BLASTP 7.6.0


Query=fugu4_745828 |jgi|Takru4|745828|fgh5_pg.C_scaffold_3021000001
        (343 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002gom |17|NM_031898|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|...    226   5e-059
hg18||uc002gon |17|AK223534|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|N...    226   5e-059
hg18||uc002czz |16|NM_144674|Q96M29|TEKT5_HUMAN|TEKT5|NM_144674|...    184   2e-046
hg18||uc002stw |2|NM_144705|Q8WW24|TEKT4_HUMAN|TEKT4|NM_144705|N...    143   5e-034
hg18||uc002gom |17|NM_031898|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|...    138   1e-032
hg18||uc002gon |17|AK223534|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|N...    138   1e-032
hg18||uc002gdt |17|NM_053285|Q969V4|TEKT1_HUMAN|TEKT1|NM_053285|...    125   9e-029
hg18||uc002czz |16|NM_144674|Q96M29|TEKT5_HUMAN|TEKT5|NM_144674|...    107   2e-023
hg18||uc001bzr |1|NM_014466|Q9UIF3|TEKT2_HUMAN|TEKT2|NM_014466|N...     96   6e-020
hg18||uc001bzs |1|BC022005|NA|NA|h-tektin-t|NA|NA|Homo sapiens m...     96   6e-020
hg18||uc003jac |4_random|DQ786282|Q8NAE5|Q8NAE5_HUMAN|LOC389833|...     80   3e-015
hg18||uc003jah |4_random|AX747734|Q8NAE5|Q8NAE5_HUMAN|LOC389833|...     80   3e-015
hg18||uc002zka |21_random|NM_001033515|Q6GMR3|Q6GMR3_HUMAN|LOC38...     67   3e-011
hg18||uc003jad |4_random|NM_001033515|Q6GMR3|Q6GMR3_HUMAN|LOC389...     67   3e-011
hg18||uc002stw |2|NM_144705|Q8WW24|TEKT4_HUMAN|TEKT4|NM_144705|N...     66   6e-011
hg18||uc002gmk |17|NM_003802|Q9UKX3|MYH13_HUMAN|MYH13|NM_003802|...     48   1e-005
hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1...     36   0.072
hg18||uc002gll |17|NM_005964|Q149N4|Q149N4_HUMAN|MYH10|NM_005964...     32   1.037
hg18||uc002glm |17|AB210026|Q4LE45|Q4LE45_HUMAN|MYH10|NM_005964|...     32   1.037
hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_0...     32   1.354
hg18||uc001kyh |10|NM_001008723|Q5T655|Q5T655_HUMAN|C10orf80|NM_...     31   1.768
hg18||uc002ddv |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001...     31   1.768
hg18||uc002ddw |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844...     31   1.768
hg18||uc002ddx |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001...     31   1.768
hg18||uc002ddy |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|...     31   1.768
hg18||uc003okk |6|NM_022047|Q9H4E7|Q9H4E7_HUMAN|DEF6|NM_022047|N...     30   3.016
hg18||uc002xbi |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884...     30   3.939
hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP...     30   3.939
hg18||uc002hvf |17|NM_181539|Q7Z3Y9|Q7Z3Y9_HUMAN|KRT26|NM_181539...     30   5.145
hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|...     29   8.776

>hg18||uc002gom
        |17|NM_031898|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|NP_114104|tektin 3

          Length = 490

 Score =  226 bits (574), Expect = 5e-059
 Identities = 110/178 (61%), Positives = 143/178 (80%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           ||||||| ||||.|| |.  |. ||||||| ||..|.|| .||||||| .||||||||||
Sbjct: 312 QSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQE 371

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           |||||| |||.|.|...| . ||||||||.|||||||.|||||     ||.|| |..||.
Sbjct: 372 IFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTI 431

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRKSFPSMPRLAGY 341
             |..|| .||.            |.||..|||||..|||||||.|||.|.  || |.
Sbjct: 432 QTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGF 489

>hg18||uc002gon |17|AK223534|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|NP_114104|tektin
        3

          Length = 490

 Score =  226 bits (574), Expect = 5e-059
 Identities = 110/178 (61%), Positives = 143/178 (80%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           ||||||| ||||.|| |.  |. ||||||| ||..|.|| .||||||| .||||||||||
Sbjct: 312 QSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQE 371

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           |||||| |||.|.|...| . ||||||||.|||||||.|||||     ||.|| |..||.
Sbjct: 372 IFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTI 431

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRKSFPSMPRLAGY 341
             |..|| .||.            |.||..|||||..|||||||.|||.|.  || |.
Sbjct: 432 QTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGF 489

>hg18||uc002czz
        |16|NM_144674|Q96M29|TEKT5_HUMAN|TEKT5|NM_144674|NP_653275|tektin 5

          Length = 485

 Score =  184 bits (466), Expect = 2e-046
 Identities = 96/179 (53%), Positives = 121/179 (67%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           |. || | .||.| | |    | .|| ||   |.||. | ||  | || ||| |||||||
Sbjct: 307 QNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQE 366

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           ||| |  |  |.|..  || |||||||||| ||||||.||||| |   ||.||  |.||.
Sbjct: 367 IFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTL 426

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRKSFPSMPRLAGYS 342
             |. || | ..            ||.|.||||.| .|.|||| .||.||  ||| |..
Sbjct: 427 QTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFPCTPRLVGHT 485

>hg18||uc002stw |2|NM_144705|Q8WW24|TEKT4_HUMAN|TEKT4|NM_144705|NP_653306|tektin
        4

          Length = 435

 Score =  143 bits (358), Expect = 5e-034
 Identities = 77/178 (43%), Positives = 111/178 (62%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           | || ||  ||  .. ..  || ..  | . ||.||  |  |  ||.  |  || |||.|
Sbjct: 257 QRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLRE 316

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           |   |  . .||.|...||.|| ||||||  |. |||.|||||     |.||| |.  ..
Sbjct: 317 ITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSL 376

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRKSFPSMPRLAGY 341
             |||.| |||             | |..   ||||.|..|||. |  .|.. .||||
Sbjct: 377 TALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAGY 434

>hg18||uc002gom
        |17|NM_031898|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|NP_114104|tektin 3

          Length = 490

 Score =  138 bits (347), Expect = 1e-032
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 1/167 (0%)

Query:   2 AASYRNTKSALAVNPSVSL-WKSNNFYQASNAGPTLSCVPRENLDLVRAKTMFYPSNRTV 60
           |.|||.      .  |.|| |. . .|. ..  |...     .  .     . . |||| 
Sbjct:  30 ASSYRDRFPHSNLTHSLSLPWRPSTYYKVASNSPSVAPYCTRSQRVSENTMLPFVSNRTT 89

Query:  61 LTTRYSPDDWYKSNQNNYXXXXXXXXXXXXXXXDTVRLIQDKNQLTRRTQENSSKNIGER 120
             |||.|||||.||  ||               || |||||| | ||.|| ....|.|||
Sbjct:  90 FFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGER 149

Query: 121 LNSIVFWKSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSER 167
           .| | |||||. |||| |. |  || .||.|||||| ||| | |  |
Sbjct: 150 VNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVAR 196

>hg18||uc002gon |17|AK223534|Q9BXF9|TEKT3_HUMAN|TEKT3|NM_031898|NP_114104|tektin
        3

          Length = 490

 Score =  138 bits (347), Expect = 1e-032
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 1/167 (0%)

Query:   2 AASYRNTKSALAVNPSVSL-WKSNNFYQASNAGPTLSCVPRENLDLVRAKTMFYPSNRTV 60
           |.|||.      .  |.|| |. . .|. ..  |...     .  .     . . |||| 
Sbjct:  30 ASSYRDRFPHSNLTHSLSLPWRPSTYYKVASNSPSVAPYCTRSQRVSENTMLPFVSNRTT 89

Query:  61 LTTRYSPDDWYKSNQNNYXXXXXXXXXXXXXXXDTVRLIQDKNQLTRRTQENSSKNIGER 120
             |||.|||||.||  ||               || |||||| | ||.|| ....|.|||
Sbjct:  90 FFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGER 149

Query: 121 LNSIVFWKSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSER 167
           .| | |||||. |||| |. |  || .||.|||||| ||| | |  |
Sbjct: 150 VNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVAR 196

>hg18||uc002gdt
        |17|NM_053285|Q969V4|TEKT1_HUMAN|TEKT1|NM_053285|NP_444515|tektin 1

          Length = 418

 Score =  125 bits (313), Expect = 9e-029
 Identities = 62/168 (36%), Positives = 102/168 (60%)

Query: 166 ERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQEIF 225
           .|  |  |.  .. ... |. ..  | . |. || |   .| ||.. |  |||| ..|| 
Sbjct: 231 QRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIA 290

Query: 226 QTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTVYK 285
             |  | .|..|. ..| | ||| |||| || |||||||||   . |. || ||   | .
Sbjct: 291 SQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVAR 350

Query: 286 LRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRKSFP 333
           |.| |..|.             . .. .| |....|.  || .||| |
Sbjct: 351 LKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIP 398

>hg18||uc002czz
        |16|NM_144674|Q96M29|TEKT5_HUMAN|TEKT5|NM_144674|NP_653275|tektin 5

          Length = 485

 Score =  107 bits (267), Expect = 2e-023
 Identities = 59/144 (40%), Positives = 84/144 (58%), Gaps = 5/144 (3%)

Query:  21 WKSNNFYQASNAGPTLSCVPRENLDLVRAKTMFYPSNRTVLTTRYSPDDWYKSNQNNYXX 80
           |. . ||. .|    .   | |.   .|  |.  |. |. | .|||| || .|||     
Sbjct:  50 WRPSLFYKIAN----VQTCPDESTSTLRPPTIL-PTLRSALFSRYSPHDWDQSNQLQVRG 104

Query:  81 XXXXXXXXXXXXXDTVRLIQDKNQLTRRTQENSSKNIGERLNSIVFWKSELSHELDNMVT 140
                        |..||.|||.||| . || . .|.|.||. | |||||||.||| ..|
Sbjct: 105 AEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLT 164

Query: 141 EIAALAEVKRRLERALAETEGPFQ 164
           |   |  |||||| |  |   | |
Sbjct: 165 ENQNLETVKRRLECAANEVNCPLQ 188

>hg18||uc001bzr |1|NM_014466|Q9UIF3|TEKT2_HUMAN|TEKT2|NM_014466|NP_055281|tektin
        2

          Length = 430

 Score =  96 bits (237), Expect = 6e-020
 Identities = 56/167 (33%), Positives = 90/167 (53%), Gaps = 1/167 (0%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           ..|  |. .||.   . .  |. |.  |      ||  |  |     . |.     ||.|
Sbjct: 230 EAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEE 289

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           | . .  |  |.  .| |   ||.. |||| || |||||||||   . |  || ..| |.
Sbjct: 290 IAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATI 349

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRK 330
             |...|..|..            . |.. ||||. ||  |||  |.
Sbjct: 350 AALKQKLAQAQDALDALCKHLARLQADIACKANSMLLD-TKCMDTRR 395

>hg18||uc001bzs |1|BC022005|NA|NA|h-tektin-t|NA|NA|Homo sapiens mRNA for
        h-TEKTIN-t, complete cds

          Length = 336

 Score =  96 bits (237), Expect = 6e-020
 Identities = 56/167 (33%), Positives = 90/167 (53%), Gaps = 1/167 (0%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           ..|  |. .||.   . .  |. |.  |      ||  |  |     . |.     ||.|
Sbjct: 136 EAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEE 195

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHHSLVSEVMEIEDTV 283
           | . .  |  |.  .| |   ||.. |||| || |||||||||   . |  || ..| |.
Sbjct: 196 IAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATI 255

Query: 284 YKLRERLSEAENXXXXXXXXXXXXEHDLSIKANSLFLDQEKCMSLRK 330
             |...|..|..            . |.. ||||. ||  |||  |.
Sbjct: 256 AALKQKLAQAQDALDALCKHLARLQADIACKANSMLLD-TKCMDTRR 301

>hg18||uc003jac |4_random|DQ786282|Q8NAE5|Q8NAE5_HUMAN|LOC389833|NA|NA|CDNA
        FLJ35473 fis, clone SMINT2007433, weakly similar to Tektin A1

          Length = 159

 Score =  80 bits (196), Expect = 3e-015
 Identities = 42/103 (40%), Positives = 63/103 (61%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           | ||  |  |   .. ..  || ..  | . ||.||  |  |  | .. || || | |.|
Sbjct:  41 QRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGRRCEELEDVRHKLQHHLHKMLRE 100

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRD 266
           |   |  . .|| |...|| || .|||||   . |||..|||.
Sbjct: 101 ITDQEHNVVALKEAIKDKEEPLHIAQTRLYLLSHRPNMQLCRE 143

>hg18||uc003jah |4_random|AX747734|Q8NAE5|Q8NAE5_HUMAN|LOC389833|NA|NA|CDNA
        FLJ35473 fis, clone SMINT2007433, weakly similar to Tektin A1

          Length = 153

 Score =  80 bits (196), Expect = 3e-015
 Identities = 42/103 (40%), Positives = 63/103 (61%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           | ||  |  |   .. ..  || ..  | . ||.||  |  |  | .. || || | |.|
Sbjct:  41 QRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGRRCEELEDVRHKLQHHLHKMLRE 100

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRD 266
           |   |  . .|| |...|| || .|||||   . |||..|||.
Sbjct: 101 ITDQEHNVVALKEAIKDKEEPLHIAQTRLYLLSHRPNMQLCRE 143

>hg18||uc002zka
        |21_random|NM_001033515|Q6GMR3|Q6GMR3_HUMAN|LOC389833|NM_001033515|NP_0
        01028687|hypothetical protein LOC389833

          Length = 129

 Score =  67 bits (162), Expect = 3e-011
 Identities = 37/89 (41%), Positives = 54/89 (60%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           | ||  |  |   .. ..  || ..  | . ||.||  |  |  ||.. || || | |.|
Sbjct:  41 QRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKMLRE 100

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRL 252
           |   |  . .|| |...|| || .|||||
Sbjct: 101 ITDQEHNVVALKEAIKDKEEPLHIAQTRL 129

>hg18||uc003jad
        |4_random|NM_001033515|Q6GMR3|Q6GMR3_HUMAN|LOC389833|NM_001033515|NP_00
        1028687|hypothetical protein LOC389833

          Length = 129

 Score =  67 bits (162), Expect = 3e-011
 Identities = 37/89 (41%), Positives = 54/89 (60%)

Query: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223
           | ||  |  |   .. ..  || ..  | . ||.||  |  |  ||.. || || | |.|
Sbjct:  41 QRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKMLRE 100

Query: 224 IFQTEMLIESLKRAVREKESPLKVAQTRL 252
           |   |  . .|| |...|| || .|||||
Sbjct: 101 ITDQEHNVVALKEAIKDKEEPLHIAQTRL 129

>hg18||uc002stw |2|NM_144705|Q8WW24|TEKT4_HUMAN|TEKT4|NM_144705|NP_653306|tektin
        4

          Length = 435

 Score =  66 bits (159), Expect = 6e-011
 Identities = 33/102 (32%), Positives = 54/102 (52%)

Query:  62 TTRYSPDDWYKSNQNNYXXXXXXXXXXXXXXXDTVRLIQDKNQLTRRTQENSSKNIGERL 121
           |..|  ..|...    |               .. .|  .   | .|||..|.. .||||
Sbjct:  36 TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERL 95

Query: 122 NSIVFWKSELSHELDNMVTEIAALAEVKRRLERALAETEGPF 163
                |||||  |.. .  |   |   |.||||||  || ||
Sbjct:  96 QDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPF 137

>hg18||uc002gmk
        |17|NM_003802|Q9UKX3|MYH13_HUMAN|MYH13|NM_003802|NP_003793|myosin,
        heavy polypeptide 13, skeletal muscle

          Length = 1938

 Score =  48 bits (113), Expect = 1e-005
 Identities = 56/221 (25%), Positives = 92/221 (41%), Gaps = 45/221 (20%)

Query:  107 RRTQENSSKNIGERLNS-------IVFWKSELSHELDNMVTEIAALAEVKRRLERALAET 159
            |. | .|   .||....       .   ||||  |.|.| . | ||.. |  .||     
Sbjct: 1197 RKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIEALSKSKSNIERTCRTV 1256

Query:  160 EGPFQSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAK 219
            |  | ||  |  . . ..   .|     .  |    |   |.|  |    | || . | |
Sbjct: 1257 EDQF-SEIKAKDEQQTQLIHDLNMQKARLQTQ----NGELSHRVEE----KESLISQLTK 1307

Query:  220 TLQEIFQTEMLIESLKR------------------------AVREKESPLKVAQTRLEER 255
            . | . |    .| |||                         .||.    . |.  |.  
Sbjct: 1308 SKQALTQQ---LEELKRQMEEETKAKNAMAHALQSSRHDCDLLREQYEEEQEAKAELQRA 1364

Query:  256 TRRPNVELC--RDNPHHSLVSEVMEIEDTVYKLRERLSEAE 294
              . | |.   |       .    |.|.   || .|| |||
Sbjct: 1365 LSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAE 1405

>hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1000 protein
        (Fragment)

          Length = 1946

 Score =  36 bits (81), Expect = 0.072
 Identities = 36/191 (18%), Positives = 77/191 (40%), Gaps = 6/191 (3%)

Query:   69 DWYKSNQNNYXXXXXXXXXXXXXXXDTVRL--IQDKNQLTRRTQENSSKNIGERLNSIVF 126
            || . .. .                . ..|    ... . . |    .||. | ....  
Sbjct: 1467 DWKQKHEESQALLDASQKEVQALSTELLKLKNTYEESIVGQETLRRENKNLQEEISNLTN 1526

Query:  127 WKSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEIEILMNATSG 186
               | .  |  |      . | |  ..  | ||||    ||  |  |  ..|.|      
Sbjct: 1527 QVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETEGAL--ERNESKILHFQLELL--EAKA 1582

Query:  187 EMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQEIFQTEMLIESLKRAVREKESPLK 246
            |.  . .  .    |   .     .|||. |    .   .   | . ..  . | |  | 
Sbjct: 1583 ELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSRIEVTRLKKKMEEDLNEMELQLS 1642

Query:  247 VAQTRLEERTR 257
             |  .. | |.
Sbjct: 1643 CANRQVSEATK 1653

>hg18||uc002gll
        |17|NM_005964|Q149N4|Q149N4_HUMAN|MYH10|NM_005964|NP_005955|myosin,
        heavy polypeptide 10, non-muscle

          Length = 1976

 Score =  32 bits (71), Expect = 1.037
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRD 175
            . ||. |. |  .  .|| . |||||  .|. |   . |..    | |
Sbjct: 1710 RDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLND 1757

>hg18||uc002glm
        |17|AB210026|Q4LE45|Q4LE45_HUMAN|MYH10|NM_005964|NP_005955|myosin,
        heavy polypeptide 10, non-muscle

          Length = 2007

 Score =  32 bits (71), Expect = 1.037
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRD 175
            . ||. |. |  .  .|| . |||||  .|. |   . |..    | |
Sbjct: 1741 RDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLND 1788

>hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_001714|dystonin
        isoform 1e precursor

          Length = 2649

 Score =  32 bits (70), Expect = 1.354
 Identities = 44/193 (22%), Positives = 82/193 (42%), Gaps = 23/193 (11%)

Query:  101 DKNQLTRRTQENSSKNIGERLNSIVFWKSELSHELDNMVTEIAALAEVKRRLERALAETE 160
            ..|  |||| |.  |     || .   |..|  ||         | .. ...|. ||   
Sbjct: 1243 EENTFTRRTLEDHLKRKDLSLNDLEQQKNKLMEELRRKRDNEEELLKLIKQMEKDLA--- 1299

Query:  161 GPFQ---SERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHL 217
              ||   .|.    | . |.|     |  .   . | . |    . .         | | 
Sbjct: 1300 --FQKQVAEKQLKEKQKIELEARRKITEIQYTCRENALPVCPITQATSCRAVTGLQQEHD 1357

Query:  218 AKTLQEIFQTEMLIESLKRAVREKE----------SPLKVAQTRLEERTRRPNVELCRDN 267
             .  .|. |    .. |  | |. |          . |.. .|  ||. |    .|  | 
Sbjct: 1358 KQKAEELKQQ---VDELTAANRKAEQDMRELTYELNALQLEKTSSEEKARLLKDKL--DE 1412

Query:  268 PHHSLVSEVMEIE 280
             ...|    .|.|
Sbjct: 1413 TNNTLRCLKLELE 1425

>hg18||uc001kyh
        |10|NM_001008723|Q5T655|Q5T655_HUMAN|C10orf80|NM_001008723|NP_001008723
        |hypothetical protein LOC159686

          Length = 872

 Score =  31 bits (69), Expect = 1.768
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 211 NSLQTHLAKTLQEIFQTEMLIESLKRAVREKESPLKVAQTRLEERTRRPNVELCRDNPHH 270
           .| || .    | . ...  .. |.. ..|..   . |   ||.   | | .| ..|  |
Sbjct: 233 DSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMR-NAKLQQENEQH 291

Query: 271 SLVSEVMEIEDTVYKLRERLSEAE 294
           ||| | .  |.    |  .  | |
Sbjct: 292 SLVCEQLSQENQQKALELKAKEEE 315

>hg18||uc002ddv
        |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001040113|NP_001035202|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1945

 Score =  31 bits (69), Expect = 1.768
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEI 177
            | ||. || . ..   || . |||||  .|. |   . |.     . | .
Sbjct: 1717 KEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRV 1766

>hg18||uc002ddw
        |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844|NP_074035|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1938

 Score =  31 bits (69), Expect = 1.768
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEI 177
            | ||. || . ..   || . |||||  .|. |   . |.     . | .
Sbjct: 1710 KEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRV 1759

>hg18||uc002ddx
        |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001040114|NP_001035203|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1979

 Score =  31 bits (69), Expect = 1.768
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEI 177
            | ||. || . ..   || . |||||  .|. |   . |.     . | .
Sbjct: 1717 KEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRV 1766

>hg18||uc002ddy
        |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|NP_002465|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1972

 Score =  31 bits (69), Expect = 1.768
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query:  128 KSELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEI 177
            | ||. || . ..   || . |||||  .|. |   . |.     . | .
Sbjct: 1710 KEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRV 1759

>hg18||uc003okk
        |6|NM_022047|Q9H4E7|Q9H4E7_HUMAN|DEF6|NM_022047|NP_071330|differentiall
        y expressed in FDCP 6 homolog

          Length = 631

 Score =  30 bits (67), Expect = 3.016
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 9/121 (7%)

Query: 141 EIAALAEVKRRLERALAETEGPFQSERAASHKLRDEIE-------ILMNATSGEMWNQFN 193
           |.  | ...   || | | |   ...| |   |..| |        |  |  |..     
Sbjct: 346 ELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQ 405

Query: 194 CVNVAFSNRTSETADAKNSLQTHLAKTLQEIFQTEMLIESLKRAVREKESPLKVAQTRLE 253
               |      |  . . . |    | |.|. |       |.   |  |  ...||||| 
Sbjct: 406 A--RASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLL 463

Query: 254 E 254
           |
Sbjct: 464 E 464

>hg18||uc002xbi
        |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884|NP_065935|myosin,
        heavy polypeptide 7B, cardiac muscle,

          Length = 1983

 Score =  30 bits (66), Expect = 3.939
 Identities = 30/139 (21%), Positives = 59/139 (42%), Gaps = 25/139 (17%)

Query:  130 ELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEIEILMNATSG--- 186
            ... ||.   .  ||| . .| ||||| |        |    ... |.|     . |   
Sbjct: 1476 DVTLELERATSAAAALDKKQRHLERALEE-------RRRQEEEMQRELEAAQRESRGLGT 1528

Query:  187 ----------EMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQEIFQTEMLIE---- 232
                      |       .     |   | .|  . .     |..||. .|.  .|    
Sbjct: 1529 ELFRLRHGHEEALEALETLKRENKNLQEEISDLTDQVSLS-GKSIQELEKTKKALEGEKS 1587

Query:  233 SLKRAVREKESPLKVAQTR 251
             .. |. | |  |.. .|.
Sbjct: 1588 EIQAALEEAEGALELEETK 1606

>hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP_002464|myosin,
        heavy polypeptide 9, non-muscle

          Length = 1960

 Score =  30 bits (66), Expect = 3.939
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query:  102 KNQLTRRTQENSSKNIGERLNSIVFWKSELSHELDNMVTEIA------ALA-EVKRRLER 154
            .|.   .. |     . | | .    | .   | | .  |||      ||| | ||||| 
Sbjct: 1670 ENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEA 1729

Query:  155 ALAETEGPFQSERAASHKLRDEIE 178
             .|. |   . |.  .  . | ..
Sbjct: 1730 RIAQLEEELEEEQGNTELINDRLK 1753

>hg18||uc002hvf
        |17|NM_181539|Q7Z3Y9|Q7Z3Y9_HUMAN|KRT26|NM_181539|NP_853517|keratin
        25B

          Length = 468

 Score =  30 bits (65), Expect = 5.145
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 129 SELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEIEIL 180
           .||   |  .  |. .|  ||   | .|||||| . ..     ...|.| ..
Sbjct: 304 TELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQ---LQQIQDQIGVM 352

>hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|LOC146439
        protein

          Length = 508

 Score =  29 bits (63), Expect = 8.776
 Identities = 31/141 (21%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 129 SELSHELDNMVTEIAALAEVKRRLERALAETEGPFQSERAASHKLRDEIEILMNATSGEM 188
           |||| .   .  ..|  .. .. |.| |    |  |..  |  .||  .| |       .
Sbjct: 151 SELSEQNLRLSQQLAQASQTEQELQRELDALRGQCQAQALAGAELRTRLESLQGENQ-ML 209

Query: 189 WNQFNCVNVAFSNRTSETADAKNSLQT---HLAKTLQEIFQTEMLIESLKRAVREKESPL 245
            ..   .         |    .  |||    |    .|  .  . .|  .    |  | |
Sbjct: 210 QSRRQDLEAQIRGLREEVEKGEGRLQTTHEELLLLRRERREHSLELERARSEAGEALSAL 269

Query: 246 KVAQTR---LEERTRRPNVEL 263
           .  | |   ||| .|  . ..
Sbjct: 270 RRLQRRVSELEEESRLQDADV 290

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,252,843
Number of Sequences: 45480
Number of Extensions: 191252843
Number of Successful Extensions: 11153049
Number of sequences better than 0.0: 0
BLASTP 7.6.0