BLASTP 7.6.0


Query=fugu4_746368 |jgi|Takru4|746368|fgh5_pg.C_scaffold_3588000001
        (840 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KI...    254   5e-067
hg18||uc004bgt |9|BC009609|Q5T1M2|Q5T1M2_HUMAN|KIAA0674|NA|NA|Pe...    254   5e-067
hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KI...    156   1e-037
hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP...    109   2e-023
hg18||uc001nyy |11|NM_004470|P26885|FKBP2_HUMAN|FKBP2|NM_004470|...     81   6e-015
hg18||uc001nyz |11|NM_057092|P26885|FKBP2_HUMAN|FKBP2|NM_057092|...     81   6e-015
hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP...     79   2e-014
hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KI...     79   2e-014
hg18||uc002hxv |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939...     72   3e-012
hg18||uc001qkz |12|NM_002014|Q02790|FKBP4_HUMAN|FKBP4|NM_002014|...     71   5e-012
hg18||uc002hxv |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939...     71   5e-012
hg18||uc002rer |2|NM_004116|P68106|FKB1B_HUMAN|FKBP1B|NM_004116|...     71   5e-012
hg18||uc002wey |20|NM_000801|P62942|FKB1A_HUMAN|FKBP1A|NM_000801...     71   6e-012
hg18||uc002wfa |20|NM_054014|P62942|FKB1A_HUMAN|FKBP1A|NM_054014...     71   6e-012
hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506...     69   2e-011
hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|N...     69   2e-011
hg18||uc001wwb |14|NM_002013|Q00688|FKBP3_HUMAN|FKBP3|NM_002013|...     69   3e-011
hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506...     67   7e-011
hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|N...     67   7e-011
hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|N...     67   7e-011
hg18||uc002hxv |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939...     66   2e-010
hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|N...     65   3e-010
hg18||uc001rsp |12|NM_016594|Q9NYL4|FKB11_HUMAN|FKBP11|NM_016594...     61   5e-009
hg18||uc002umm |2|AY353086|Q6V3B2|Q6V3B2_HUMAN|FKBP7|NM_181342|N...     60   1e-008
hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506...     59   2e-008
hg18||uc003tya |7|AF038847|O75344|FKBP6_HUMAN|FKBP6|NM_003602|NP...     58   4e-008
hg18||uc003twy |7|NM_003602|Q7Z4T4|Q7Z4T4_HUMAN|FKBP6|NM_003602|...     55   3e-007
hg18||uc002hxv |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939...     54   8e-007
hg18||uc002hxw |17|AK025874|Q9H6J3|Q9H6J3_HUMAN|FKBP10|NM_021939...     54   8e-007
hg18||uc002hxw |17|AK025874|Q9H6J3|Q9H6J3_HUMAN|FKBP10|NM_021939...     45   3e-004
hg18||uc003tqt |7|NM_182827|Q75LS8|Q75LS8_HUMAN|FKBP9L|NM_182827...     44   0.001
hg18||uc001hnl |1|NM_198551|Q5JRA6|Q5JRA6_HUMAN|MIA3|NM_198551|N...     38   0.057
hg18||uc001hnm |1|AX775845|Q5JRB1|Q5JRB1_HUMAN|MIA3|NM_198551|NP...     38   0.057
hg18||uc003hxb |4|NM_001813|Q02224|CENPE_HUMAN|CENPE|NM_001813|N...     37   0.074
hg18||uc003hxc |4|AB209996|Q4LE75|Q4LE75_HUMAN|CENPE|NM_001813|N...     37   0.074
hg18||uc002ehc |16|AB002306|Q3L8U1-3|Q3L8U1-3|CHD9|NM_025134|NP_...     35   0.481
hg18||uc002ehg |16|AY243502|NA|NA|KIAA0308|NA|NA|Homo sapiens KI...     35   0.481
hg18||uc001ohb |11|NM_022822|Q9H0B6|KLC2_HUMAN|KLC2|NM_022822|NP...     34   0.820
hg18||uc001ohc |11|BC034373|Q9H0B6|KLC2_HUMAN|KLC2|NM_022822|NP_...     34   0.820
hg18||uc002egy |16|NM_025134|Q3L8U1-2|Q3L8U1-2|CHD9|NM_025134|NP...     33   1.071
hg18||uc002ehb |16|AY243500|Q3L8U1|CHD9_HUMAN|CHD9|NM_025134|NP_...     33   1.071
hg18||uc002ehf |16|DQ059482|Q461N2|Q461N2_HUMAN|CHD9|NM_025134|N...     33   1.071
hg18||uc001vjs |13|NM_005358|Q8WWI1-3|Q8WWI1-3|LMO7|NM_005358|NP...     33   1.826
hg18||uc001vjv |13|AB020665|Q5JV83|Q5JV83_HUMAN|LMO7|NA|NA|LIM d...     33   1.826
hg18||uc001kgr |10|NM_016195|Q96Q89-3|Q96Q89-3|MPHOSPH1|NM_01619...     32   2.385
hg18||uc001kgs |10|AB033337|Q96Q89|MPPH1_HUMAN|MPHOSPH1|NM_01619...     32   3.116
hg18||uc001vjt |13|AX747335|Q8WWI1-3|Q8WWI1-3|LMO7|NM_005358|NP_...     32   4.069
hg18||uc001vjw |13|AK055465|Q5JV86|Q5JV86_HUMAN|LMO7|NM_005358|N...     32   4.069
hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-i...     31   5.314
hg18||uc001ghs |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172...     31   5.314
hg18||uc002pep |19|NM_032040|Q9H0W5|CCDC8_HUMAN|CCDC8|NM_032040|...     31   6.941
hg18||uc001bzz |1|NM_018067|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067...     30   9.065
hg18||uc001caa |1|AK096341|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067|...     30   9.065
hg18||uc001cab |1|BC057293|Q9ULN3|Q9ULN3_HUMAN|MAP7D1|NM_018067|...     30   9.065
hg18||uc001cac |1|BC067256|Q6NX58|Q6NX58_HUMAN|MAP7D1|NM_018067|...     30   9.065
hg18||uc001cad |1|AK095939|Q8N905|Q8N905_HUMAN|MAP7D1|NM_018067|...     30   9.065

>hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KIAA0674 protein
        (Fragment)

          Length = 1219

 Score =  254 bits (647), Expect = 5e-067
 Identities = 152/322 (47%), Positives = 189/322 (58%), Gaps = 15/322 (4%)

Query:   1 LQPNSYYTFYDDQMQNWSVIFESEKSSSDFCREVCXXXXXXXXXXXXXXVQDLRVGEGQA 60
           ..||.| |||||| ||||..|||||.. .| ..||               ||| | .| |
Sbjct: 134 VRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDAVLSQDLIVADGPA 193

Query:  61 VEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGH 120
           ||.|| |||.|||||  || .||||||  ||||||| |.|||||.||||.||||||| | 
Sbjct: 194 VEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKGWEDGMLGMKKGGK 253

Query: 121 RLIIVPPHLAYGAKGVPNRVPA-NSTLIFEVELQRVKFAKDGVSEHXXXXXXXXXXXXXX 179
           ||.||||  | |..||     | .| |.||||..|||||.|  |.               
Sbjct: 254 RLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPI 313

Query: 180 XXXXXXXXXXXXXXGQPPTTAPGGLGE--LRSKSNSLSEQLA---NPDVTKANLISRMAK 234
                           |||. |   ||  ||.||||||||||   .||  || |||||||
Sbjct: 314 PGADNLSADPVV---SPPTSIPFKSGEPALRTKSNSLSEQLAINTSPDAVKAKLISRMAK 370

Query: 235 MGQPMLPFLKGASSQPESSDSELEDTSGSRTKERXXXXXXXXXXXXXXXXXXXXXEQMCT 294
           ||||||| |     | .|.|||.|| .   | .                       || .
Sbjct: 371 MGQPMLPIL---PPQLDSNDSEIEDVN---TLQGGGQPVVTPSVQPSLHPAHPALPQMTS 424

Query: 295 VAPPTFSFGHAAPPSALLPVMS 316
            ||     |  || .||. | |
Sbjct: 425 QAPQPSVTGLQAPSAALMQVSS 446

>hg18||uc004bgt |9|BC009609|Q5T1M2|Q5T1M2_HUMAN|KIAA0674|NA|NA|Peptidyl-prolyl
        cis-trans isomerase (EC 5.2.1.8) (Fragment)

          Length = 472

 Score =  254 bits (647), Expect = 5e-067
 Identities = 152/322 (47%), Positives = 189/322 (58%), Gaps = 15/322 (4%)

Query:   1 LQPNSYYTFYDDQMQNWSVIFESEKSSSDFCREVCXXXXXXXXXXXXXXVQDLRVGEGQA 60
           ..||.| |||||| ||||..|||||.. .| ..||               ||| | .| |
Sbjct: 134 VRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDAVLSQDLIVADGPA 193

Query:  61 VEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGH 120
           ||.|| |||.|||||  || .||||||  ||||||| |.|||||.||||.||||||| | 
Sbjct: 194 VEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKGWEDGMLGMKKGGK 253

Query: 121 RLIIVPPHLAYGAKGVPNRVPA-NSTLIFEVELQRVKFAKDGVSEHXXXXXXXXXXXXXX 179
           ||.||||  | |..||     | .| |.||||..|||||.|  |.               
Sbjct: 254 RLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPI 313

Query: 180 XXXXXXXXXXXXXXGQPPTTAPGGLGE--LRSKSNSLSEQLA---NPDVTKANLISRMAK 234
                           |||. |   ||  ||.||||||||||   .||  || |||||||
Sbjct: 314 PGADNLSADPVV---SPPTSIPFKSGEPALRTKSNSLSEQLAINTSPDAVKAKLISRMAK 370

Query: 235 MGQPMLPFLKGASSQPESSDSELEDTSGSRTKERXXXXXXXXXXXXXXXXXXXXXEQMCT 294
           ||||||| |     | .|.|||.|| .   | .                       || .
Sbjct: 371 MGQPMLPIL---PPQLDSNDSEIEDVN---TLQGGGQPVVTPSVQPSLHPAHPALPQMTS 424

Query: 295 VAPPTFSFGHAAPPSALLPVMS 316
            ||     |  || .||. | |
Sbjct: 425 QAPQPSVTGLQAPSAALMQVSS 446

>hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KIAA0674 protein
        (Fragment)

          Length = 1219

 Score =  156 bits (394), Expect = 1e-037
 Identities = 87/159 (54%), Positives = 113/159 (71%), Gaps = 16/159 (10%)

Query: 307 PPSALLPVMSSGPPRLPGPA-------FQARQQNTEIRLSIGKVADKVDQLSSKIDDLQK 359
           |   | |   | ||   |          .||| |||||... |||||.| | .|...|||
Sbjct: 483 PVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEELQK 542

Query: 360 QANLSAGVS------SMPMETSIILHNIQRIVQENECLKKEVFEKSSRIEEQNHKISELI 413
               ||| |      |. ||||.|. |||||.|||| ||.|. |||.|||||| ||||||
Sbjct: 543 H---SAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELI 599

Query: 414 EQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQAEQEK 452
           |.||||.|||||..||||.| . . | .||..| |||||
Sbjct: 600 ERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEK 638

>hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP15 protein
        (Fragment)

          Length = 656

 Score =  109 bits (272), Expect = 2e-023
 Identities = 56/98 (57%), Positives = 76/98 (77%), Gaps = 3/98 (3%)

Query: 369 SMPMETSIILHNIQRIVQENECLKKEVFEKSSRIEEQNHKISELIEQNQRYLEQSNLLLE 428
           |. ||||.|. |||||.|||| ||.|. |||.|||||| |||||||.||||.|||||..|
Sbjct:   2 SVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMME 61

Query: 429 KRNDSFKMSNEQSQAKLLQAEQEKRCHRVQSDHRRMKV 466
           |||.| . . | .|||.    .|      |  | ..|.
Sbjct:  62 KRNNSLQTATENTQAKV---TEELAAATAQVSHLQLKM 96

>hg18||uc001nyy
        |11|NM_004470|P26885|FKBP2_HUMAN|FKBP2|NM_004470|NP_004461|FK506-bindin
        g protein 2 precursor

          Length = 142

 Score =  81 bits (198), Expect = 6e-015
 Identities = 37/93 (39%), Positives = 61/93 (65%), Gaps = 4/93 (4%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           || | . ||| |      |  |||.  ...   | .|.|.|.|||..|.||| .   | .
Sbjct:  49 GDVLHMHYTGKLED----GTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKL 104

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVELQRVK 156
           ..|  | || .| | ..|  .||.||||| ...
Sbjct: 105 VIPSELGYGERGAPPKIPGGATLVFEVELLKIE 137

>hg18||uc001nyz
        |11|NM_057092|P26885|FKBP2_HUMAN|FKBP2|NM_057092|NP_476433|FK506-bindin
        g protein 2 precursor

          Length = 142

 Score =  81 bits (198), Expect = 6e-015
 Identities = 37/93 (39%), Positives = 61/93 (65%), Gaps = 4/93 (4%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           || | . ||| |      |  |||.  ...   | .|.|.|.|||..|.||| .   | .
Sbjct:  49 GDVLHMHYTGKLED----GTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKL 104

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVELQRVK 156
           ..|  | || .| | ..|  .||.||||| ...
Sbjct: 105 VIPSELGYGERGAPPKIPGGATLVFEVELLKIE 137

>hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP15 protein
        (Fragment)

          Length = 656

 Score =  79 bits (193), Expect = 2e-014
 Identities = 48/178 (26%), Positives = 81/178 (45%)

Query: 576 SATQAEGHQTVRLTEDLAVSTARXXXXXXXXXXXXXKAVELQNKXXXXXXXXXXXXXRVA 635
           |   |  .   ..||.|| .||.             |  ||| .             .. 
Sbjct:  66 SLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQMQLTESLKETDLLRGQLT 125

Query: 636 GLETQLEELKEAAEATQARYRSEKQRRQQMELRVNSXXXXXXXXXXXXGSLERTLLERKK 695
            .. .| ||.| .|  |....|||| |.|.||.| |             |||. | ||||
Sbjct: 126 KVQAKLSELQETSEQAQSKFKSEKQNRKQLELKVTSLEEELTDLRVEKESLEKNLSERKK 185

Query: 696 KWQAXXXXXXXXXXXXXXXXXXXXXNLWAQLRRARSSTEHSVSDQMCQMQAELENEWK 753
           |                         |   |.. | ||. . ..|.  .||||. .|.
Sbjct: 186 KSAQERSQAEEEIDEIRKSYQEELDKLRQLLKKTRVSTDQAAAEQLSLVQAELQTQWE 243

>hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KIAA0674 protein
        (Fragment)

          Length = 1219

 Score =  79 bits (193), Expect = 2e-014
 Identities = 46/170 (27%), Positives = 79/170 (46%)

Query: 584 QTVRLTEDLAVSTARXXXXXXXXXXXXXKAVELQNKXXXXXXXXXXXXXRVAGLETQLEE 643
           .  ..||.|| .||.             |  ||| .             ..  .. .| |
Sbjct: 637 EKAKVTEELAAATAQVSHLQLKMTAHQKKETELQMQLTESLKETDLLRGQLTKVQAKLSE 696

Query: 644 LKEAAEATQARYRSEKQRRQQMELRVNSXXXXXXXXXXXXGSLERTLLERKKKWQAXXXX 703
           |.| .|  |....|||| |.|.||.| |             |||. | |||||       
Sbjct: 697 LQETSEQAQSKFKSEKQNRKQLELKVTSLEEELTDLRVEKESLEKNLSERKKKSAQERSQ 756

Query: 704 XXXXXXXXXXXXXXXXXNLWAQLRRARSSTEHSVSDQMCQMQAELENEWK 753
                             |   |.. | ||. . ..|.  .||||. .|.
Sbjct: 757 AEEEIDEIRKSYQEELDKLRQLLKKTRVSTDQAAAEQLSLVQAELQTQWE 806

>hg18||uc002hxv
        |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 582

 Score =  72 bits (175), Expect = 3e-012
 Identities = 38/102 (37%), Positives = 61/102 (59%), Gaps = 4/102 (3%)

Query:  61 VEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGH 120
           |.||||.   | |        |. |||. ... |.   || |... | . |..||  .  
Sbjct:  59 VQMGDFVRYHYNGTFED----GKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNER 114

Query: 121 RLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGV 162
           | .|||||| ||. |.   .| ..|| |.| |  |   .| |
Sbjct: 115 RRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTV 156

>hg18||uc001qkz
        |12|NM_002014|Q02790|FKBP4_HUMAN|FKBP4|NM_002014|NP_002005|FK506-bindin
        g protein 4

          Length = 459

 Score =  71 bits (173), Expect = 5e-012
 Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 7/103 (6%)

Query:  57 EGQAVEM---GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGML 113
           ||   ||   || . | |||||.     |  |||. ..     | .| |.|.| |.  . 
Sbjct:  40 EGTGTEMPMIGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIA 95

Query: 114 GMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVK 156
            ||      |   |  |||. | | ..| |.||.|||||   |
Sbjct:  96 TMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFK 138

>hg18||uc002hxv
        |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 582

 Score =  71 bits (173), Expect = 5e-012
 Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query:  61 VEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGH 120
           |. |||.   | | |.     |  ||.. .|       |||| ..|| ..|.|||     
Sbjct: 171 VQDGDFVRYHYNGTLLD----GTFFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGER 226

Query: 121 RLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGV 162
           | ||.|| |||| ||    .|  ..|.| | |  |   || |
Sbjct: 227 RKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAV 268

>hg18||uc002rer
        |2|NM_004116|P68106|FKB1B_HUMAN|FKBP1B|NM_004116|NP_004107|FK506-bindin
        g protein 1B isoform a

          Length = 108

 Score =  71 bits (173), Expect = 5e-012
 Identities = 38/104 (36%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query:  50 VQDLRVGEGQAV-EMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGW 108
           .. .  |.|.   . |    | ||| | .    |. |||.....|  .|..|  .|.||.
Sbjct:   5 IETISPGDGRTFPKKGQTCVVHYTGMLQN----GKKFDSSRDRNKPFKFRIGKQEVIKGF 60

Query: 109 EEGMLGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           |||   |       .   | .|||| | |  .| |.||||.|||
Sbjct:  61 EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVEL 104

>hg18||uc002wey
        |20|NM_000801|P62942|FKB1A_HUMAN|FKBP1A|NM_000801|NP_000792|FK506-bindi
        ng protein 1A

          Length = 108

 Score =  71 bits (172), Expect = 6e-012
 Identities = 37/108 (34%), Positives = 64/108 (59%), Gaps = 5/108 (4%)

Query:  50 VQDLRVGEGQAV-EMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGW 108
           |. .  |.|.   . |    | ||| |      |. |||.....|  .| .|  .|..||
Sbjct:   5 VETISPGDGRTFPKRGQTCVVHYTGMLED----GKKFDSSRDRNKPFKFMLGKQEVIRGW 60

Query: 109 EEGMLGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVK 156
           |||.  |       . . |  |||| | |  .| ..||.|.||| ...
Sbjct:  61 EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108

>hg18||uc002wfa
        |20|NM_054014|P62942|FKB1A_HUMAN|FKBP1A|NM_054014|NP_463460|FK506-bindi
        ng protein 1A

          Length = 108

 Score =  71 bits (172), Expect = 6e-012
 Identities = 37/108 (34%), Positives = 64/108 (59%), Gaps = 5/108 (4%)

Query:  50 VQDLRVGEGQAV-EMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGW 108
           |. .  |.|.   . |    | ||| |      |. |||.....|  .| .|  .|..||
Sbjct:   5 VETISPGDGRTFPKRGQTCVVHYTGMLED----GKKFDSSRDRNKPFKFMLGKQEVIRGW 60

Query: 109 EEGMLGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVK 156
           |||.  |       . . |  |||| | |  .| ..||.|.||| ...
Sbjct:  61 EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108

>hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506 binding
        protein 9

          Length = 377

 Score =  69 bits (168), Expect = 2e-011
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           . |  |||.   | |        || |||. ..|      || |... | .. ..||  .
Sbjct:  49 RTVRSGDFVRYHYVGTFPD----GQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVN 104

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGVSEH 165
             | . .|| |||| .||   .| || | |.| |  .  ..| |  |
Sbjct: 105 ERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIH 151

>hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|NP_009201|FK506
        binding protein 9

          Length = 570

 Score =  69 bits (168), Expect = 2e-011
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           . |  |||.   | |        || |||. ..|      || |... | .. ..||  .
Sbjct:  49 RTVRSGDFVRYHYVGTFPD----GQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVN 104

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGVSEH 165
             | . .|| |||| .||   .| || | |.| |  .  ..| |  |
Sbjct: 105 ERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIH 151

>hg18||uc001wwb
        |14|NM_002013|Q00688|FKBP3_HUMAN|FKBP3|NM_002013|NP_002004|FK506-bindin
        g protein 3

          Length = 224

 Score =  69 bits (166), Expect = 3e-011
 Identities = 41/97 (42%), Positives = 54/97 (55%), Gaps = 12/97 (12%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSN-------QNKDKLLRFKVGSGKVMKGWEEGMLGMK 116
           || .   ||| |      | |||.|       .   | | |||| |||..||.| .| | 
Sbjct: 128 GDVVHCWYTGTLQD----GTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMS 183

Query: 117 KSGHRLIIVPPHLAYGAKGVPN-RVPANSTLIFEVEL 152
           |     . . |  ||| || |. ..| |. | |||||
Sbjct: 184 KGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVEL 220

>hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506 binding
        protein 9

          Length = 377

 Score =  67 bits (163), Expect = 7e-011
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 4/105 (3%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           . ... ||.   | |  .     | .|||. |. |     || | .. | ..|.|||   
Sbjct: 161 RTIQVSDFVRYHYNGTFLD----GTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVG 216

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGVS 163
             |.| .|| ||||  |    .|  ..|.|.| |  .   || .|
Sbjct: 217 EKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSIS 261

>hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|NP_009201|FK506
        binding protein 9

          Length = 570

 Score =  67 bits (163), Expect = 7e-011
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 4/105 (3%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           . ... ||.   | |  .     | .|||. |. |     || | .. | ..|.|||   
Sbjct: 161 RTIQVSDFVRYHYNGTFLD----GTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVG 216

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGVS 163
             |.| .|| ||||  |    .|  ..|.|.| |  .   || .|
Sbjct: 217 EKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSIS 261

>hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|NP_009201|FK506
        binding protein 9

          Length = 570

 Score =  67 bits (163), Expect = 7e-011
 Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 5/102 (4%)

Query:  62 EMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHR 121
           . ||||   | | |.     | .|||. ....     .| | |. | .||.||.     |
Sbjct: 276 QSGDFLRYHYNGTLLD----GTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKR 331

Query: 122 LIIVPPHLAYGAKGVPNRVPANSTLIFEVELQRVKFAKDGVS 163
            |.||||| || .|  | .| .. |.|.. .       | .|
Sbjct: 332 RIVVPPHLGYGEEGRGN-IPGSAVLVFDIHVIDFHNPSDSIS 372

>hg18||uc002hxv
        |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 582

 Score =  66 bits (159), Expect = 2e-010
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 4/89 (4%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           |||.   | | ||     | .|||. ...      .| | .. | ..|. |      | |
Sbjct: 286 GDFMRYHYNGSLMD----GTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRI 341

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
            .|||||||  |  ...| .. ||| | .
Sbjct: 342 TIPPHLAYGENGTGDKIPGSAVLIFNVHV 370

>hg18||uc003tdh |7|NM_007270|O95302|FKBP9_HUMAN|FKBP9|NM_007270|NP_009201|FK506
        binding protein 9

          Length = 570

 Score =  65 bits (157), Expect = 3e-010
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           ||.|.  |   |.     | . ||  |  |     .|||.|. | . |.  |     | .
Sbjct: 389 GDYLKYHYNASLLD----GTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTV 444

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           |.|||| ||  ||   || .. |.|..||
Sbjct: 445 IIPPHLGYGEAGVDGEVPGSAVLVFDIEL 473

>hg18||uc001rsp
        |12|NM_016594|Q9NYL4|FKB11_HUMAN|FKBP11|NM_016594|NP_057678|FK506
        binding protein precursor

          Length = 201

 Score =  61 bits (147), Expect = 5e-009
 Identities = 33/89 (37%), Positives = 54/89 (60%), Gaps = 5/89 (5%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           || | . ||| |.     |.. |..  .| |.  ..|  .|. | |. .| |     |  
Sbjct:  57 GDTLHIHYTGSLVD----GRIIDTSLTRDPLV-IELGQKQVIPGLEQSLLDMCVGEKRRA 111

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           |.| ||||| .| |  |||.. . ..|||
Sbjct: 112 IIPSHLAYGKRGFPPSVPADAVVQYDVEL 140

>hg18||uc002umm
        |2|AY353086|Q6V3B2|Q6V3B2_HUMAN|FKBP7|NM_181342|NP_851939|FK506-binding
        protein 7 precursor

          Length = 217

 Score =  60 bits (144), Expect = 1e-008
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query:  64 GDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLI 123
           || |   | |.|  . |        ||.     | .| |.|.|| .  |  |     | .
Sbjct:  49 GDLLNAHYDGYLAKD-GSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKV 107

Query: 124 IVPPHLAYGAKGVPNRVPANSTLIFEVELQRV 155
           ..||  ||| .|   ..| ..|||||.||  |
Sbjct: 108 VIPPSFAYGKEGYEGKIPPDATLIFEIELYAV 139

>hg18||uc003tdg |7|CR623093|NA|NA|FKBP9|NM_007270|NP_009201|FK506 binding
        protein 9

          Length = 377

 Score =  59 bits (141), Expect = 2e-008
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 4/74 (5%)

Query:  62 EMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHR 121
           . ||||   | | |.     | .|||. ....     .| | |. | .||.||.     |
Sbjct: 276 QSGDFLRYHYNGTLLD----GTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKR 331

Query: 122 LIIVPPHLAYGAKG 135
            |.||||| || .|
Sbjct: 332 RIVVPPHLGYGEEG 345

>hg18||uc003tya
        |7|AF038847|O75344|FKBP6_HUMAN|FKBP6|NM_003602|NP_003593|FK506-binding
        protein 6

          Length = 327

 Score =  58 bits (139), Expect = 4e-008
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query:  53 LRVGEGQAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGM 112
           .| | |  |     . | |.|.| |   . . ||||  .      |.|    . | | |.
Sbjct:  43 IREGAGDLVAPDASVLVKYSGYLEH---MDRPFDSNYFRKTPRLMKLGEDITLWGMELGL 99

Query: 113 LGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           | |..      .  |. |||  | |  .| |.|..||.||
Sbjct: 100 LSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIEL 139

>hg18||uc003twy
        |7|NM_003602|Q7Z4T4|Q7Z4T4_HUMAN|FKBP6|NM_003602|NP_003593|FK506-bindin
        g protein 6

          Length = 327

 Score =  55 bits (131), Expect = 3e-007
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query:  53 LRVGEGQAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGM 112
           .| | |  |     . | | |.| |   . . ||||  .      |.|    . | | |.
Sbjct:  43 IREGAGDLVAPDASVLVKYYGYLEH---LDRPFDSNYFRKTPRLMKLGEDITLWGMELGL 99

Query: 113 LGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           | |..      .  |. |||  | |  .| |.|..|..||
Sbjct: 100 LSMQRGELARFLFKPNYAYGTLGSPPLIPPNTTVLFKIEL 139

>hg18||uc002hxv
        |17|NM_021939|Q96AY3|FKB10_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 582

 Score =  54 bits (128), Expect = 8e-007
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 5/94 (5%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           .  ..|||.   |   |.    .    |    ..  |    |. ||..| . |. ||   
Sbjct: 394 ETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATL----GANKVIEGLDTGLQGMCVG 449

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
             | .|||||||.|  |    || .. |.|||||
Sbjct: 450 ERRQLIVPPHLAHGESGA-RGVPGSAVLLFEVEL 482

>hg18||uc002hxw
        |17|AK025874|Q9H6J3|Q9H6J3_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 346

 Score =  54 bits (128), Expect = 8e-007
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 5/94 (5%)

Query:  59 QAVEMGDFLEVSYTGWLMHNHGIGQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKS 118
           .  ..|||.   |   |.    .    |    ..  |    |. ||..| . |. ||   
Sbjct: 158 ETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATL----GANKVIEGLDTGLQGMCVG 213

Query: 119 GHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
             | .|||||||.|  |    || .. |.|||||
Sbjct: 214 ERRQLIVPPHLAHGESGA-RGVPGSAVLLFEVEL 246

>hg18||uc002hxw
        |17|AK025874|Q9H6J3|Q9H6J3_HUMAN|FKBP10|NM_021939|NP_068758|FK506
        binding protein 10, 65 kDa

          Length = 346

 Score =  45 bits (106), Expect = 3e-004
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query:  82 GQVFDSNQNKDKLLRFKVGSGKVMKGWEEGMLGMKKSGHRLIIVPPHLAYGAKG 135
           | .|||. ...      .| | .. | ..|. |      | | .|||||||  |
Sbjct:   3 GTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENG 56

>hg18||uc003tqt
        |7|NM_182827|Q75LS8|Q75LS8_HUMAN|FKBP9L|NM_182827|NP_878247|FK506
        binding protein 9-like

          Length = 142

 Score =  44 bits (101), Expect = 0.001
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 111 GMLGMKKSGHRLIIVPPHLAYGAKGVPNRVPANSTLIFEVEL 152
           |.  |     | .|.|||| ||  ||   || .. |.|..||
Sbjct:   4 GLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIEL 45

>hg18||uc001hnl
        |1|NM_198551|Q5JRA6|Q5JRA6_HUMAN|MIA3|NM_198551|NP_940953|melanoma
        inhibitory activity family, member 3

          Length = 1907

 Score =  38 bits (86), Expect = 0.057
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query:  404 EQNHKISELIEQNQRYLEQSNLLLEKRNDSF-KMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
            ||| |  .|| .|.. .|.   ..      | ..    ..||| . . .  ||||| .. 
Sbjct: 1295 EQNVKNQDLISENKKSIEKLKDVISMNASEFSEVQIALNEAKLSEEKVKSECHRVQEENA 1354

Query:  463 RMK 465
            |.|
Sbjct: 1355 RLK 1357

>hg18||uc001hnm
        |1|AX775845|Q5JRB1|Q5JRB1_HUMAN|MIA3|NM_198551|NP_940953|melanoma
        inhibitory activity family, member 3

          Length = 785

 Score =  38 bits (86), Expect = 0.057
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 404 EQNHKISELIEQNQRYLEQSNLLLEKRNDSF-KMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
           ||| |  .|| .|.. .|.   ..      | ..    ..||| . . .  ||||| .. 
Sbjct: 173 EQNVKNQDLISENKKSIEKLKDVISMNASEFSEVQIALNEAKLSEEKVKSECHRVQEENA 232

Query: 463 RMK 465
           |.|
Sbjct: 233 RLK 235

>hg18||uc003hxb
        |4|NM_001813|Q02224|CENPE_HUMAN|CENPE|NM_001813|NP_001804|centromere
        protein E

          Length = 2701

 Score =  37 bits (85), Expect = 0.074
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 349 QLSSKIDDLQKQANLSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRI----EE 404
           .|  || ||||. |     .    |  |.|  .. .  | | |.||. .||  .     |
Sbjct: 717 ELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSE 776

Query: 405 QNHKISELIEQNQR 418
           ..   ||.. .  |
Sbjct: 777 KDKLFSEVVHKESR 790

>hg18||uc003hxc
        |4|AB209996|Q4LE75|Q4LE75_HUMAN|CENPE|NM_001813|NP_001804|centromere
        protein E

          Length = 2580

 Score =  37 bits (85), Expect = 0.074
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 349 QLSSKIDDLQKQANLSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRI----EE 404
           .|  || ||||. |     .    |  |.|  .. .  | | |.||. .||  .     |
Sbjct: 692 ELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSE 751

Query: 405 QNHKISELIEQNQR 418
           ..   ||.. .  |
Sbjct: 752 KDKLFSEVVHKESR 765

>hg18||uc002ehc
        |16|AB002306|Q3L8U1-3|Q3L8U1-3|CHD9|NM_025134|NP_079410|chromodomain
        helicase DNA binding protein 9

          Length = 2882

 Score =  35 bits (78), Expect = 0.481
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query:  505 SDSELSCSATQRAGGPSDSELSCSATHRAGGPSDSELSCSATQRAGGPSDSELSCSATQR 564
            |||.   |.       | |  ||| . |.|  | |  |||.   .   | |  | |..  
Sbjct: 2134 SDSDSERSSCSSRSSSSSSSSSCSHS-RSGSSSSSSSSCSSASSSSSSSTSS-SSSSSSS 2191

Query:  565 AGGPSDSELSCSATQAEGHQTVRLTEDLAVST 596
            .   |||.   .  .||    ..  .. .|..
Sbjct: 2192 SSEESDSDEEEAQKRAESTTHMKAYDEESVAS 2223

>hg18||uc002ehg |16|AY243502|NA|NA|KIAA0308|NA|NA|Homo sapiens KIAA0308 mRNA,
        partial cds

          Length = 461

 Score =  35 bits (78), Expect = 0.481
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 505 SDSELSCSATQRAGGPSDSELSCSATHRAGGPSDSELSCSATQRAGGPSDSELSCSATQR 564
           |||.   |.       | |  ||| . |.|  | |  |||.   .   | |  | |..  
Sbjct: 140 SDSDSERSSCSSRSSSSSSSSSCSHS-RSGSSSSSSSSCSSASSSSSSSTSS-SSSSSSS 197

Query: 565 AGGPSDSELSCSATQAEGHQTVRLTEDLAVST 596
           .   |||.   .  .||    ..  .. .|..
Sbjct: 198 SSEESDSDEEEAQKRAESTTHMKAYDEESVAS 229

>hg18||uc001ohb |11|NM_022822|Q9H0B6|KLC2_HUMAN|KLC2|NM_022822|NP_073733|kinesin
        light chain 2

          Length = 622

 Score =  34 bits (76), Expect = 0.820
 Identities = 15/63 (23%), Positives = 35/63 (55%)

Query: 363 LSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRIEEQNHKISELIEQNQRYLEQ 422
           ||. . ..  |   .   ..|.||||. |..|.     ...     ...| |. |  |  
Sbjct:  81 LSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM 140

Query: 423 SNL 425
           | .
Sbjct: 141 SQI 143

>hg18||uc001ohc |11|BC034373|Q9H0B6|KLC2_HUMAN|KLC2|NM_022822|NP_073733|kinesin
        light chain 2

          Length = 622

 Score =  34 bits (76), Expect = 0.820
 Identities = 15/63 (23%), Positives = 35/63 (55%)

Query: 363 LSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRIEEQNHKISELIEQNQRYLEQ 422
           ||. . ..  |   .   ..|.||||. |..|.     ...     ...| |. |  |  
Sbjct:  81 LSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM 140

Query: 423 SNL 425
           | .
Sbjct: 141 SQI 143

>hg18||uc002egy
        |16|NM_025134|Q3L8U1-2|Q3L8U1-2|CHD9|NM_025134|NP_079410|chromodomain
        helicase DNA binding protein 9

          Length = 2881

 Score =  33 bits (75), Expect = 1.071
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query:  505 SDSELSCSATQRAGGPSDSELSCSATHRAGGPSDSELSCSATQRAGGPSDSELSCSATQR 564
            |||.   |.       | |  ||| . |.|  | |  |||.   .   | |  | |..  
Sbjct: 2134 SDSDSERSSCSSRSSSSSSSSSCSHS-RSGSSSSSSSSCSSASSSSSSSTSSSSSSSSSS 2192

Query:  565 AGGPSDSELSCSATQAEGHQTVRLTEDLA 593
            .      |      ..  |      | .|
Sbjct: 2193 SEESDSDEEEAQKRESTTHMKAYDEESVA 2221

>hg18||uc002ehb
        |16|AY243500|Q3L8U1|CHD9_HUMAN|CHD9|NM_025134|NP_079410|chromodomain
        helicase DNA binding protein 9

          Length = 2897

 Score =  33 bits (75), Expect = 1.071
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query:  505 SDSELSCSATQRAGGPSDSELSCSATHRAGGPSDSELSCSATQRAGGPSDSELSCSATQR 564
            |||.   |.       | |  ||| . |.|  | |  |||.   .   | |  | |..  
Sbjct: 2134 SDSDSERSSCSSRSSSSSSSSSCSHS-RSGSSSSSSSSCSSASSSSSSSTSSSSSSSSSS 2192

Query:  565 AGGPSDSELSCSATQAEGHQTVRLTEDLA 593
            .      |      ..  |      | .|
Sbjct: 2193 SEESDSDEEEAQKRESTTHMKAYDEESVA 2221

>hg18||uc002ehf
        |16|DQ059482|Q461N2|Q461N2_HUMAN|CHD9|NM_025134|NP_079410|chromodomain
        helicase DNA binding protein 9

          Length = 1995

 Score =  33 bits (75), Expect = 1.071
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query:  505 SDSELSCSATQRAGGPSDSELSCSATHRAGGPSDSELSCSATQRAGGPSDSELSCSATQR 564
            |||.   |.       | |  ||| . |.|  | |  |||.   .   | |  | |..  
Sbjct: 1248 SDSDSERSSCSSRSSSSSSSSSCSHS-RSGSSSSSSSSCSSASSSSSSSTSSSSSSSSSS 1306

Query:  565 AGGPSDSELSCSATQAEGHQTVRLTEDLA 593
            .      |      ..  |      | .|
Sbjct: 1307 SEESDSDEEEAQKRESTTHMKAYDEESVA 1335

>hg18||uc001vjs |13|NM_005358|Q8WWI1-3|Q8WWI1-3|LMO7|NM_005358|NP_005349|LIM
        domain only 7

          Length = 1349

 Score =  33 bits (73), Expect = 1.826
 Identities = 25/117 (21%), Positives = 50/117 (42%), Gaps = 1/117 (0%)

Query:  403 EEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
            ||.     |.. ..|    |  |..|.     .   |. . | |||| |..    .   |
Sbjct:  986 EERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKRPAEEQKR 1045

Query:  463 RMKVDGKICSESPAKKKSEGGQHTPATTVKTSCSAP-HRAGGPSDSELSCSATQRAG 518
            . ... .        ..       | |   .|   |  |    | .||   .| . |
Sbjct: 1046 QAEIERETSVRIYQYRRPVDSYDIPKTEEASSGFLPGDRNKSRSTTELDDYSTNKNG 1102

>hg18||uc001vjv |13|AB020665|Q5JV83|Q5JV83_HUMAN|LMO7|NA|NA|LIM domain only 7
        (Fragment)

          Length = 1385

 Score =  33 bits (73), Expect = 1.826
 Identities = 25/117 (21%), Positives = 50/117 (42%), Gaps = 1/117 (0%)

Query:  403 EEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
            ||.     |.. ..|    |  |..|.     .   |. . | |||| |..    .   |
Sbjct: 1035 EERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKRPAEEQKR 1094

Query:  463 RMKVDGKICSESPAKKKSEGGQHTPATTVKTSCSAP-HRAGGPSDSELSCSATQRAG 518
            . ... .        ..       | |   .|   |  |    | .||   .| . |
Sbjct: 1095 QAEIERETSVRIYQYRRPVDSYDIPKTEEASSGFLPGDRNKSRSTTELDDYSTNKNG 1151

>hg18||uc001kgr
        |10|NM_016195|Q96Q89-3|Q96Q89-3|MPHOSPH1|NM_016195|NP_057279|M-phase
        phosphoprotein 1

          Length = 1780

 Score =  32 bits (72), Expect = 2.385
 Identities = 38/161 (23%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 331 QQNTEIRLSIGK-VADKVDQLSSKIDDL-QKQANLSAGVSSMPMETSIILHNIQR----I 384
           ..| | ||.| | .  | |       |.   .       . . .. . |   . .    .
Sbjct: 632 EENAERRLAIFKDLVGKCDTREEAAKDICATKVETEEATACLELKFNQIKAELAKTKGEL 691

Query: 385 VQENECLKKEVFEKSSRIEEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAK 444
           ..  | |||   |  | |.|      ..| ||||  |  |.. .| .   .  | .|   
Sbjct: 692 IKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKS--- 748

Query: 445 LLQAEQEKRCHRVQSDHRRMKVDGK-ICSES---PAKKKSE 481
               |   .|.  ..|   . .. | ||.|.   |   ||.
Sbjct: 749 --HMENTFKCND-KADTSSLIINNKLICNETVEVPKDSKSK 786

>hg18||uc001kgs
        |10|AB033337|Q96Q89|MPPH1_HUMAN|MPHOSPH1|NM_016195|NP_057279|M-phase
        phosphoprotein 1

          Length = 1820

 Score =  32 bits (71), Expect = 3.116
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 10/102 (9%)

Query: 384 IVQENECLKKEVFEKSSRIEEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQA 443
           ...  | |||   |  | |.|      ..| ||||  |  |.. .| .   .  | .|  
Sbjct: 731 LIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKS-- 788

Query: 444 KLLQAEQEKRCHRVQSDHRRMKVDGK-ICSES---PAKKKSE 481
                |   .|.  ..|   . .. | ||.|.   |   ||.
Sbjct: 789 ---HMENTFKCND-KADTSSLIINNKLICNETVEVPKDSKSK 826

>hg18||uc001vjt |13|AX747335|Q8WWI1-3|Q8WWI1-3|LMO7|NM_005358|NP_005349|LIM
        domain only 7

          Length = 1049

 Score =  32 bits (70), Expect = 4.069
 Identities = 15/65 (23%), Positives = 33/65 (50%)

Query: 403 EEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
           ||.     |.. ..|    |  |..|.     .   |. . | |||| |..    .   |
Sbjct: 934 EERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKRPAEEQKR 993

Query: 463 RMKVD 467
           . ...
Sbjct: 994 QAEIE 998

>hg18||uc001vjw |13|AK055465|Q5JV86|Q5JV86_HUMAN|LMO7|NM_005358|NP_005349|LIM
        domain only 7

          Length = 1056

 Score =  32 bits (70), Expect = 4.069
 Identities = 15/65 (23%), Positives = 33/65 (50%)

Query:  403 EEQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQAEQEKRCHRVQSDHR 462
            ||.     |.. ..|    |  |..|.     .   |. . | |||| |..    .   |
Sbjct:  941 EERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKRPAEEQKR 1000

Query:  463 RMKVD 467
            . ...
Sbjct: 1001 QAEIE 1005

>hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-iso (Fragment)

          Length = 624

 Score =  31 bits (69), Expect = 5.314
 Identities = 31/134 (23%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 344 ADKVDQLSSKIDDLQKQANLSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRIE 403
           |.|. .|  |.  |.|| .          |        . . .| |  ...  ||    .
Sbjct: 484 AEKLKRLDEKLGILEKQPSPE---EIREREREKEREREKELEKEQEQEREKEREKDRERQ 540

Query: 404 EQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQ--AEQEKRCHRVQSDH 461
           ..  |  |  .. || .|.      |.    ..  .. . | ||   |||| |   . . 
Sbjct: 541 QEKEKELEKEQEKQREMEKE----RKQEKEKELERQKEKEKELQKMKEQEKEC---ELEK 593

Query: 462 RRMKVDGKICSESP 475
            | |.. ||    |
Sbjct: 594 EREKLEEKIEPREP 607

>hg18||uc001ghs
        |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172|NP_055987|HBxAg
        transactivated protein 2

          Length = 2817

 Score =  31 bits (69), Expect = 5.314
 Identities = 31/134 (23%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 344 ADKVDQLSSKIDDLQKQANLSAGVSSMPMETSIILHNIQRIVQENECLKKEVFEKSSRIE 403
           |.|. .|  |.  |.|| .          |        . . .| |  ...  ||    .
Sbjct: 482 AEKLKRLDEKLGILEKQPSPE---EIREREREKEREREKELEKEQEQEREKEREKDRERQ 538

Query: 404 EQNHKISELIEQNQRYLEQSNLLLEKRNDSFKMSNEQSQAKLLQ--AEQEKRCHRVQSDH 461
           ..  |  |  .. || .|.      |.    ..  .. . | ||   |||| |   . . 
Sbjct: 539 QEKEKELEKEQEKQREMEKE----RKQEKEKELERQKEKEKELQKMKEQEKEC---ELEK 591

Query: 462 RRMKVDGKICSESP 475
            | |.. ||    |
Sbjct: 592 EREKLEEKIEPREP 605

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0