BLASTP 7.6.0


Query=fugu4_746039 |jgi|Takru4|746039|fgh5_pg.C_scaffold_3217000001
        (535 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hxg |4|NM_025212|Q9H2H0|Q9H2H0_HUMAN|CXXC4|NM_025212|...     90   6e-018
hg18||uc003les |5|NM_016463|Q9NV51|Q9NV51_HUMAN|CXXC5|NM_016463|...     84   5e-016
hg18||uc003let |5|AK001782|Q8TB79|Q8TB79_HUMAN|CXXC5|NA|NA|Hypot...     84   5e-016
hg18||uc001jok |10|NM_030625|Q8NFU7|CXXC6_HUMAN|CXXC6|NM_030625|...     70   8e-012
hg18||uc001pta |11|NM_005933|Q03164|HRX_HUMAN|MLL|NM_005933|NP_0...     40   0.007
hg18||uc001ptb |11|L04731|Q03164|HRX_HUMAN|MLL|NM_005933|NP_0059...     40   0.007
hg18||uc002mng |19|NM_001379|P26358|DNMT1_HUMAN|DNMT1|NM_001379|...     35   0.283
hg18||uc002mnh |19|BC092517|Q569F5|Q569F5_HUMAN|DNMT1|NA|NA|DNMT...     35   0.283
hg18||uc002mni |19|BC126227|P26358-2|P26358-2|DNMT1|NM_001379|NP...     35   0.283
hg18||uc002mnj |19|AB209413|Q59FP7|Q59FP7_HUMAN|DNMT1|NM_001379|...     35   0.283
hg18||uc001ojw |11|NM_012308|Q9Y2K7|JHD1A_HUMAN|FBXL11|NM_012308...     30   6.981
hg18||uc001ojy |11|BC047371|Q9Y2K7-2|Q9Y2K7-2|FBXL11|NA|NA|JmjC ...     30   6.981
hg18||uc001ojz |11|BC056905|NA|NA|KIAA1004|NA|NA|Homo sapiens mR...     30   6.981

>hg18||uc003hxg |4|NM_025212|Q9H2H0|Q9H2H0_HUMAN|CXXC4|NM_025212|NP_079488|CXXC
        finger 4

          Length = 198

 Score =  90 bits (222), Expect = 6e-018
 Identities = 37/40 (92%), Positives = 39/40 (97%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRKTGHQICKFRKC 333
           |.|||||||| ||.||||||||||||||||||||||||||
Sbjct: 133 KKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKC 172

>hg18||uc003les |5|NM_016463|Q9NV51|Q9NV51_HUMAN|CXXC5|NM_016463|NP_057547|CXXC
        finger 5

          Length = 227

 Score =  84 bits (205), Expect = 5e-016
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRKTGHQICKFRKC 333
           |.||||||.| |||| |||  |||||||||||||||||||
Sbjct: 162 KKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKC 201

>hg18||uc003let |5|AK001782|Q8TB79|Q8TB79_HUMAN|CXXC5|NA|NA|Hypothetical protein
        (CXXC5 protein) (Putative MAPK activating protein) (Putative NFkB
        activating protein)

          Length = 322

 Score =  84 bits (205), Expect = 5e-016
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRKTGHQICKFRKC 333
           |.||||||.| |||| |||  |||||||||||||||||||
Sbjct: 257 KKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKC 296

>hg18||uc001jok |10|NM_030625|Q8NFU7|CXXC6_HUMAN|CXXC6|NM_030625|NP_085128|CXXC
        finger 6

          Length = 2136

 Score =  70 bits (169), Expect = 8e-012
 Identities = 27/40 (67%), Positives = 32/40 (80%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRKTGHQICKFRKC 333
           |.|||||||| ||..  ||| |. |.|||  ||||| |||
Sbjct: 585 KKKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKC 624

>hg18||uc001pta
        |11|NM_005933|Q03164|HRX_HUMAN|MLL|NM_005933|NP_005924|myeloid/lymphoid
        or mixed-lineage leukemia

          Length = 3969

 Score =  40 bits (92), Expect = 0.007
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query:  295 RKRKRCGVCGPCRRLINCGVCSSCRN------RKTGHQICKFRKC 333
            |. .||| |  |.   .||||..| .      |    | || |||
Sbjct: 1150 RRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKC 1194

>hg18||uc001ptb
        |11|L04731|Q03164|HRX_HUMAN|MLL|NM_005933|NP_005924|myeloid/lymphoid or
        mixed-lineage leukemia

          Length = 3972

 Score =  40 bits (92), Expect = 0.007
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query:  295 RKRKRCGVCGPCRRLINCGVCSSCRN------RKTGHQICKFRKC 333
            |. .||| |  |.   .||||..| .      |    | || |||
Sbjct: 1150 RRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKC 1194

>hg18||uc002mng |19|NM_001379|P26358|DNMT1_HUMAN|DNMT1|NM_001379|NP_001370|DNA
        (cytosine-5-)-methyltransferase 1

          Length = 1616

 Score =  35 bits (78), Expect = 0.283
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 296 KRKRCGVCGPCRRLINCGVCSSCRNR-KTG-----HQICKFRKC 333
           ||.|||||  |..   || | .|..  | |      | |. |.|
Sbjct: 649 KRRRCGVCEVCQQ-PECGKCKACKDMVKFGGSGRSKQACQERRC 691

>hg18||uc002mnh |19|BC092517|Q569F5|Q569F5_HUMAN|DNMT1|NA|NA|DNMT1 protein

          Length = 1511

 Score =  35 bits (78), Expect = 0.283
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 296 KRKRCGVCGPCRRLINCGVCSSCRNR-KTG-----HQICKFRKC 333
           ||.|||||  |..   || | .|..  | |      | |. |.|
Sbjct: 544 KRRRCGVCEVCQQ-PECGKCKACKDMVKFGGSGRSKQACQERRC 586

>hg18||uc002mni |19|BC126227|P26358-2|P26358-2|DNMT1|NM_001379|NP_001370|DNA
        (cytosine-5-)-methyltransferase 1

          Length = 1694

 Score =  35 bits (78), Expect = 0.283
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 296 KRKRCGVCGPCRRLINCGVCSSCRNR-KTG-----HQICKFRKC 333
           ||.|||||  |..   || | .|..  | |      | |. |.|
Sbjct: 727 KRRRCGVCEVCQQ-PECGKCKACKDMVKFGGSGRSKQACQERRC 769

>hg18||uc002mnj |19|AB209413|Q59FP7|Q59FP7_HUMAN|DNMT1|NM_001379|NP_001370|DNA
        (cytosine-5-)-methyltransferase 1

          Length = 1681

 Score =  35 bits (78), Expect = 0.283
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 296 KRKRCGVCGPCRRLINCGVCSSCRNR-KTG-----HQICKFRKC 333
           ||.|||||  |..   || | .|..  | |      | |. |.|
Sbjct: 711 KRRRCGVCEVCQQ-PECGKCKACKDMVKFGGSGRSKQACQERRC 753

>hg18||uc001ojw
        |11|NM_012308|Q9Y2K7|JHD1A_HUMAN|FBXL11|NM_012308|NP_036440|F-box and
        leucine-rich repeat protein 11

          Length = 1162

 Score =  30 bits (66), Expect = 6.981
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRK------TGHQICKFRKC 333
           .|.| ||  |  | .   ||||  ||. |         | |  |.|
Sbjct: 565 RRRRVRCRKCKACVQ-GECGVCHYCRDMKKFGGPGRMKQSCVLRQC 609

>hg18||uc001ojy |11|BC047371|Q9Y2K7-2|Q9Y2K7-2|FBXL11|NA|NA|JmjC
        domain-containing histone demethylation protein 1A (EC 1.14.11.27)
        ([Histone-H3]-lysine-36 demethylase 1A) (F-box/LRR- repeat protein 11)
        (F-box and leucine-rich repeat protein 11) (F-box protein FBL7) (F-box
        protein Lilina)

          Length = 856

 Score =  30 bits (66), Expect = 6.981
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRK------TGHQICKFRKC 333
           .|.| ||  |  | .   ||||  ||. |         | |  |.|
Sbjct: 259 RRRRVRCRKCKACVQ-GECGVCHYCRDMKKFGGPGRMKQSCVLRQC 303

>hg18||uc001ojz |11|BC056905|NA|NA|KIAA1004|NA|NA|Homo sapiens mRNA for KIAA1004
        protein, partial cds

          Length = 583

 Score =  30 bits (66), Expect = 6.981
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 294 KRKRKRCGVCGPCRRLINCGVCSSCRNRK------TGHQICKFRKC 333
           .|.| ||  |  | .   ||||  ||. |         | |  |.|
Sbjct:  23 RRRRVRCRKCKACVQ-GECGVCHYCRDMKKFGGPGRMKQSCVLRQC 67

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0