BLASTP 7.6.0


Query=fugu4_746312 |jgi|Takru4|746312|fgh5_pg.C_scaffold_3521000001
        (189 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002wja |20|NM_023068|Q9BZZ2|SN_HUMAN|SIGLEC1|NM_023068|N...     47   2e-005
hg18||uc002php |19|NM_198479|Q8N7U7|Q8N7U7_HUMAN|TPRX1|NM_198479...     32   0.403
hg18||uc001fqz |1|BC028933|Q8N6S2|Q8N6S2_HUMAN|FCRL3|NM_052939|N...     32   0.527
hg18||uc001fra |1|AL833391|NA|NA|FCRH3|NA|NA|Homo sapiens SH2 do...     32   0.527
hg18||uc001frb |1|NM_052939|Q96P31|Q96P31_HUMAN|FCRL3|NM_052939|...     32   0.527
hg18||uc001frc |1|AK098122|Q96P31|Q96P31_HUMAN|FCRL3|NM_052939|N...     32   0.527
hg18||uc004fjb |X|NM_000425|P32004|L1CAM_HUMAN|L1CAM|NM_000425|N...     32   0.527
hg18||uc004fjc |X|NM_024003|P32004-2|P32004-2|L1CAM|NM_024003|NP...     32   0.527
hg18||uc001rmm |12|NM_001843|Q12860|CNTN1_HUMAN|CNTN1|NM_001843|...     30   1.174
hg18||uc001rmn |12|NM_175038|Q12860-2|Q12860-2|CNTN1|NM_175038|N...     30   1.174
hg18||uc001rmo |12|BC036569|Q12860-3|Q12860-3|CNTN1|NM_001843|NP...     30   1.174
hg18||uc002uag |2|NM_033394|NA|NA|TANC1|NM_033394|NP_203752|TPR ...     30   2.002
hg18||uc002wja |20|NM_023068|Q9BZZ2|SN_HUMAN|SIGLEC1|NM_023068|N...     30   2.002
hg18||uc001lsw |11|AY312160|NA|NA|MUC6|NA|NA|Homo sapiens mucin ...     29   2.614
hg18||uc003tac |7|NM_175887|Q8IV56|PRR15_HUMAN|PRR15|NM_175887|N...     29   2.614
hg18||uc001oeo |11|AL834433|Q9H7M7|Q9H7M7_HUMAN|FLJ00043|NA|NA|F...     28   4.459
hg18||uc002jxc |17|NM_005189|Q14781|CBX2_HUMAN|CBX2|NM_005189|NP...     28   4.459
hg18||uc001rta |12|AF010404|O14686-2|O14686-2|MLL2|NM_003482|NP_...     28   7.607
hg18||uc001rtb |12|NM_003482|NA|NA|MLL2|NM_003482|NP_003473|myel...     28   7.607
hg18||uc002gzz |17|NM_016231|Q9UBE8|NLK_HUMAN|NLK|NM_016231|NP_0...     28   7.607
hg18||uc002ter |2|DQ307286|A0SDZ7|A0SDZ7_HUMAN|POSH2|NA|NA|Plent...     28   7.607
hg18||uc003lrl |5|BC047521|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP...     28   7.607
hg18||uc003lrm |5|NM_005211|P07333|CSF1R_HUMAN|CSF1R|NM_005211|N...     28   7.607
hg18||uc001yhf |14|CR616378|P23381|SYWC_HUMAN|WARS|NM_173701|NP_...     27   9.934
hg18||uc001yhg |14|BC095453|P23381|SYWC_HUMAN|WARS|NM_213646|NP_...     27   9.934
hg18||uc001yhh |14|NM_004184|P23381|SYWC_HUMAN|WARS|NM_004184|NP...     27   9.934
hg18||uc001yhl |14|NM_173701|P23381|SYWC_HUMAN|WARS|NM_173701|NP...     27   9.934

>hg18||uc002wja
        |20|NM_023068|Q9BZZ2|SN_HUMAN|SIGLEC1|NM_023068|NP_075556|sialoadhesin
        precursor

          Length = 1709

 Score =  47 bits (109), Expect = 2e-005
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query:   2 KVKISPSTEVTEGDRVKLTCNTSCPLTNNKNYIWYLNDQLLQLPEHQNKHLVLAVVTPQH 61
           .. |||. || ||  | |.| .    | .  . ||||  ||   |     |.|   .   
Sbjct: 512 RLLISPAAEVVEGQAVTLSCRSGLSPTPDARFSWYLNGALLH--EGPGSSLLLPAASSTD 569

Query:  62 AGNYSCAVNTQRDVRSP 78
           ||.| |          |
Sbjct: 570 AGSYHCRARDGHSASGP 586

>hg18||uc002php
        |19|NM_198479|Q8N7U7|Q8N7U7_HUMAN|TPRX1|NM_198479|NP_940881|tetra-pepti
        de repeat homeobox

          Length = 411

 Score =  32 bits (71), Expect = 0.403
 Identities = 18/33 (54%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 137 GSCPDPNPAPGSLSGPAALSPINATSPTATAFL 169
           || | | | ||||  || | |    || |. ||
Sbjct: 315 GSVPAPIPGPGSLPAPAPLWP---QSPDASDFL 344

>hg18||uc001fqz |1|BC028933|Q8N6S2|Q8N6S2_HUMAN|FCRL3|NM_052939|NP_443171|Fc
        receptor-like 3 precursor

          Length = 742

 Score =  32 bits (70), Expect = 0.527
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query:  57 VTPQHAGNYSC-AVNTQRDVRSPEKTLRVQSSSLKWTLTAAAGVR---VALLVFTSLVII 112
           .| .|.||||| | |      |   || |  .|   |   |||.    ...||  .   .
Sbjct: 534 LTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAAL 593

Query: 113 WIMWVKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
            . . .                ||  | .|     | | |. . |     || .  |.|.
Sbjct: 594 -LHYARARRKPGGLSATGTSSHSPSECQEP-----SSSRPSRIDP---QEPTHSKPLAPM 644

Query: 173 ARE 175
             |
Sbjct: 645 ELE 647

>hg18||uc001fra |1|AL833391|NA|NA|FCRH3|NA|NA|Homo sapiens SH2 domain-containing
        phosphatase anchor protein 2a mRNA, complete cds, alternatively
        spliced

          Length = 460

 Score =  32 bits (70), Expect = 0.527
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query:  57 VTPQHAGNYSC-AVNTQRDVRSPEKTLRVQSSSLKWTLTAAAGVR---VALLVFTSLVII 112
           .| .|.||||| | |      |   || |  .|   |   |||.    ...||  .   .
Sbjct: 260 LTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAAL 319

Query: 113 WIMWVKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
            . . .                ||  | .|     | | |. . |     || .  |.|.
Sbjct: 320 -LHYARARRKPGGLSATGTSSHSPSECQEP-----SSSRPSRIDP---QEPTHSKPLAPM 370

Query: 173 ARE 175
             |
Sbjct: 371 ELE 373

>hg18||uc001frb |1|NM_052939|Q96P31|Q96P31_HUMAN|FCRL3|NM_052939|NP_443171|Fc
        receptor-like 3 precursor

          Length = 734

 Score =  32 bits (70), Expect = 0.527
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query:  57 VTPQHAGNYSC-AVNTQRDVRSPEKTLRVQSSSLKWTLTAAAGVR---VALLVFTSLVII 112
           .| .|.||||| | |      |   || |  .|   |   |||.    ...||  .   .
Sbjct: 534 LTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAAL 593

Query: 113 WIMWVKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
            . . .                ||  | .|     | | |. . |     || .  |.|.
Sbjct: 594 -LHYARARRKPGGLSATGTSSHSPSECQEP-----SSSRPSRIDP---QEPTHSKPLAPM 644

Query: 173 ARE 175
             |
Sbjct: 645 ELE 647

>hg18||uc001frc |1|AK098122|Q96P31|Q96P31_HUMAN|FCRL3|NM_052939|NP_443171|Fc
        receptor-like 3 precursor

          Length = 724

 Score =  32 bits (70), Expect = 0.527
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query:  57 VTPQHAGNYSC-AVNTQRDVRSPEKTLRVQSSSLKWTLTAAAGVR---VALLVFTSLVII 112
           .| .|.||||| | |      |   || |  .|   |   |||.    ...||  .   .
Sbjct: 534 LTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAAL 593

Query: 113 WIMWVKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
            . . .                ||  | .|     | | |. . |     || .  |.|.
Sbjct: 594 -LHYARARRKPGGLSATGTSSHSPSECQEP-----SSSRPSRIDP---QEPTHSKPLAPM 644

Query: 173 ARE 175
             |
Sbjct: 645 ELE 647

>hg18||uc004fjb |X|NM_000425|P32004|L1CAM_HUMAN|L1CAM|NM_000425|NP_000416|L1
        cell adhesion molecule isoform 1 precursor

          Length = 1257

 Score =  32 bits (70), Expect = 0.527
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 6/86 (6%)

Query:   8 STEVTEGDRVKLTCNTSCPLTNNKNYIWYLNDQLLQLPEHQNKH------LVLAVVTPQH 61
           ||   .| ||  ||  |   .   .  |  . . ||     .|.      ||.  .    
Sbjct: 526 STIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSD 585

Query:  62 AGNYSCAVNTQRDVRSPEKTLRVQSS 87
            |||||  .|. ||      | |  |
Sbjct: 586 QGNYSCVASTELDVVESRAQLLVVGS 611

>hg18||uc004fjc |X|NM_024003|P32004-2|P32004-2|L1CAM|NM_024003|NP_076493|L1 cell
        adhesion molecule isoform 2 precursor

          Length = 1253

 Score =  32 bits (70), Expect = 0.527
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 6/86 (6%)

Query:   8 STEVTEGDRVKLTCNTSCPLTNNKNYIWYLNDQLLQLPEHQNKH------LVLAVVTPQH 61
           ||   .| ||  ||  |   .   .  |  . . ||     .|.      ||.  .    
Sbjct: 526 STIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSD 585

Query:  62 AGNYSCAVNTQRDVRSPEKTLRVQSS 87
            |||||  .|. ||      | |  |
Sbjct: 586 QGNYSCVASTELDVVESRAQLLVVGS 611

>hg18||uc001rmm
        |12|NM_001843|Q12860|CNTN1_HUMAN|CNTN1|NM_001843|NP_001834|contactin 1
        isoform 1 precursor

          Length = 1018

 Score =  30 bits (67), Expect = 1.174
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query:  11 VTEGDRVKLTCNTSCPLTNNKNYIWYLND-------QLLQLPEHQNKHLVLAVVTPQHAG 63
           | ||  . | |.      .. .| | ||.          .     | .| .| |     |
Sbjct: 148 VKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKG 207

Query:  64 NYSCAVNTQRDVRS 77
           |||| |..    .|
Sbjct: 208 NYSCFVSSPSITKS 221

>hg18||uc001rmn
        |12|NM_175038|Q12860-2|Q12860-2|CNTN1|NM_175038|NP_778203|contactin 1
        isoform 2 precursor

          Length = 1007

 Score =  30 bits (67), Expect = 1.174
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query:  11 VTEGDRVKLTCNTSCPLTNNKNYIWYLND-------QLLQLPEHQNKHLVLAVVTPQHAG 63
           | ||  . | |.      .. .| | ||.          .     | .| .| |     |
Sbjct: 137 VKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKG 196

Query:  64 NYSCAVNTQRDVRS 77
           |||| |..    .|
Sbjct: 197 NYSCFVSSPSITKS 210

>hg18||uc001rmo
        |12|BC036569|Q12860-3|Q12860-3|CNTN1|NM_001843|NP_001834|contactin 1
        isoform 1 precursor

          Length = 627

 Score =  30 bits (67), Expect = 1.174
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query:  11 VTEGDRVKLTCNTSCPLTNNKNYIWYLND-------QLLQLPEHQNKHLVLAVVTPQHAG 63
           | ||  . | |.      .. .| | ||.          .     | .| .| |     |
Sbjct: 148 VKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKG 207

Query:  64 NYSCAVNTQRDVRS 77
           |||| |..    .|
Sbjct: 208 NYSCFVSSPSITKS 221

>hg18||uc002uag |2|NM_033394|NA|NA|TANC1|NM_033394|NP_203752|TPR domain,
        ankyrin-repeat and

          Length = 1861

 Score =  30 bits (65), Expect = 2.002
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 128 IRQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTATA 167
           .|||   |||| |  .     |     ||| ..|| ..||
Sbjct: 437 MRQIASNSPGSSPKTSDPTQDLHFTPLLSPSSSTSASSTA 476

>hg18||uc002wja
        |20|NM_023068|Q9BZZ2|SN_HUMAN|SIGLEC1|NM_023068|NP_075556|sialoadhesin
        precursor

          Length = 1709

 Score =  30 bits (65), Expect = 2.002
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query:   5 ISPSTEVTEGDRVKLTCNTSCPLTNN-KNYIWYLNDQLLQLPEHQNKHLVLAVVTPQHAG 63
           |.||  . ||    |||| |     .  |. |. |  |    .   . . |  |    | 
Sbjct: 713 IAPSHTLQEGTEANLTCNVSREAAGSPANFSWFRNGVL--WAQGPLETVTLLPVARTDAA 770

Query:  64 NYSCAVNTQ 72
            |.| . |.
Sbjct: 771 LYACRILTE 779

>hg18||uc001lsw |11|AY312160|NA|NA|MUC6|NA|NA|Homo sapiens mucin glycoprotein
        (MUC6) mRNA, partial cds

          Length = 1206

 Score =  29 bits (64), Expect = 2.614
 Identities = 13/38 (34%), Positives = 18/38 (47%)

Query:  129 RQIKRTSPGSCPDPNPAPGSLSGPAALSPINATSPTAT 166
            ...  |.      | | | | .||    |   | ||||
Sbjct:  985 QELPGTTATQTTGPRPTPASTTGPTTPQPGQPTRPTAT 1022

>hg18||uc003tac
        |7|NM_175887|Q8IV56|PRR15_HUMAN|PRR15|NM_175887|NP_787083|proline rich
        15

          Length = 129

 Score =  29 bits (64), Expect = 2.614
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 116 WVKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAALSP 157
           | | ||||     .. |  . |  |   ||||  . ||  ||
Sbjct:  13 WWKSLTNSR----KKSKEAAVGVPPPAQPAPGEPTPPAPPSP 50

>hg18||uc001oeo |11|AL834433|Q9H7M7|Q9H7M7_HUMAN|FLJ00043|NA|NA|FLJ00043 protein
        (Fragment)

          Length = 1451

 Score =  28 bits (62), Expect = 4.459
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query:  137 GSCPDPNPAPGSLSGPAALSPINATSPTATAFLSP 171
            |  |||.||||  .   .  |   .||.     ||
Sbjct: 1241 GQAPDPSPAPGPPTAADSQQPPGGSSPSEEPPPSP 1275

>hg18||uc002jxc
        |17|NM_005189|Q14781|CBX2_HUMAN|CBX2|NM_005189|NP_005180|chromobox
        homolog 2 isoform 1

          Length = 532

 Score =  28 bits (62), Expect = 4.459
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 134 TSPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPLA 173
           |.    |  |||||  .|   .    || || |.    ||
Sbjct: 376 TATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLA 415

>hg18||uc001rta
        |12|AF010404|O14686-2|O14686-2|MLL2|NM_003482|NP_003473|myeloid/lymphoi
        d or mixed-lineage leukemia 2

          Length = 4957

 Score =  28 bits (60), Expect = 7.607
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 135 SPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
           .||| |.|   ||||.     ||.    |   | ..|.
Sbjct: 550 APGSQPEPGQTPGSLASELKGSPV-LLDPEELAPVTPM 586

>hg18||uc001rtb |12|NM_003482|NA|NA|MLL2|NM_003482|NP_003473|myeloid/lymphoid or
        mixed-lineage leukemia 2

          Length = 5262

 Score =  28 bits (60), Expect = 7.607
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 135 SPGSCPDPNPAPGSLSGPAALSPINATSPTATAFLSPL 172
           .||| |.|   ||||.     ||.    |   | ..|.
Sbjct: 855 APGSQPEPGQTPGSLASELKGSPV-LLDPEELAPVTPM 891

>hg18||uc002gzz |17|NM_016231|Q9UBE8|NLK_HUMAN|NLK|NM_016231|NP_057315|nemo like
        kinase

          Length = 515

 Score =  28 bits (60), Expect = 7.607
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 142 PNPAPGSLSGPAALSPINATSPTA 165
           |.||||   |||| .|    .  |
Sbjct:  83 PSPAPGQAPGPAAAAPAQVQAAAA 106

>hg18||uc002ter |2|DQ307286|A0SDZ7|A0SDZ7_HUMAN|POSH2|NA|NA|Plenty of SH3s-2
        (Fragment)

          Length = 270

 Score =  28 bits (60), Expect = 7.607
 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 5/58 (8%)

Query: 128 IRQIKR--TSPGSCPDPNPAPGSLSGPAAL---SPINATSPTATAFLSPLAREVRGDI 180
           |||  |  ||||  |   | ||  . |           ..| .  |||  |    | .
Sbjct:  76 IRQRPRAGTSPGGSPPARPIPGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTAGSL 133

>hg18||uc003lrl |5|BC047521|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP_005202|colony
        stimulating factor 1 receptor precursor

          Length = 972

 Score =  28 bits (60), Expect = 7.607
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query:  47 HQNKH-----LVLAVVTPQHAGNYSCAVNTQRDVRSPEKTLRVQSSS 88
           | |..     | |  |  ||||||||  .  .   |     ||  |.
Sbjct: 253 HNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESA 299

>hg18||uc003lrm |5|NM_005211|P07333|CSF1R_HUMAN|CSF1R|NM_005211|NP_005202|colony
        stimulating factor 1 receptor precursor

          Length = 972

 Score =  28 bits (60), Expect = 7.607
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query:  47 HQNKH-----LVLAVVTPQHAGNYSCAVNTQRDVRSPEKTLRVQSSS 88
           | |..     | |  |  ||||||||  .  .   |     ||  |.
Sbjct: 253 HNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESA 299

>hg18||uc001yhf
        |14|CR616378|P23381|SYWC_HUMAN|WARS|NM_173701|NP_776049|tryptophanyl-tR
        NA synthetase isoform a

          Length = 471

 Score =  27 bits (59), Expect = 9.934
 Identities = 15/38 (39%), Positives = 16/38 (42%)

Query: 117 VKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAA 154
           |||| .    |           ||  |||| |  || |
Sbjct:  40 VKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDA 77

>hg18||uc001yhg
        |14|BC095453|P23381|SYWC_HUMAN|WARS|NM_213646|NP_998811|tryptophanyl-tR
        NA synthetase isoform b

          Length = 471

 Score =  27 bits (59), Expect = 9.934
 Identities = 15/38 (39%), Positives = 16/38 (42%)

Query: 117 VKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAA 154
           |||| .    |           ||  |||| |  || |
Sbjct:  40 VKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDA 77

>hg18||uc001yhh
        |14|NM_004184|P23381|SYWC_HUMAN|WARS|NM_004184|NP_004175|tryptophanyl-t
        RNA synthetase isoform a

          Length = 471

 Score =  27 bits (59), Expect = 9.934
 Identities = 15/38 (39%), Positives = 16/38 (42%)

Query: 117 VKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAA 154
           |||| .    |           ||  |||| |  || |
Sbjct:  40 VKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDA 77

>hg18||uc001yhl
        |14|NM_173701|P23381|SYWC_HUMAN|WARS|NM_173701|NP_776049|tryptophanyl-t
        RNA synthetase isoform a

          Length = 471

 Score =  27 bits (59), Expect = 9.934
 Identities = 15/38 (39%), Positives = 16/38 (42%)

Query: 117 VKMLTNSTFFYIRQIKRTSPGSCPDPNPAPGSLSGPAA 154
           |||| .    |           ||  |||| |  || |
Sbjct:  40 VKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDA 77

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0