548|NP_078824|leucine-rich
        repeats and IQ motif containing 2

          Length = 865

 Score =  50 bits (118), Expect = 3e-006
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query:  46 LKILYLQNNLIPRMENLGHLKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRLSS 105
           |..| | .| |  .| |  |  |..|||| ||.. .| .  | .|. |||. | . ..  
Sbjct:  82 LRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGD 141

Query: 106 VERLKHNPHLTELFLVGNPCTKFQ 129
           . .|     |  | | ||  |  .
Sbjct: 142 LSKL---VSLKTLLLHGNIITSLR 162

>hg18||uc004aya
        |9|NM_006401|Q92688|AN32B_HUMAN|ANP32B|NM_006401|NP_006392|acidic
        (leucine-rich) nuclear phosphoprotein 32

          Length = 251

 Score =  49 bits (114), Expect = 8e-006
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 4/142 (2%)

Query:  10 RMRAEHNDKEICSLEEVSLH--QQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHLKK 67
           |.  |  ..   .. |. |   . |  ||| |     ||. | | |  .  . ||  | |
Sbjct:   6 RIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPK 65

Query:  68 LQYLNLALNNI--EVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPC 125
           |. | |. | |   .    |   .|  |.|. | .  .|..| ||    |  | |     
Sbjct:  66 LKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEV 125

Query: 126 TKFQGYREYVVVTLPQLKWLDG 147
           |    ||| |   |||| .|||
Sbjct: 126 TNLNDYRESVFKLLPQLTYLDG 147

>hg18||uc001xoq
        |14|NM_031427|Q9BS43|Q9BS43_HUMAN|DNAL1|NM_031427|NP_113615|axonemal
        dynein light chain 1

          Length = 151

 Score =  47 bits (111), Expect = 2e-005
 Identities = 40/140 (28%), Positives = 70/140 (50%), Gaps = 6/140 (4%)

Query:  20 ICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRMENLGHL-KKLQYLNLALNNI 78
           . . |..||    |||| .|.   .||.|| |  | |  .  |  .   |. | .. | |
Sbjct:   8 LANCEKLSLSTNCIEKIANLN-GLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFI 66

Query:  79 EVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPC----TKFQGYREY 134
           | .. .   . |. | .. | |   .   .|   | | .|  ||||     .    . | 
Sbjct:  67 EKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEE 126

Query: 135 VVVTLPQLKWLDGAKISRSE 154
               .|.|| |||  . . .
Sbjct: 127 ATKRVPKLKKLDGTPVIKGD 146

>hg18||uc001dsw
        |1|NM_144620|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|NP_653221|leucine rich
        repeat containing 39

          Length = 335

 Score =  45 bits (104), Expect = 1e-004
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRM-ENLGHLKKLQYLNLALNNIEVI 81
           |.|  ||.  . ||       .|| .| |  | |  .   .| | .|| | |. | |. .
Sbjct:  85 LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTV 144

Query:  82 -ENLEGCESLEKLDLTVN 98
            . |  | |||||.| ||
Sbjct: 145 PKELSNCASLEKLELAVN 162

>hg18||uc001dsx
        |1|AY358131|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|NP_653221|leucine rich
        repeat containing 39

          Length = 335

 Score =  45 bits (104), Expect = 1e-004
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRM-ENLGHLKKLQYLNLALNNIEVI 81
           |.|  ||.  . ||       .|| .| |  | |  .   .| | .|| | |. | |. .
Sbjct:  85 LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTV 144

Query:  82 -ENLEGCESLEKLDLTVN 98
            . |  | |||||.| ||
Sbjct: 145 PKELSNCASLEKLELAVN 162

>hg18||uc001dsy |1|AL833417|Q96DD0-2|Q96DD0-2|LRRC39|NA|NA|Leucine-rich
        repeat-containing protein 39 (Densin hlg)

          Length = 339

 Score =  45 bits (104), Expect = 1e-004
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRM-ENLGHLKKLQYLNLALNNIEVI 81
           |.|  ||.  . ||       .|| .| |  | |  .   .| | .|| | |. | |. .
Sbjct:  85 LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTV 144

Query:  82 -ENLEGCESLEKLDLTVN 98
            . |  | |||||.| ||
Sbjct: 145 PKELSNCASLEKLELAVN 162

>hg18||uc001dsz
        |1|BC022420|Q96DD0|LRC39_HUMAN|LRRC39|NM_144620|NP_653221|leucine rich
        repeat containing 39

          Length = 335

 Score =  45 bits (104), Expect = 1e-004
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query:  23 LEEVSLHQQNIEKIEHLDRWCRNLKILYLQNNLIPRM-ENLGHLKKLQYLNLALNNIEVI 81
           |.|  ||.  . ||       .|| .| |  | |  .   .| | .|| | |. | |. .
Sbjct:  85 LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTV 144

Query:  82 -ENLEGCESLEKLDLTVN 98
            . |  | |||||.| ||
Sbjct: 145 PKELSNCASLEKLELAVN 162

>hg18||uc004bkw |9|BC089415|Q5JVD3|Q5JVD3_HUMAN|CEP1|NA|NA|Centrosomal protein
        1

          Length = 448

 Score =  45 bits (104), Expect = 1e-004
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 12/123 (9%)

Query:  15 HNDKEICSLEEVSLHQQNIEKIEHLDR--WCRNLKILYLQNNLIPRMENLGHLKKLQYLN 72
           |.  . |  |.| .  .|   ... |      .  . |.   || ..    .|  .. ||
Sbjct:  47 HSGGQWC--EQVEIADENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLN 104

Query:  73 LALN-----NIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTK 127
           |.|.       . ||||| |  || |.|. | .|..  ...|     | || |  |  .|
Sbjct: 105 LSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLL---KLRELNLSYNKISK 161

Query: 128 FQG 130
            .|
Sbjct: 162 IEG 164

>hg18||uc004bkx
        |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018|NP_008949|centrosomal
        protein 110kDa

          Length = 2325

 Score =  45 bits (104), Expect = 1e-004
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 12/123 (9%)

Query:  15 HNDKEICSLEEVSLHQQNIEKIEHLDR--WCRNLKILYLQNNLIPRMENLGHLKKLQYLN 72
           |.  . |  |.| .  .|   ... |      .  . |.   || ..    .|  .. ||
Sbjct:  47 HSGGQWC--EQVEIADENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLN 104

Query:  73 LALN-----NIEVIENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTK 127
           |.|.       . ||||| |  || |.|. | .|..  ...|     | || |  |  .|
Sbjct: 105 LSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLL---KLRELNLSYNKISK 161

Query: 128 FQG 130
            .|
Sbjct: 162 IEG 164

>hg18||uc003ytk
        |8|NM_012472|Q86X45|LRRC6_HUMAN|LRRC6|NM_012472|NP_036604|leucine rich
        repeat containing 6

          Length = 466

 Score =  44 bits (101), Expect = 3e-004
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 191 ESRGVTSTPLWVQENQEEDPGLED--RFWNTPCEFSPESRVEAHRHLEEKQRAAER 244
           ||.     |   . | ..    ||   ||| || |.||||.|  ||.|....  |.
Sbjct: 222 ESKDHLQAPDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEK 277

>hg18||uc001tab
        |12|NM_032165|Q96JM4|Q96JM4_HUMAN|LRRIQ1|NM_032165|NP_115541|leucine-ri
        ch repeats and IQ motif containing 1

          Length = 1336

 Score =  43 bits (99), Expect = 5e-004
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query:   46 LKILYLQNNLIPRMENLGH--LKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRL 103
            |. |.| .| |  .|      |  || . .. |..  |  |    ||||||.. | .  |
Sbjct: 1037 LRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDL 1096

Query:  104 -SSVERLKHNPHLTELFLVGNPCTKFQGYREYVVVTLPQLKWLDGAKISRSERIR 157
             |...       | || | |||  .   .|. ..  || |. |.|  .. .   |
Sbjct: 1097 KSAIKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLPALRILNGNILNSNSESR 1151

>hg18||uc001tac
        |12|NM_001079910|NA|NA|LRRIQ1|NM_001079910|NP_001073379|leucine-rich
        repeats and IQ motif containing 1

          Length = 1722

 Score =  43 bits (99), Expect = 5e-004
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query:   46 LKILYLQNNLIPRMENLGH--LKKLQYLNLALNNIEVIENLEGCESLEKLDLTVNFVGRL 103
            |. |.| .| |  .|      |  || . .. |..  |  |    ||||||.. | .  |
Sbjct: 1037 LRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDL 1096

Query:  104 -SSVERLKHNPHLTELFLVGNPCTKFQGYREYVVVTLPQLKWLDGAKISRSERIR 157
             |...       | || | |||  .   .|. ..  || |. |.|  .. .   |
Sbjct: 1097 KSAIKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLPALRILNGNILNSNSESR 1151

>hg18||uc001dnh |1|BC030607|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  42 bits (97), Expect = 8e-004
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query:  20 ICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQ-NNLIPRMENLGHLKKLQYLNLALNNI 78
           . .||..||   ||| .      |  |  | |  |.|    | . .|  |||  .  |||
Sbjct: 655 LSNLEQLSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQYLSNLQYFAVTNNNI 714

Query:  79 EVI-ENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           |.. . |  |. |. | |  | .  ||    .    .|| | |.||
Sbjct: 715 EMLPDGLFQCKKLQCLLLGKNSLMNLS--PHVGELSNLTHLELIGN 758

>hg18||uc001dni |1|BC060782|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  42 bits (97), Expect = 8e-004
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query:  20 ICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQ-NNLIPRMENLGHLKKLQYLNLALNNI 78
           . .||..||   ||| .      |  |  | |  |.|    | . .|  |||  .  |||
Sbjct: 655 LSNLEQLSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQYLSNLQYFAVTNNNI 714

Query:  79 EVI-ENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           |.. . |  |. |. | |  | .  ||    .    .|| | |.||
Sbjct: 715 EMLPDGLFQCKKLQCLLLGKNSLMNLS--PHVGELSNLTHLELIGN 758

>hg18||uc001dnj
        |1|NM_015350|Q6P9F7|LRC8B_HUMAN|LRRC8B|NM_015350|NP_056165|T-cell
        activation leucine repeat-rich protein

          Length = 803

 Score =  42 bits (97), Expect = 8e-004
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query:  20 ICSLEEVSLHQQNIEKIEHLDRWCRNLKILYLQ-NNLIPRMENLGHLKKLQYLNLALNNI 78
           . .||..||   ||| .      |  |  | |  |.|    | . .|  |||  .  |||
Sbjct: 655 LSNLEQLSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQYLSNLQYFAVTNNNI 714

Query:  79 EVI-ENLEGCESLEKLDLTVNFVGRLSSVERLKHNPHLTELFLVGN 123
           |.. . |  |. |. | |  | .  ||    .    .|| | |.||
Sbjct: 715 EMLPDGLFQCKKLQCLLLGKNSLMNLS--PHVGELSNLTHLELIGN 758

>hg18||uc003dec |3|BC050552|NA|NA|KIAA0975|NA|NA|Homo sapiens mRNA for KIAA0975
        protein, partial cds

          Length = 583

 Score =  40 bits (93), Expect = 0.002
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query:  33 IEKIEHLDRWCRNLKILYLQNNLIPRMENL-GHLKKLQYLNLALNNIEVIENLEGCESLE 91
           .. ..||     ||  | |  | .  .| |   |  .. |||| | .| .  |    || 
Sbjct: 325 VDNLQHL----YNLVHLDLSYNKLSSLEGLHTKLGNIKTLNLAGNLLESLSGLHKLYSLV 380

Query:  92 KLDLTVNFVGRLSSVERLKHNPHLTELFLVGNPCTKFQGYREYVV 136
            |||  | . ..  |  .   | |  . |. || .    ||  |.
Sbjct: 381 NLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVL 425

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,333,540
Number of Sequences: 45480
Number of Extensions: 194333540
Number of Successful Extensions: 10864763
Number of sequences better than 0.0: 0
BLASTP 7.6.0