BLASTP 7.6.0


Query=fugu4_745851 |jgi|Takru4|745851|fgh5_pg.C_scaffold_3048000001
        (280 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001opi |11|NM_018043|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_0180...    245   8e-065
hg18||uc001opj |11|AL833582|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_01804...    245   8e-065
hg18||uc001opk |11|AK097619|Q8N7V3|Q8N7V3_HUMAN|TMEM16A|NM_01804...    243   2e-064
hg18||uc001qnm |12|NM_020373|NA|NA|TMEM16B|NM_020373|NP_065106|t...    220   3e-057
hg18||uc001mqi |11|NM_213599|Q75V66|TM16E_HUMAN|TMEM16E|NM_21359...    161   1e-039
hg18||uc001mqj |11|AL832374|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599...    161   1e-039
hg18||uc001opi |11|NM_018043|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_0180...    155   6e-038
hg18||uc001opj |11|AL833582|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_01804...    155   6e-038
hg18||uc001thw |12|NM_178826|Q8NB39|Q8NB39_HUMAN|TMEM16D|NM_1788...    155   6e-038
hg18||uc001thx |12|BC109308|Q32M45|Q32M45_HUMAN|TMEM16D|NM_17882...    155   6e-038
hg18||uc001mqt |11|NM_031418|Q9BYT9|TM16C_HUMAN|TMEM16C|NM_03141...    152   5e-037
hg18||uc002wax |2|NM_001001891|Q6IWH7|Q6IWH7_HUMAN|TMEM16G|NM_00...    152   5e-037
hg18||uc001qnm |12|NM_020373|NA|NA|TMEM16B|NM_020373|NP_065106|t...    150   3e-036
hg18||uc001roo |12|NM_001025356|Q4KMQ2|TM16F_HUMAN|TMEM16F|NM_00...    140   2e-033
hg18||uc001lpi |11|NM_001012302|A1A5B4|A1A5B4_HUMAN|TMEM16J|NM_0...    135   6e-032
hg18||uc001opk |11|AK097619|Q8N7V3|Q8N7V3_HUMAN|TMEM16A|NM_01804...     96   4e-020
hg18||uc001mqi |11|NM_213599|Q75V66|TM16E_HUMAN|TMEM16E|NM_21359...     89   7e-018
hg18||uc001mqj |11|AL832374|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599...     89   7e-018
hg18||uc001mqt |11|NM_031418|Q9BYT9|TM16C_HUMAN|TMEM16C|NM_03141...     89   7e-018
hg18||uc002wax |2|NM_001001891|Q6IWH7|Q6IWH7_HUMAN|TMEM16G|NM_00...     84   1e-016
hg18||uc001thy |12|AX747621|Q8NAJ0|Q8NAJ0_HUMAN|TMEM16D|NM_17882...     42   6e-004
hg18||uc002ngf |19|NM_020959|Q9HCE9|TM16H_HUMAN|TMEM16H|NM_02095...     41   0.001
hg18||uc002ngf |19|NM_020959|Q9HCE9|TM16H_HUMAN|TMEM16H|NM_02095...     40   0.003
hg18||uc003cmv |3|NM_018075|NA|NA|TMEM16K|NM_018075|NP_060545|hy...     37   0.031
hg18||uc003cmw |3|AK131223|Q9NW15|Q9NW15_HUMAN|TMEM16K|NM_018075...     37   0.031

>hg18||uc001opi
        |11|NM_018043|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_018043|NP_060513|transmemb
        rane protein 16A

          Length = 960

 Score =  245 bits (623), Expect = 8e-065
 Identities = 109/127 (85%), Positives = 118/127 (92%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           ||||||.|||||||||||||||||||||.|||||||||.|.||||||.|| |.|||||||
Sbjct: 322 KYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL 381

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           ||  |||||. .|| ||||||||||||||||||||||||  |||||||.|||||| ||||
Sbjct: 382 CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLT 441

Query: 121 GFGEEEE 127
           || ||||
Sbjct: 442 GFEEEEE 448

>hg18||uc001opj
        |11|AL833582|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_018043|NP_060513|transmembr
        ane protein 16A

          Length = 986

 Score =  245 bits (623), Expect = 8e-065
 Identities = 109/127 (85%), Positives = 118/127 (92%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           ||||||.|||||||||||||||||||||.|||||||||.|.||||||.|| |.|||||||
Sbjct: 322 KYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL 381

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           ||  |||||. .|| ||||||||||||||||||||||||  |||||||.|||||| ||||
Sbjct: 382 CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLT 441

Query: 121 GFGEEEE 127
           || ||||
Sbjct: 442 GFEEEEE 448

>hg18||uc001opk
        |11|AK097619|Q8N7V3|Q8N7V3_HUMAN|TMEM16A|NM_018043|NP_060513|transmembr
        ane protein 16A

          Length = 642

 Score =  243 bits (620), Expect = 2e-064
 Identities = 108/127 (85%), Positives = 118/127 (92%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           ||||||.|||||||||||||||||||||.|||||||||.|.||||||.|| |.|||||||
Sbjct: 294 KYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL 353

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           ||  |||||. .|| ||||||||||||||||||||||||  |||||||.|||||| ||||
Sbjct: 354 CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLT 413

Query: 121 GFGEEEE 127
           || |||.
Sbjct: 414 GFEEEED 420

>hg18||uc001qnm |12|NM_020373|NA|NA|TMEM16B|NM_020373|NP_065106|transmembrane
        protein 16B

          Length = 999

 Score =  220 bits (558), Expect = 3e-057
 Identities = 95/134 (70%), Positives = 114/134 (85%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           ||||||.||||||||.||  |||.|..|||||||||||....||| |.|| .|  |||||
Sbjct: 350 KYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPL 409

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           || .| || | .|||||.||||||||||||||.|||||| .|.|.||| |||| | ||||
Sbjct: 410 CDKSCDYWNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLT 469

Query: 121 GFGEEEEGFQLASK 134
           |  ||||  |  |.
Sbjct: 470 GIEEEEERAQEHSR 483

>hg18||uc001mqi
        |11|NM_213599|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599|NP_998764|transmembr
        ane protein 16E

          Length = 913

 Score =  161 bits (405), Expect = 1e-039
 Identities = 68/132 (51%), Positives = 93/132 (70%), Gaps = 2/132 (1%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPR--NNITMCP 59
           |.|||.|.|| .|| ||.||  |..||.  |.||  ... |  | |||||     . |||
Sbjct: 295 YYGEKIGIYFVFLGFYTEMLFFAAVVGLACFIYGLLSMEHNTSSTEICDPEIGGQMIMCP 354

Query:  60 LCDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDL 119
           |||  | ||.| . |  .. |||||| .||||..|| .|  ||.| ||.|| || | |||
Sbjct: 355 LCDQVCDYWRLNSTCLASKFSHLFDNESTVFFAIFMGIWVTLFLEFWKQRQARLEYEWDL 414

Query: 120 TGFGEEEEGFQL 131
             | ||..  ||
Sbjct: 415 VDFEEEQQQLQL 426

>hg18||uc001mqj
        |11|AL832374|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599|NP_998764|transmembra
        ne protein 16E

          Length = 912

 Score =  161 bits (405), Expect = 1e-039
 Identities = 68/132 (51%), Positives = 93/132 (70%), Gaps = 2/132 (1%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPR--NNITMCP 59
           |.|||.|.|| .|| ||.||  |..||.  |.||  ... |  | |||||     . |||
Sbjct: 294 YYGEKIGIYFVFLGFYTEMLFFAAVVGLACFIYGLLSMEHNTSSTEICDPEIGGQMIMCP 353

Query:  60 LCDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDL 119
           |||  | ||.| . |  .. |||||| .||||..|| .|  ||.| ||.|| || | |||
Sbjct: 354 LCDQVCDYWRLNSTCLASKFSHLFDNESTVFFAIFMGIWVTLFLEFWKQRQARLEYEWDL 413

Query: 120 TGFGEEEEGFQL 131
             | ||..  ||
Sbjct: 414 VDFEEEQQQLQL 425

>hg18||uc001opi
        |11|NM_018043|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_018043|NP_060513|transmemb
        rane protein 16A

          Length = 960

 Score =  155 bits (391), Expect = 6e-038
 Identities = 72/92 (78%), Positives = 82/92 (89%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           .|||||.|||||||||| |.|||||..||| |.|||.|| ||||| |.|.  |.||||||
Sbjct: 567 IEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECA 626

Query: 232 HAGCLMELCIQLCITMLGKQLIQNNLFEIGIP 263
             |||||||||| | |||||||||||||||||
Sbjct: 627 PGGCLMELCIQLSIIMLGKQLIQNNLFEIGIP 658

>hg18||uc001opj
        |11|AL833582|Q5XXA6|Q5XXA6_HUMAN|TMEM16A|NM_018043|NP_060513|transmembr
        ane protein 16A

          Length = 986

 Score =  155 bits (391), Expect = 6e-038
 Identities = 72/92 (78%), Positives = 82/92 (89%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           .|||||.|||||||||| |.|||||..||| |.|||.|| ||||| |.|.  |.||||||
Sbjct: 593 IEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECA 652

Query: 232 HAGCLMELCIQLCITMLGKQLIQNNLFEIGIP 263
             |||||||||| | |||||||||||||||||
Sbjct: 653 PGGCLMELCIQLSIIMLGKQLIQNNLFEIGIP 684

>hg18||uc001thw
        |12|NM_178826|Q8NB39|Q8NB39_HUMAN|TMEM16D|NM_178826|NP_849148|transmemb
        rane protein 16D

          Length = 920

 Score =  155 bits (391), Expect = 6e-038
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 1/127 (0%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           .|||||.|||||||| || || ||. .|. |||||  |.| .  | |.|    .| |||.
Sbjct: 306 RYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQ-ATDIIMCPV 364

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           ||  | . .|  .|  |. .||||| |||||.||||.|| .|.| ||||.  . | ||| 
Sbjct: 365 CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLI 424

Query: 121 GFGEEEE 127
            . ||||
Sbjct: 425 DWEEEEE 431

>hg18||uc001thx
        |12|BC109308|Q32M45|Q32M45_HUMAN|TMEM16D|NM_178826|NP_849148|transmembr
        ane protein 16D

          Length = 955

 Score =  155 bits (391), Expect = 6e-038
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 1/127 (0%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           .|||||.|||||||| || || ||. .|. |||||  |.| .  | |.|    .| |||.
Sbjct: 341 RYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQ-ATDIIMCPV 399

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           ||  | . .|  .|  |. .||||| |||||.||||.|| .|.| ||||.  . | ||| 
Sbjct: 400 CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLI 459

Query: 121 GFGEEEE 127
            . ||||
Sbjct: 460 DWEEEEE 466

>hg18||uc001mqt
        |11|NM_031418|Q9BYT9|TM16C_HUMAN|TMEM16C|NM_031418|NP_113606|transmembr
        ane protein 16C

          Length = 981

 Score =  152 bits (383), Expect = 5e-037
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 1/126 (0%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPLC 61
           |||||.|||||||| || |||||.|||. || ||  |....  | |||     . |||||
Sbjct: 387 YFGEKIGLYFAWLGWYTGMLIPAAIVGLCVFFYGLFTMNNSQVSQEIC-KATEVFMCPLC 445

Query:  62 DHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLTG 121
           |  ||  .|  .|  |. ..||||  ||||..|||.|| .|.| ||||.  | | |||  
Sbjct: 446 DKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWATVFLEFWKRRRSILTYTWDLIE 505

Query: 122 FGEEEE 127
           . ||||
Sbjct: 506 WEEEEE 511

>hg18||uc002wax
        |2|NM_001001891|Q6IWH7|Q6IWH7_HUMAN|TMEM16G|NM_001001891|NP_001001891|t
        ransmembrane protein 16G isoform NGEP long

          Length = 933

 Score =  152 bits (383), Expect = 5e-037
 Identities = 68/127 (53%), Positives = 90/127 (70%), Gaps = 1/127 (0%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPL 60
           .|||||| ||||||| ||  |.||..|| .||| ||  |  .||. |.|  ...  ||||
Sbjct: 337 RYFGEKVALYFAWLGFYTGWLLPAAVVGTLVFLVGCFLVFSDIPTQELCGSKDSFEMCPL 396

Query:  61 CDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLT 120
           |   | .| | .||  |.|  |||.  |||||.|||||||| .|.|||.   | | || .
Sbjct: 397 C-LDCPFWLLSSACALAQAGRLFDHGGTVFFSLFMALWAVLLLEYWKRKSATLAYRWDCS 455

Query: 121 GFGEEEE 127
            . . ||
Sbjct: 456 DYEDTEE 462

>hg18||uc001qnm |12|NM_020373|NA|NA|TMEM16B|NM_020373|NP_065106|transmembrane
        protein 16B

          Length = 999

 Score =  150 bits (377), Expect = 3e-036
 Identities = 68/92 (73%), Positives = 80/92 (86%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           .|||||...|||||| | |.||||||..|| |.|||.|| ||||| |.||   |||||||
Sbjct: 606 IEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECA 665

Query: 232 HAGCLMELCIQLCITMLGKQLIQNNLFEIGIP 263
             |||||||||| | ||||||||||.||||.|
Sbjct: 666 PGGCLMELCIQLSIIMLGKQLIQNNIFEIGVP 697

>hg18||uc001roo
        |12|NM_001025356|Q4KMQ2|TM16F_HUMAN|TMEM16F|NM_001025356|NP_001020527|t
        ransmembrane protein 16F

          Length = 910

 Score =  140 bits (352), Expect = 2e-033
 Identities = 63/129 (48%), Positives = 83/129 (64%), Gaps = 2/129 (1%)

Query:   1 KYFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDP--RNNITMC 58
           ||.|||.|.|||||| |||||. |..|||  ||||    |.   | |.| |     | ||
Sbjct: 289 KYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMC 348

Query:  59 PLCDHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWD 118
           | ||  | .|||   | ...   .||.  |. |.||| .|  ||.| |||||  | | ||
Sbjct: 349 PQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWD 408

Query: 119 LTGFGEEEE 127
                .||.
Sbjct: 409 TVELQQEEQ 417

>hg18||uc001lpi
        |11|NM_001012302|A1A5B4|A1A5B4_HUMAN|TMEM16J|NM_001012302|NP_001012302|
        tumor protein p53 inducible protein 5

          Length = 782

 Score =  135 bits (339), Expect = 6e-032
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 1/130 (0%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLYGCATVDDNIPSMEICDPRNNITMCPLC 61
           |||||| ||| ||| || ||.||.. |..||| | .  . .  | |||.  ..| |||| 
Sbjct: 182 YFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICE-AHDILMCPLG 240

Query:  62 DHACSYWKLMTACGTARASHLFDNPATVFFSVFMALWAVLFMEHWKRRQMRLNYVWDLTG 121
           ||.  | .|   |  |. .|||||  || |..|||||| .|.| |||.. |.   |||  
Sbjct: 241 DHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYV 300

Query: 122 FGEEEEGFQL 131
           . ||.|   |
Sbjct: 301 WDEEQEEMAL 310

>hg18||uc001opk
        |11|AK097619|Q8N7V3|Q8N7V3_HUMAN|TMEM16A|NM_018043|NP_060513|transmembr
        ane protein 16A

          Length = 642

 Score =  96 bits (237), Expect = 4e-020
 Identities = 42/58 (72%), Positives = 52/58 (89%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEE 229
           .|||||.|||||||||| |.|||||..||| |.|||.|| ||||| |.|.  |.||||
Sbjct: 535 IEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE 592

>hg18||uc001mqi
        |11|NM_213599|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599|NP_998764|transmembr
        ane protein 16E

          Length = 913

 Score =  89 bits (218), Expect = 7e-018
 Identities = 39/84 (46%), Positives = 55/84 (65%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           .|.|.| . .|  |  | |. .||| ..   |.|||.|. || |||| |.   .| ||| 
Sbjct: 543 MEIPRTYQEYESSLTLKMFLFQFVNFYSSCFYVAFFKGKFVGYPGKYTYLFNEWRSEECD 602

Query: 232 HAGCLMELCIQLCITMLGKQLIQN 255
             |||.||  || | | |||.  |
Sbjct: 603 PGGCLIELTTQLTIIMTGKQIFGN 626

>hg18||uc001mqj
        |11|AL832374|Q75V66|TM16E_HUMAN|TMEM16E|NM_213599|NP_998764|transmembra
        ne protein 16E

          Length = 912

 Score =  89 bits (218), Expect = 7e-018
 Identities = 39/84 (46%), Positives = 55/84 (65%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           .|.|.| . .|  |  | |. .||| ..   |.|||.|. || |||| |.   .| ||| 
Sbjct: 542 MEIPRTYQEYESSLTLKMFLFQFVNFYSSCFYVAFFKGKFVGYPGKYTYLFNEWRSEECD 601

Query: 232 HAGCLMELCIQLCITMLGKQLIQN 255
             |||.||  || | | |||.  |
Sbjct: 602 PGGCLIELTTQLTIIMTGKQIFGN 625

>hg18||uc001mqt
        |11|NM_031418|Q9BYT9|TM16C_HUMAN|TMEM16C|NM_031418|NP_113606|transmembr
        ane protein 16C

          Length = 981

 Score =  89 bits (218), Expect = 7e-018
 Identities = 42/92 (45%), Positives = 59/92 (64%), Gaps = 1/92 (1%)

Query: 172 LEVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECA 231
           || |.|.  .|     | |. .|||  . | |.||| || || ||||  .   .|.||| 
Sbjct: 624 LEYPRTESEWENSFALKMFLFQFVNLNSSIFYIAFFLGRFVGHPGKYNKLFDRWRLEECH 683

Query: 232 HAGCLMELCIQLCITMLGKQLIQNNLFEIGIP 263
            .|||..||.|. . |  || | ||  |.| |
Sbjct: 684 PSGCLIDLCLQMGVIMFLKQ-IWNNFMELGYP 714

>hg18||uc002wax
        |2|NM_001001891|Q6IWH7|Q6IWH7_HUMAN|TMEM16G|NM_001001891|NP_001001891|t
        ransmembrane protein 16G isoform NGEP long

          Length = 933

 Score =  84 bits (207), Expect = 1e-016
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 2/91 (2%)

Query: 173 EVPKTDKSFEERLIFKTFILKFVNAFTPIVYLAFFRGRLVGRPGKYLYVVGSYRMEECAH 232
           |. .|   ||.    | || .||| ..  ||.|||.|| || || |  . |  | |||| 
Sbjct: 575 EMHRTQTKFEDAFTLKVFIFQFVNFYSSPVYIAFFKGRFVGYPGNYHTLFG-VRNEECAA 633

Query: 233 AGCLMELCIQLCITMLGKQLIQNNLFEIGIP 263
            |||.||  .| . |.|||.| ||. |. ||
Sbjct: 634 GGCLIELAQELLVIMVGKQVI-NNMQEVLIP 663

>hg18||uc001thy
        |12|AX747621|Q8NAJ0|Q8NAJ0_HUMAN|TMEM16D|NM_178826|NP_849148|transmembr
        ane protein 16D

          Length = 475

 Score =  42 bits (98), Expect = 6e-004
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query:  95 MALWAVLFMEHWKRRQMRLNYVWDLTGFGEEE 126
           ||.|| .|.| ||||.  . | |||  . |||
Sbjct:   1 MAVWATVFLEFWKRRRAVIAYDWDLIDWEEEE 32

>hg18||uc002ngf
        |19|NM_020959|Q9HCE9|TM16H_HUMAN|TMEM16H|NM_020959|NP_066010|hypothetic
        al protein LOC57719

          Length = 1232

 Score =  41 bits (95), Expect = 0.001
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query:  89 VFFSVFMALWAVLFMEHWKRRQMRLNYVW---DLTGFGEEEEGFQLASKRRLT 138
           | |..|  .|. ||.| ||||   | | |   |  |   ||   |    ||..
Sbjct: 285 VVFALFNVIWSTLFLEEWKRRGAELAYKWGTLDSPGEAVEEPRPQFRGVRRIS 337

>hg18||uc002ngf
        |19|NM_020959|Q9HCE9|TM16H_HUMAN|TMEM16H|NM_020959|NP_066010|hypothetic
        al protein LOC57719

          Length = 1232

 Score =  40 bits (92), Expect = 0.003
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLY 34
           ||| |. .|||||| ||  ..  .. | ... .
Sbjct: 240 YFGVKIAMYFAWLGFYTSAMVYPAVFGSVLYTF 272

>hg18||uc003cmv |3|NM_018075|NA|NA|TMEM16K|NM_018075|NP_060545|hypothetical
        protein LOC55129

          Length = 660

 Score =  37 bits (83), Expect = 0.031
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLY 34
           |||| . ||| .|  .|  ||| ...|.  .|.
Sbjct: 203 YFGETIALYFGFLEYFTFALIPMAVIGLPYYLF 235

>hg18||uc003cmw
        |3|AK131223|Q9NW15|Q9NW15_HUMAN|TMEM16K|NM_018075|NP_060545|hypothetica
        l protein LOC55129

          Length = 594

 Score =  37 bits (83), Expect = 0.031
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query:   2 YFGEKVGLYFAWLGVYTQMLIPASIVGVIVFLY 34
           |||| . ||| .|  .|  ||| ...|.  .|.
Sbjct: 137 YFGETIALYFGFLEYFTFALIPMAVIGLPYYLF 169

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,183,133
Number of Sequences: 45480
Number of Extensions: 191183133
Number of Successful Extensions: 11127707
Number of sequences better than 0.0: 0
BLASTP 7.6.0