BLASTP 7.6.0


Query=fugu4_745747 |jgi|Takru4|745747|fgh5_pg.C_scaffold_2935000001
        (397 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hyd...    126   6e-029
hg18||uc002ezv |16|NM_017558|Q9H9B8|Q9H9B8_HUMAN|HYDIN|NM_017558...    126   6e-029
hg18||uc002ezw |16|BC028351|Q8TC08|Q8TC08_HUMAN|HYDIN|NM_017558|...    126   6e-029
hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hyd...    105   2e-022
hg18||uc002ezv |16|NM_017558|Q9H9B8|Q9H9B8_HUMAN|HYDIN|NM_017558...    105   2e-022
hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hyd...     39   0.008
hg18||uc001zyx |15|NM_007347|A0AVD6|A0AVD6_HUMAN|AP4E1|NM_007347...     29   8.196

>hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hydrocephalus
        inducing isoform a

          Length = 5120

 Score =  126 bits (315), Expect = 6e-029
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query:  73 RESTLALTIMGDAMGPDLQPNYSVMDMGNIFMGSNNCYEVQLSNIGLIEATFTIKVPTPA 132
           ||  | | | |. ||| .  |. ..|.| .| || .|||  | | | |.| | .  || |
Sbjct: 444 REIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSA 503

Query: 133 TGFGGCFSIRPDEGVVPPGGCHTVQVSFLSHTCGSFSERLLLTVMGNPDATSLTFRGRVI 192
              | ||   | ||.. | |   .|.|| |   |.| |  |. | |.|.   || || ||
Sbjct: 504 --LGACFVFSPKEGIIEPSGVQAIQISFSSTILGNFEEEFLVNVNGSPEPVKLTIRGCVI 561

Query: 193 GPTFDLSVSDLNFGVVAFG 211
           ||||  .|  |.|| |.||
Sbjct: 562 GPTFHFNVPALHFGDVSFG 580

>hg18||uc002ezv
        |16|NM_017558|Q9H9B8|Q9H9B8_HUMAN|HYDIN|NM_017558|NP_060028|hydrocephal
        us inducing isoform b

          Length = 1017

 Score =  126 bits (315), Expect = 6e-029
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query:  73 RESTLALTIMGDAMGPDLQPNYSVMDMGNIFMGSNNCYEVQLSNIGLIEATFTIKVPTPA 132
           ||  | | | |. ||| .  |. ..|.| .| || .|||  | | | |.| | .  || |
Sbjct: 444 REIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSA 503

Query: 133 TGFGGCFSIRPDEGVVPPGGCHTVQVSFLSHTCGSFSERLLLTVMGNPDATSLTFRGRVI 192
              | ||   | ||.. | |   .|.|| |   |.| |  |. | |.|.   || || ||
Sbjct: 504 --LGACFVFSPKEGIIEPSGVQAIQISFSSTILGNFEEEFLVNVNGSPEPVKLTIRGCVI 561

Query: 193 GPTFDLSVSDLNFGVVAFG 211
           ||||  .|  |.|| |.||
Sbjct: 562 GPTFHFNVPALHFGDVSFG 580

>hg18||uc002ezw
        |16|BC028351|Q8TC08|Q8TC08_HUMAN|HYDIN|NM_017558|NP_060028|hydrocephalu
        s inducing isoform b

          Length = 725

 Score =  126 bits (315), Expect = 6e-029
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query:  73 RESTLALTIMGDAMGPDLQPNYSVMDMGNIFMGSNNCYEVQLSNIGLIEATFTIKVPTPA 132
           ||  | | | |. ||| .  |. ..|.| .| || .|||  | | | |.| | .  || |
Sbjct: 461 REIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSA 520

Query: 133 TGFGGCFSIRPDEGVVPPGGCHTVQVSFLSHTCGSFSERLLLTVMGNPDATSLTFRGRVI 192
              | ||   | ||.. | |   .|.|| |   |.| |  |. | |.|.   || || ||
Sbjct: 521 --LGACFVFSPKEGIIEPSGVQAIQISFSSTILGNFEEEFLVNVNGSPEPVKLTIRGCVI 578

Query: 193 GPTFDLSVSDLNFGVVAFG 211
           ||||  .|  |.|| |.||
Sbjct: 579 GPTFHFNVPALHFGDVSFG 597

>hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hydrocephalus
        inducing isoform a

          Length = 5120

 Score =  105 bits (260), Expect = 2e-022
 Identities = 59/156 (37%), Positives = 83/156 (53%)

Query: 242 MLQFRCGVPDVVLDTPRLDFKRCFLNQPCEQRVLLTNTSELPACCSVLEQAHEGDQLKLS 301
           ..  || || . |    .||  |||  | |. . | |  .||    |  |  |     | 
Sbjct: 688 LITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLF 747

Query: 302 YISKPKGVIGPGSSLEIPVLLLAKATGTLQHTLRIAVFGSIQPPLEVIVSCIGQGPIVES 361
               | ||| | |.. ||..|  . ||  . |. |..|||  |||   .   |.||..  
Sbjct: 748 SSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYV 807

Query: 362 QNQLLDFGKVLVLKDKIRTLELSNKSPIPARFTASL 397
               .||| . ||||  | | | |.| ||| | | .
Sbjct: 808 HPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHM 843

>hg18||uc002ezv
        |16|NM_017558|Q9H9B8|Q9H9B8_HUMAN|HYDIN|NM_017558|NP_060028|hydrocephal
        us inducing isoform b

          Length = 1017

 Score =  105 bits (260), Expect = 2e-022
 Identities = 59/156 (37%), Positives = 83/156 (53%)

Query: 242 MLQFRCGVPDVVLDTPRLDFKRCFLNQPCEQRVLLTNTSELPACCSVLEQAHEGDQLKLS 301
           ..  || || . |    .||  |||  | |. . | |  .||    |  |  |     | 
Sbjct: 688 LITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLF 747

Query: 302 YISKPKGVIGPGSSLEIPVLLLAKATGTLQHTLRIAVFGSIQPPLEVIVSCIGQGPIVES 361
               | ||| | |.. ||..|  . ||  . |. |..|||  |||   .   |.||..  
Sbjct: 748 SSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYV 807

Query: 362 QNQLLDFGKVLVLKDKIRTLELSNKSPIPARFTASL 397
               .||| . ||||  | | | |.| ||| | | .
Sbjct: 808 HPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHM 843

>hg18||uc002ezr |16|NM_032821|NA|NA|HYDIN|NM_032821|NP_116210|hydrocephalus
        inducing isoform a

          Length = 5120

 Score =  39 bits (90), Expect = 0.008
 Identities = 39/182 (21%), Positives = 75/182 (41%), Gaps = 28/182 (15%)

Query:  233 VQVLCRHSRMLQFRCGV------PDVVLDTPRLDFKRCFLNQ----PCEQRVLLTNTSEL 282
            .... . |    | | .      | .       .|  ||. |    | .| ...||  | 
Sbjct: 4285 LELIIKISHGPTFMCNISGCAVSPAIHFSFTSYNFGTCFIYQAGMPPYKQTLVITNKEET 4344

Query:  283 PAC--CSVLEQAHEGDQLKLSYISKPKGVIGPGSSLEIPVLLLAKATGTLQHTLRIAVFG 340
            |    |      |         ..    |. ||..||||.    . .   |  .   . |
Sbjct: 4345 PMSIDCLYTNTTH-------LEVNSRVDVVKPGNTLEIPITFYPRESINYQELIPFEING 4397

Query:  341 SIQPPLEVIVSCIGQGP-----IVESQNQLLDFGKVLVLKDKIRTLELSNKSPIPARFTA 395
              |  .|.     |.|      ...  |...  | ||  .   ||. . | |     |  
Sbjct: 4398 LSQQTVEI----KGKGTKMKILVLDPANRIVKLGAVLPGQVVKRTVSIMNNSLAQLTFNQ 4453

Query:  396 SL 397
            |.
Sbjct: 4454 SI 4455

>hg18||uc001zyx
        |15|NM_007347|A0AVD6|A0AVD6_HUMAN|AP4E1|NM_007347|NP_031373|adaptor-rel
        ated protein complex 4, epsilon 1

          Length = 1137

 Score =  29 bits (64), Expect = 8.196
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query:   8 HEEQQERRNESDSTEFQRLSALPDASQGFTGRESTLALTIMGDAMG 53
           |. |.|. ..     |.    |  .| |||||.|   ...  |  |
Sbjct: 644 HQRQEEKLSQEKVLNFEPY-GLSFSSSGFTGRQSPAGISLGSDVSG 688

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0