BLASTP 7.6.0


Query=fugu4_745738 |jgi|Takru4|745738|fgh5_pg.C_scaffold_2923000001
        (702 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003lii |5|NM_018899|Q9Y5I4|PCDC2_HUMAN|PCDHAC2|NM_018899...    210   5e-054
hg18||uc003lij |5|NM_031883|Q9Y5I4-2|Q9Y5I4-2|PCDHAC2|NM_031883|...    210   5e-054
hg18||uc003lkg |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|...    208   3e-053
hg18||uc003lkh |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921...    208   3e-053
hg18||uc003lks |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094...    206   1e-052
hg18||uc003lkt |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_00373...    206   1e-052
hg18||uc003lkk |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090...    205   2e-052
hg18||uc003lkl |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_01891...    205   2e-052
hg18||uc003lkc |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736...    203   8e-052
hg18||uc003ljj |5|NM_032009|Q9Y5H1-2|Q9Y5H1-2|PCDHGA2|NM_032009|...    202   2e-051
hg18||uc003ljk |5|NM_018915|Q9Y5H1|PCDG2_HUMAN|PCDHGA2|NM_018915...    202   2e-051
hg18||uc003liv |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957...    201   2e-051
hg18||uc003lki |5|NM_032100|Q9Y5F9-2|Q9Y5F9-2|PCDHGB6|NM_032100|...    201   2e-051
hg18||uc003lkj |5|NM_018926|Q9Y5F9|PCDGI_HUMAN|PCDHGB6|NM_018926...    201   2e-051
hg18||uc003ljl |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|...    201   3e-051
hg18||uc003ljm |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916...    201   3e-051
hg18||uc003ljn |5|NM_032095|Q9Y5G3-2|Q9Y5G3-2|PCDHGB1|NM_032095|...    201   3e-051
hg18||uc003ljo |5|NM_018922|Q9Y5G3|PCDGD_HUMAN|PCDHGB1|NM_018922...    201   3e-051
hg18||uc003lko |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091...    201   4e-051
hg18||uc003lkq |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_01891...    201   4e-051
hg18||uc003liu |5|NM_019120|Q9UN66|PCDB8_HUMAN|PCDHB8|NM_019120|...    200   5e-051
hg18||uc003ljx |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|...    200   7e-051
hg18||uc003ljy |5|NM_018919|Q9Y5G7|PCDG6_HUMAN|PCDHGA6|NM_018919...    200   7e-051
hg18||uc003lkb |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|...    200   7e-051
hg18||uc003lkd |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088...    200   7e-051
hg18||uc003ljc |5|NR_001281|Q96TA0|Q96TA0_HUMAN|PCDHB18|NA|NA|Pr...    199   1e-050
hg18||uc003ljv |5|NM_032097|Q9Y5G1-2|Q9Y5G1-2|PCDHGB3|NM_032097|...    199   1e-050
hg18||uc003ljw |5|NM_018924|Q9Y5G1|PCDGF_HUMAN|PCDHGB3|NM_018924...    199   1e-050
hg18||uc003lir |5|NM_018939|Q9Y5E3|PCDB6_HUMAN|PCDHB6|NM_018939|...    199   2e-050
hg18||uc003lit |5|NM_018940|Q9Y5E2|PCDB7_HUMAN|PCDHB7|NM_018940|...    199   2e-050
hg18||uc003ljt |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|...    198   2e-050
hg18||uc003lju |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918...    198   2e-050
hg18||uc003lkz |5|NM_032407|Q9Y5F6-2|Q9Y5F6-2|PCDHGC5|NM_032407|...    198   3e-050
hg18||uc003lla |5|NM_018929|Q9Y5F6|PCDGM_HUMAN|PCDHGC5|NM_018929...    198   3e-050
hg18||uc003ljp |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|...    198   3e-050
hg18||uc003ljq |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917...    198   3e-050
hg18||uc003ljb |5|NM_018934|Q9Y5E9|PCDBE_HUMAN|PCDHB14|NM_018934...    197   5e-050
hg18||uc003lip |5|NM_018938|Q9Y5E5|PCDB4_HUMAN|PCDHB4|NM_018938|...    197   6e-050
hg18||uc003liq |5|NM_015669|Q9Y5E4|PCDB5_HUMAN|PCDHB5|NM_015669|...    197   6e-050
hg18||uc003liw |5|NM_019119|NA|NA|PCDHB9|NM_019119|NP_061992|pro...    196   1e-049
hg18||uc003lja |5|NM_018933|Q9Y5F0|PCDBD_HUMAN|PCDHB13|NM_018933...    196   1e-049
hg18||uc003lke |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|...    195   2e-049
hg18||uc003lkf |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925...    195   2e-049
hg18||uc003lkx |5|NM_032406|Q9Y5F7-2|Q9Y5F7-2|PCDHGC4|NM_032406|...    195   2e-049
hg18||uc003lky |5|NM_018928|Q9Y5F7|PCDGL_HUMAN|PCDHGC4|NM_018928...    195   2e-049
hg18||uc003ljz |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|...    195   2e-049
hg18||uc003lka |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920...    195   2e-049
hg18||uc003liy |5|NM_018931|Q9Y5F2|PCDBB_HUMAN|PCDHB11|NM_018931...    194   5e-049
hg18||uc003lkm |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|...    194   5e-049
hg18||uc003lkn |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927...    194   5e-049
hg18||uc003lio |5|NM_018937|Q9Y5E6|PCDB3_HUMAN|PCDHB3|NM_018937|...    193   7e-049
hg18||uc003lix |5|NM_018930|Q9UN67|PCDBA_HUMAN|PCDHB10|NM_018930...    193   7e-049
hg18||uc003ljh |5|NM_031993|Q9Y5H4-2|Q9Y5H4-2|PCDHGA1|NM_031993|...    193   7e-049
hg18||uc003lji |5|NM_018912|Q9Y5H4|PCDG1_HUMAN|PCDHGA1|NM_018912...    193   7e-049
hg18||uc003lil |5|NM_018936|Q9Y5E7|PCDB2_HUMAN|PCDHB2|NM_018936|...    192   2e-048
hg18||uc003lim |5|BC103505|Q59ER6|Q59ER6_HUMAN|BC103505|NA|NA|Pr...    192   2e-048
hg18||uc003lje |5|NM_018935|Q9Y5E8|PCDBF_HUMAN|PCDHB15|NM_018935...    192   2e-048
hg18||uc003liz |5|NM_018932|Q9Y5F1|PCDBC_HUMAN|PCDHB12|NM_018932...    190   6e-048
hg18||uc003ljr |5|NM_032096|Q9Y5G2-2|Q9Y5G2-2|PCDHGB2|NM_032096|...    190   7e-048
hg18||uc003ljs |5|NM_018923|Q9Y5G2|PCDGE_HUMAN|PCDHGB2|NM_018923...    190   7e-048
hg18||uc003lid |5|NM_031865|Q9Y5I0-2|Q9Y5I0-2|PCDHA13|NM_031865|...    189   2e-047
hg18||uc003lie |5|AB208924|Q59H35|Q59H35_HUMAN|PCDHA13|NM_018904...    189   2e-047
hg18||uc003lif |5|NM_018904|Q9Y5I0|PCDAD_HUMAN|PCDHA13|NM_018904...    189   2e-047
hg18||uc003lhv |5|NM_031859|Q9Y5I2-3|Q9Y5I2-3|PCDHA10|NM_031859|...    186   1e-046
hg18||uc003lhx |5|NM_018901|Q9Y5I2|PCDAA_HUMAN|PCDHA10|NM_018901...    186   1e-046
hg18||uc003lig |5|NM_031882|Q9H158-2|Q9H158-2|PCDHAC1|NM_031882|...    186   1e-046
hg18||uc003lih |5|NM_018898|Q9H158|PCDC1_HUMAN|PCDHAC1|NM_018898...    186   1e-046
hg18||uc003lhm |5|NM_031848|Q9UN73-3|Q9UN73-3|PCDHA6|NM_031848|N...    186   1e-046
hg18||uc003lho |5|NM_018909|Q9UN73|PCDA6_HUMAN|PCDHA6|NM_018909|...    186   1e-046
hg18||uc003lib |5|NM_031864|Q9UN75-2|Q9UN75-2|PCDHA12|NM_031864|...    184   4e-046
hg18||uc003lic |5|NM_018903|Q9UN75|PCDAC_HUMAN|PCDHA12|NM_018903...    184   4e-046
hg18||uc003lhe |5|NM_031497|Q9Y5H8-2|Q9Y5H8-2|PCDHA3|NM_031497|N...    184   5e-046
hg18||uc003lhf |5|NM_018906|Q9Y5H8|PCDA3_HUMAN|PCDHA3|NM_018906|...    184   5e-046
hg18||uc003lhc |5|NM_031495|Q9Y5H9-2|Q9Y5H9-2|PCDHA2|NM_031495|N...    183   7e-046
hg18||uc003lhd |5|NM_018905|Q9Y5H9|PCDA2_HUMAN|PCDHA2|NM_018905|...    183   7e-046
hg18||uc003lht |5|NM_014005|Q9Y5H5-2|Q9Y5H5-2|PCDHA9|NM_014005|N...    183   7e-046
hg18||uc003lhu |5|NM_031857|Q9Y5H5|PCDA9_HUMAN|PCDHA9|NM_031857|...    183   7e-046
hg18||uc003lgz |5|NM_031410|Q9Y5I3-3|Q9Y5I3-3|PCDHA1|NM_031410|N...    183   9e-046
hg18||uc003lhb |5|NM_018900|Q9Y5I3|PCDA1_HUMAN|PCDHA1|NM_018900|...    183   9e-046
hg18||uc003lhg |5|NM_031500|Q9UN74-2|Q9UN74-2|PCDHA4|NM_031500|N...    183   9e-046
hg18||uc003lhh |5|AB208925|Q59H34|Q59H34_HUMAN|PCDHA4|NM_018907|...    183   9e-046
hg18||uc003lhi |5|NM_018907|Q9UN74|PCDA4_HUMAN|PCDHA4|NM_018907|...    183   9e-046
hg18||uc003lhp |5|NM_031852|Q9UN72-2|Q9UN72-2|PCDHA7|NM_031852|N...    182   2e-045
hg18||uc003lhq |5|NM_018910|Q9UN72|PCDA7_HUMAN|PCDHA7|NM_018910|...    182   2e-045
hg18||uc003lhr |5|NM_031856|Q9Y5H6-2|Q9Y5H6-2|PCDHA8|NM_031856|N...    182   2e-045
hg18||uc003lhs |5|NM_018911|Q9Y5H6|PCDA8_HUMAN|PCDHA8|NM_018911|...    182   2e-045
hg18||uc003lhz |5|NM_031861|Q9Y5I1-2|Q9Y5I1-2|PCDHA11|NM_031861|...    180   8e-045
hg18||uc003lia |5|NM_018902|Q9Y5I1|PCDAB_HUMAN|PCDHA11|NM_018902...    180   8e-045
hg18||uc003lhj |5|NM_031501|Q9Y5H7-2|Q9Y5H7-2|PCDHA5|NM_031501|N...    176   1e-043
hg18||uc003lhk |5|BC033735|Q9Y5H7-3|Q9Y5H7-3|PCDHA5|NM_018908|NP...    176   1e-043
hg18||uc003lhl |5|NM_018908|Q9Y5H7|PCDA5_HUMAN|PCDHA5|NM_018908|...    176   1e-043
hg18||uc003lkp |5|NM_032092|Q9Y5H2-3|Q9Y5H2-3|PCDHGA11|NM_032092...    153   8e-037
hg18||uc003lku |5|NM_032402|Q9UN70-2|Q9UN70-2|PCDHGC3|NM_032402|...    134   6e-031
hg18||uc003lkv |5|NM_002588|Q9UN70|PCDGK_HUMAN|PCDHGC3|NM_002588...    134   6e-031
hg18||uc003igz |4|NM_020815|Q96SF0|Q96SF0_HUMAN|PCDH10|NM_020815...    126   1e-028
hg18||uc003iha |4|NM_032961|Q9P2E7|PCD10_HUMAN|PCDH10|NM_032961|...    126   1e-028
hg18||uc003lko |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091...    119   1e-026
hg18||uc003lkp |5|NM_032092|Q9Y5H2-3|Q9Y5H2-3|PCDHGA11|NM_032092...    119   1e-026
hg18||uc003lkq |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_01891...    119   1e-026
hg18||uc003lkx |5|NM_032406|Q9Y5F7-2|Q9Y5F7-2|PCDHGC4|NM_032406|...    119   2e-026

>hg18||uc003lii
        |5|NM_018899|Q9Y5I4|PCDC2_HUMAN|PCDHAC2|NM_018899|NP_061722|protocadher
        in alpha subfamily C, 2 isoform 1

          Length = 1007

 Score =  210 bits (534), Expect = 5e-054
 Identities = 112/279 (40%), Positives = 158/279 (56%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           . .|. ||||| | | .  |.| . ||| || || .. | |||  ||  . | .||.|| 
Sbjct: 455 LKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQ 514

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              ..   |||   |.|| . .||||  .||   .||.| ||||||| |. .. .|| ||
Sbjct: 515 GLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMND 574

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           .|| |. |     |   | .||.   | || ||||.| ||  |. . | | | .|  || 
Sbjct: 575 HAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFK 634

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .. . ||||| |           | || .||| |.|||.| | .. |.   |   |    
Sbjct: 635 VELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVDRVSKILPDTQRH 694

Query: 241 PLEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQK 279
                 .|.. |||.| | .|||            || .
Sbjct: 695 VKSPRTYSEITLYLIIALSTVSFIFLLTIIILSIIKCYR 733

>hg18||uc003lij
        |5|NM_031883|Q9Y5I4-2|Q9Y5I4-2|PCDHAC2|NM_031883|NP_114089|protocadheri
        n alpha subfamily C, 2 isoform 2

          Length = 884

 Score =  210 bits (534), Expect = 5e-054
 Identities = 112/279 (40%), Positives = 158/279 (56%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           . .|. ||||| | | .  |.| . ||| || || .. | |||  ||  . | .||.|| 
Sbjct: 455 LKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQ 514

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              ..   |||   |.|| . .||||  .||   .||.| ||||||| |. .. .|| ||
Sbjct: 515 GLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMND 574

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           .|| |. |     |   | .||.   | || ||||.| ||  |. . | | | .|  || 
Sbjct: 575 HAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFK 634

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .. . ||||| |           | || .||| |.|||.| | .. |.   |   |    
Sbjct: 635 VELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVDRVSKILPDTQRH 694

Query: 241 PLEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQK 279
                 .|.. |||.| | .|||            || .
Sbjct: 695 VKSPRTYSEITLYLIIALSTVSFIFLLTIIILSIIKCYR 733

>hg18||uc003lkg
        |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|NP_114478|protocadheri
        n gamma subfamily A, 9 isoform 2

          Length = 828

 Score =  208 bits (527), Expect = 3e-053
 Identities = 113/264 (42%), Positives = 165/264 (62%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .||.. ||||| | | |. |.. . |||| |  . |. |.||| .||  ..| . |  | 
Sbjct: 438 ITLQVTDINDNPPAFSQASYSVYLPENNARGTSIFSVIAYDPDSNENSRVIYSLAEDTIQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
            . .|   ||| . | || | .||||  ..    . | ||||||||||||. . ..||||
Sbjct: 498 GSPLSTYVSINSDTGVLYALCSFDYEQFRDLQMQVTASDSGSPPLSSNVSLRLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.| . ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLFKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..     .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAIADSIPDILADLGS 677

Query: 240 VPLEYDI-FSDLNLYLVIGLGSVS 262
           . .  |.  ||| ||||. .  ||
Sbjct: 678 LQIPADLEASDLTLYLVVAVAVVS 701

>hg18||uc003lkh
        |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921|NP_061744|protocadher
        in gamma subfamily A, 9 isoform 1

          Length = 932

 Score =  208 bits (527), Expect = 3e-053
 Identities = 113/264 (42%), Positives = 165/264 (62%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .||.. ||||| | | |. |.. . |||| |  . |. |.||| .||  ..| . |  | 
Sbjct: 438 ITLQVTDINDNPPAFSQASYSVYLPENNARGTSIFSVIAYDPDSNENSRVIYSLAEDTIQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
            . .|   ||| . | || | .||||  ..    . | ||||||||||||. . ..||||
Sbjct: 498 GSPLSTYVSINSDTGVLYALCSFDYEQFRDLQMQVTASDSGSPPLSSNVSLRLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.| . ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLFKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..     .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAIADSIPDILADLGS 677

Query: 240 VPLEYDI-FSDLNLYLVIGLGSVS 262
           . .  |.  ||| ||||. .  ||
Sbjct: 678 LQIPADLEASDLTLYLVVAVAVVS 701

>hg18||uc003lks
        |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094|NP_115265|protocadher
        in gamma subfamily A, 12 isoform 2

          Length = 820

 Score =  206 bits (522), Expect = 1e-052
 Identities = 115/265 (43%), Positives = 162/265 (61%), Gaps = 4/265 (1%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..| . | ||| | |||. |.  . |||  |  | |.|| |||  ||  . | . |  | 
Sbjct: 438 ISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
             |.|   ||| . | || | .||||  ..    . |||.| ||||||||. . ..||||
Sbjct: 498 GASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDL-- 237
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPQVLADLGS 677

Query: 238 TEVPLEYDIFSDLNLYLVIGLGSVS 262
            | |   .  ||| ||||. . .||
Sbjct: 678 LESPANSET-SDLTLYLVVAVAAVS 701

>hg18||uc003lkt
        |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_003735|NP_003726|protocadhe
        rin gamma subfamily A, 12 isoform 1

          Length = 932

 Score =  206 bits (522), Expect = 1e-052
 Identities = 115/265 (43%), Positives = 162/265 (61%), Gaps = 4/265 (1%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..| . | ||| | |||. |.  . |||  |  | |.|| |||  ||  . | . |  | 
Sbjct: 438 ISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
             |.|   ||| . | || | .||||  ..    . |||.| ||||||||. . ..||||
Sbjct: 498 GASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDL-- 237
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPQVLADLGS 677

Query: 238 TEVPLEYDIFSDLNLYLVIGLGSVS 262
            | |   .  ||| ||||. . .||
Sbjct: 678 LESPANSET-SDLTLYLVVAVAAVS 701

>hg18||uc003lkk
        |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090|NP_114479|protocadher
        in gamma subfamily A, 10 isoform 2

          Length = 850

 Score =  205 bits (521), Expect = 2e-052
 Identities = 115/263 (43%), Positives = 161/263 (61%), Gaps = 4/263 (1%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. ||||| | | |  |   . |||| || . |.|| |||  ||  ..| . |  |   
Sbjct: 444 LQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDSKENAQIIYSLAEDTIQGV 503

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||   |    . | ||| ||||||||. . ..||||||
Sbjct: 504 PLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASDSGDPPLSSNVSLSLFVLDQNDNA 563

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 564 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAV 623

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDL--TE 239
            .. ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||   |
Sbjct: 624 GEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPQVLADLGSFE 683

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   .  ||| ||||. . .||
Sbjct: 684 SPANSET-SDLTLYLVVAVAAVS 705

>hg18||uc003lkl
        |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_018913|NP_061736|protocadhe
        rin gamma subfamily A, 10 isoform 1

          Length = 936

 Score =  205 bits (521), Expect = 2e-052
 Identities = 115/263 (43%), Positives = 161/263 (61%), Gaps = 4/263 (1%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. ||||| | | |  |   . |||| || . |.|| |||  ||  ..| . |  |   
Sbjct: 444 LQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDSKENAQIIYSLAEDTIQGV 503

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||   |    . | ||| ||||||||. . ..||||||
Sbjct: 504 PLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASDSGDPPLSSNVSLSLFVLDQNDNA 563

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 564 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAV 623

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDL--TE 239
            .. ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||   |
Sbjct: 624 GEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPQVLADLGSFE 683

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   .  ||| ||||. . .||
Sbjct: 684 SPANSET-SDLTLYLVVAVAAVS 705

>hg18||uc003lkc
        |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736|NP_003727|protocadher
        in gamma subfamily B, 4 isoform 1

          Length = 923

 Score =  203 bits (515), Expect = 8e-052
 Identities = 105/263 (39%), Positives = 159/263 (60%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . |.||| | | || | . | ||| ||| .| . | ||||  |  . | |.  .. 
Sbjct: 436 ITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLE 495

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   ||. | | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 496 QRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRND 555

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     || . . .| . . | || ||.|.| || ||. ..| .|| ..  ||
Sbjct: 556 NAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLF 615

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    ||   |||.|  .| | | |||| |. |   ..  .   |.|.
Sbjct: 616 SLGLRTGEVRTARALGDRDAVRQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITD 675

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   |. ..|  |||. |  .|
Sbjct: 676 RPDPSDLQAELQFYLVVALALIS 698

>hg18||uc003ljj
        |5|NM_032009|Q9Y5H1-2|Q9Y5H1-2|PCDHGA2|NM_032009|NP_114398|protocadheri
        n gamma subfamily A, 2 isoform 2

          Length = 823

 Score =  202 bits (512), Expect = 2e-051
 Identities = 111/262 (42%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. ||||| | | .. |.  . |||  || . |.|| ||| ..| .. |   |  .   
Sbjct: 440 LQVADINDNAPAFSRTSYSTYIPENNPRGASVFSVTAHDPDSNDNAHVTYSFAEDTVQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  ..    . |||||.||||||||. . ..||||||
Sbjct: 500 PLSSYISINSDTGVLYALRSFDYEQLRDLQVWVIARDSGNPPLSSNVSLSLFVLDQNDNA 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. | .   ||   |  ||| . | || ||.|.| ||  |. ..| ||. ..  |||.
Sbjct: 560 PEILYPAFPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFSV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
             . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  . 
Sbjct: 620 GLHTGEVRTARALLDRDALKQSLVVAIQDHGQPPLSATVTLTVAVADRIPDILADLGSLE 679

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
           |      ||| ||||. . .||
Sbjct: 680 PSAIPNDSDLTLYLVVAVAAVS 701

>hg18||uc003ljk
        |5|NM_018915|Q9Y5H1|PCDG2_HUMAN|PCDHGA2|NM_018915|NP_061738|protocadher
        in gamma subfamily A, 2 isoform 1

          Length = 932

 Score =  202 bits (512), Expect = 2e-051
 Identities = 111/262 (42%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. ||||| | | .. |.  . |||  || . |.|| ||| ..| .. |   |  .   
Sbjct: 440 LQVADINDNAPAFSRTSYSTYIPENNPRGASVFSVTAHDPDSNDNAHVTYSFAEDTVQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  ..    . |||||.||||||||. . ..||||||
Sbjct: 500 PLSSYISINSDTGVLYALRSFDYEQLRDLQVWVIARDSGNPPLSSNVSLSLFVLDQNDNA 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. | .   ||   |  ||| . | || ||.|.| ||  |. ..| ||. ..  |||.
Sbjct: 560 PEILYPAFPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFSV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
             . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  . 
Sbjct: 620 GLHTGEVRTARALLDRDALKQSLVVAIQDHGQPPLSATVTLTVAVADRIPDILADLGSLE 679

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
           |      ||| ||||. . .||
Sbjct: 680 PSAIPNDSDLTLYLVVAVAAVS 701

>hg18||uc003liv
        |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957|NP_066008|protocadher
        in beta 16 precursor

          Length = 776

 Score =  201 bits (511), Expect = 2e-051
 Identities = 104/262 (39%), Positives = 161/262 (61%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|... |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 437 ITVQISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP 496

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  .|| | . | | ||| |||   | ....| ||
Sbjct: 497 HLPLASLVSINADNGHLFALRSLDYEALREFEFRVSATDRGSPALSSEALVRVLVLDAND 556

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 557 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 616

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||   |||||. |||| |  ||| |. .  |.   . .  | | 
Sbjct: 617 VWAHNGEVRTARLLSERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPFLPLPEA 676

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                  . | .|||. | |||
Sbjct: 677 APGQTQANSLTVYLVVALASVS 698

>hg18||uc003lki
        |5|NM_032100|Q9Y5F9-2|Q9Y5F9-2|PCDHGB6|NM_032100|NP_115271|protocadheri
        n gamma subfamily B, 6 isoform 2

          Length = 820

 Score =  201 bits (511), Expect = 2e-051
 Identities = 104/263 (39%), Positives = 161/263 (61%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . ||||| | | |. | . | ||| ||| .. ..| ||||  | .. | |.  .. 
Sbjct: 438 ITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
             ..|   |.. . | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 PLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     ||   . .||| . | || ||.|.| || ||. ..| .|| ..  ||
Sbjct: 558 NAPRVLYPALGPDGSAFFDMVPRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    ||   |||.|  .| | | |||| |. |   .   .   ||..
Sbjct: 618 SLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |.  |  ..|  |||. |  .|
Sbjct: 678 RPVLSDPQAELQFYLVVALALIS 700

>hg18||uc003lkj
        |5|NM_018926|Q9Y5F9|PCDGI_HUMAN|PCDHGB6|NM_018926|NP_061749|protocadher
        in gamma subfamily B, 6 isoform 1

          Length = 930

 Score =  201 bits (511), Expect = 2e-051
 Identities = 104/263 (39%), Positives = 161/263 (61%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . ||||| | | |. | . | ||| ||| .. ..| ||||  | .. | |.  .. 
Sbjct: 438 ITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPDLGLNGHISYSIVASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
             ..|   |.. . | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 PLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSPTLSANVSLRVLVGDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     ||   . .||| . | || ||.|.| || ||. ..| .|| ..  ||
Sbjct: 558 NAPRVLYPALGPDGSAFFDMVPRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    ||   |||.|  .| | | |||| |. |   .   .   ||..
Sbjct: 618 SLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADNLQEILPDLSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |.  |  ..|  |||. |  .|
Sbjct: 678 RPVLSDPQAELQFYLVVALALIS 700

>hg18||uc003ljl
        |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|NP_114400|protocadheri
        n gamma subfamily A, 3 isoform 2

          Length = 829

 Score =  201 bits (510), Expect = 3e-051
 Identities = 112/264 (42%), Positives = 160/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| ..||||| | ||   |.  . |||  || . |.|| ||| . |  . | . |  . 
Sbjct: 438 ITLHVIDINDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPDSNNNARITYALTEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |||   | || |..||||  ..    . | |||.||||||||... ..||||
Sbjct: 498 GAPLSSFVSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNPPLSSNVSLNLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADRIPDILADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      ||| ||||. . .||
Sbjct: 678 LEPSAKPNDSDLTLYLVVAVAAVS 701

>hg18||uc003ljm
        |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916|NP_061739|protocadher
        in gamma subfamily A, 3 isoform 1

          Length = 932

 Score =  201 bits (510), Expect = 3e-051
 Identities = 112/264 (42%), Positives = 160/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| ..||||| | ||   |.  . |||  || . |.|| ||| . |  . | . |  . 
Sbjct: 438 ITLHVIDINDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPDSNNNARITYALTEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |||   | || |..||||  ..    . | |||.||||||||... ..||||
Sbjct: 498 GAPLSSFVSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNPPLSSNVSLNLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADRIPDILADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      ||| ||||. . .||
Sbjct: 678 LEPSAKPNDSDLTLYLVVAVAAVS 701

>hg18||uc003ljn
        |5|NM_032095|Q9Y5G3-2|Q9Y5G3-2|PCDHGB1|NM_032095|NP_115266|protocadheri
        n gamma subfamily B, 1 isoform 2

          Length = 810

 Score =  201 bits (510), Expect = 3e-051
 Identities = 104/263 (39%), Positives = 160/263 (60%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . ||||| | | |. | . |.||| ||| .. ..| ||||  |  . | ||  .. 
Sbjct: 434 ITLHISDINDNAPVFHQASYVVHVSENNPPGASIAQVSASDPDLGPNGRVSYSILASDLE 493

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .    |..|. | ..  . ||.|  . |   ..||| ||| ||.|||. ... | ||
Sbjct: 494 PRELLSYVSVSPQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDLND 553

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     || . . .||. . | || ||.|.| || ||. ..| .|| ..  ||
Sbjct: 554 NAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLF 613

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    ||   |||.|  .| | | |||| |. |   ..  .   ||..
Sbjct: 614 SLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSD 673

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   |  ..|  |||. |  .|
Sbjct: 674 RPEPSDPQTELQFYLVVALALIS 696

>hg18||uc003ljo
        |5|NM_018922|Q9Y5G3|PCDGD_HUMAN|PCDHGB1|NM_018922|NP_061745|protocadher
        in gamma subfamily B, 1 isoform 1

          Length = 927

 Score =  201 bits (510), Expect = 3e-051
 Identities = 104/263 (39%), Positives = 160/263 (60%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . ||||| | | |. | . |.||| ||| .. ..| ||||  |  . | ||  .. 
Sbjct: 434 ITLHISDINDNAPVFHQASYVVHVSENNPPGASIAQVSASDPDLGPNGRVSYSILASDLE 493

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .    |..|. | ..  . ||.|  . |   ..||| ||| ||.|||. ... | ||
Sbjct: 494 PRELLSYVSVSPQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDLND 553

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     || . . .||. . | || ||.|.| || ||. ..| .|| ..  ||
Sbjct: 554 NAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLF 613

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    ||   |||.|  .| | | |||| |. |   ..  .   ||..
Sbjct: 614 SLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSD 673

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   |  ..|  |||. |  .|
Sbjct: 674 RPEPSDPQTELQFYLVVALALIS 696

>hg18||uc003lko
        |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091|NP_114480|protocadher
        in gamma subfamily A, 11 isoform 2

          Length = 837

 Score =  201 bits (509), Expect = 4e-051
 Identities = 110/262 (41%), Positives = 160/262 (61%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . | ||| | || | |.  . |||  || . |.|| |||  .|  . | . .  .   
Sbjct: 441 LNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGV 500

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   |||   | || |..||||  ..    . ||||| ||||||||. . ..||||||
Sbjct: 501 PLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNA 560

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 561 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFAV 620

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
            .. ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  . 
Sbjct: 621 GEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLE 680

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
            |     |||.||||. . .||
Sbjct: 681 SLANSETSDLSLYLVVAVAAVS 702

>hg18||uc003lkq
        |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_018914|NP_061737|protocadhe
        rin gamma subfamily A, 11 isoform 1

          Length = 935

 Score =  201 bits (509), Expect = 4e-051
 Identities = 110/262 (41%), Positives = 160/262 (61%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . | ||| | || | |.  . |||  || . |.|| |||  .|  . | . .  .   
Sbjct: 441 LNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGV 500

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   |||   | || |..||||  ..    . ||||| ||||||||. . ..||||||
Sbjct: 501 PLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNA 560

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 561 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFAV 620

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
            .. ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  . 
Sbjct: 621 GEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLE 680

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
            |     |||.||||. . .||
Sbjct: 681 SLANSETSDLSLYLVVAVAAVS 702

>hg18||uc003liu
        |5|NM_019120|Q9UN66|PCDB8_HUMAN|PCDHB8|NM_019120|NP_061993|protocadheri
        n beta 8 precursor

          Length = 801

 Score =  200 bits (508), Expect = 5e-051
 Identities = 106/262 (40%), Positives = 158/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ||. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 438 MTVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 498 HLPLASLVSINTDNGHLFALRSLDYEALQAFEFRVGASDRGSPALSSEALVRVLVLDAND 557

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 558 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 617

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||   |||||. |||| |  ||| |. |  |.   . |  | | 
Sbjct: 618 VWAHNGEVRTARLLSERDAAKQRLVVLVKDNGEPPCSATATLHLLLVDGFSQPYLPLPEA 677

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 678 APAQGQADSLTVYLVVALASVS 699

>hg18||uc003ljx
        |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|NP_114475|protocadheri
        n gamma subfamily A, 6 isoform 2

          Length = 818

 Score =  200 bits (507), Expect = 7e-051
 Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..| . | ||| | || | |.. | |||  || . |. | |||. .|  . | . |  . 
Sbjct: 438 ISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPDVDQNAQVSYSLAEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   ||| . | || |..||||  ..    . | ||| ||||||||. . ..||||
Sbjct: 498 GAPLSSYVSINSDTGILYALRSFDYEQLRDLQLWVTASDSGDPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADRIPDILADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      ||| ||||. . .||
Sbjct: 678 LEPSAKPNDSDLTLYLVVAVAAVS 701

>hg18||uc003ljy
        |5|NM_018919|Q9Y5G7|PCDG6_HUMAN|PCDHGA6|NM_018919|NP_061742|protocadher
        in gamma subfamily A, 6 isoform 1

          Length = 932

 Score =  200 bits (507), Expect = 7e-051
 Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..| . | ||| | || | |.. | |||  || . |. | |||. .|  . | . |  . 
Sbjct: 438 ISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPDVDQNAQVSYSLAEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   ||| . | || |..||||  ..    . | ||| ||||||||. . ..||||
Sbjct: 498 GAPLSSYVSINSDTGILYALRSFDYEQLRDLQLWVTASDSGDPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  .      .||  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADRIPDILADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      ||| ||||. . .||
Sbjct: 678 LEPSAKPNDSDLTLYLVVAVAAVS 701

>hg18||uc003lkb
        |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|NP_054723|protocadheri
        n gamma subfamily A, 8 isoform 2

          Length = 820

 Score =  200 bits (507), Expect = 7e-051
 Identities = 109/264 (41%), Positives = 160/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           . | . ||||| | || . |.  . |||  || . |||| |||  ||  . | . |  . 
Sbjct: 438 IALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   ||| . | || |..||||  ..    . | ||| ||||||.|. . ..||||
Sbjct: 498 GAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNMSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| ..| || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  ..|  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLTELGS 677

Query: 240 VPLEYD-IFSDLNLYLVIGLGSVS 262
           .    |   | | ||||. . ..|
Sbjct: 678 LKPSVDPNDSSLTLYLVVAVAAIS 701

>hg18||uc003lkd
        |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088|NP_114477|protocadher
        in gamma subfamily A, 8 isoform 1

          Length = 932

 Score =  200 bits (507), Expect = 7e-051
 Identities = 109/264 (41%), Positives = 160/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           . | . ||||| | || . |.  . |||  || . |||| |||  ||  . | . |  . 
Sbjct: 438 IALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   ||| . | || |..||||  ..    . | ||| ||||||.|. . ..||||
Sbjct: 498 GAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNMSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| |. |     ||   |  ||| ..| || ||.|.| ||  |. ..|.||. ..  ||
Sbjct: 558 NAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           |.  . ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  ..|  
Sbjct: 618 SVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLTELGS 677

Query: 240 VPLEYD-IFSDLNLYLVIGLGSVS 262
           .    |   | | ||||. . ..|
Sbjct: 678 LKPSVDPNDSSLTLYLVVAVAAIS 701

>hg18||uc003ljc
        |5|NR_001281|Q96TA0|Q96TA0_HUMAN|PCDHB18|NA|NA|Protocadherin-psi2

          Length = 734

 Score =  199 bits (505), Expect = 1e-050
 Identities = 107/262 (40%), Positives = 159/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 384 ITVLVSDVNDNAPIFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP 443

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  .|| | . | | ||| ||| | | ....| ||
Sbjct: 444 HLPLTSLVSINADNGHLFALRSLDYEALQEFGFRVGAADHGSPALSSEVLVRVLVLDAND 503

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 504 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 563

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .||| || |. | ||    ||||. |||| |  ||| |. .  ||   . |  ||| 
Sbjct: 564 VWAHNGEGRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVEGFSQPYLPLTEA 623

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 624 APSQAQADSLTVYLVVALASVS 645

>hg18||uc003ljv
        |5|NM_032097|Q9Y5G1-2|Q9Y5G1-2|PCDHGB3|NM_032097|NP_115268|protocadheri
        n gamma subfamily B, 3 isoform 2

          Length = 814

 Score =  199 bits (505), Expect = 1e-050
 Identities = 101/263 (38%), Positives = 163/263 (61%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| .||.||||| | |. ||. | ||| ||| .. . | ||||  |  . |.|.  .. 
Sbjct: 438 ITLHILDVNDNVPVFHQASYTVHVAENNPPGASIAHVRASDPDLGPNGLVSYYIVASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |..   | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 PRELSSYVSVSARSGVVFAQRAFDHEQLRAFELTLQARDQGSPTLSANVSLRVLVDDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           |||... |    .|| . . .||| . | || ||.|.| || .|. ..| ..| ..  ||
Sbjct: 558 NAPLVLYPALGPEGSALFDMVPRSAEPGYLVTKVVAVDADSGYNAWLSYHIVQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    |.   |||.|  .| |   ||||| . |   ..  .   ||..
Sbjct: 618 SLGLRTGEVRTARTLGDREAARQRLLVTVRDGGQQPLSATVMLHLIFADSLQEIQPDLSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   |  ..|  .||. |  .|
Sbjct: 678 RPTPSDPQAELQFHLVVALALIS 700

>hg18||uc003ljw
        |5|NM_018924|Q9Y5G1|PCDGF_HUMAN|PCDHGB3|NM_018924|NP_061747|protocadher
        in gamma subfamily B, 3 isoform 1

          Length = 929

 Score =  199 bits (505), Expect = 1e-050
 Identities = 101/263 (38%), Positives = 163/263 (61%), Gaps = 1/263 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| .||.||||| | |. ||. | ||| ||| .. . | ||||  |  . |.|.  .. 
Sbjct: 438 ITLHILDVNDNVPVFHQASYTVHVAENNPPGASIAHVRASDPDLGPNGLVSYYIVASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |..   | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 PRELSSYVSVSARSGVVFAQRAFDHEQLRAFELTLQARDQGSPTLSANVSLRVLVDDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           |||... |    .|| . . .||| . | || ||.|.| || .|. ..| ..| ..  ||
Sbjct: 558 NAPLVLYPALGPEGSALFDMVPRSAEPGYLVTKVVAVDADSGYNAWLSYHIVQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.|| |    |.   |||.|  .| |   ||||| . |   ..  .   ||..
Sbjct: 618 SLGLRTGEVRTARTLGDREAARQRLLVTVRDGGQQPLSATVMLHLIFADSLQEIQPDLSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVS 262
            |   |  ..|  .||. |  .|
Sbjct: 678 RPTPSDPQAELQFHLVVALALIS 700

>hg18||uc003lir
        |5|NM_018939|Q9Y5E3|PCDB6_HUMAN|PCDHB6|NM_018939|NP_061762|protocadheri
        n beta 6 precursor

          Length = 794

 Score =  199 bits (504), Expect = 2e-050
 Identities = 105/262 (40%), Positives = 159/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|... |.||||| | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 435 ITVQVSDVNDNVPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGINAQVTYSLLPPQDP 494

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .| | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 495 HLPLSSLVSINADNGHLFALRSLDYEALQSFEFRVGATDRGSPALSSEALVRLLVLDAND 554

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 555 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATELGLFG 614

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 615 VWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 674

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 675 APAQAQADSLTVYLVVALASVS 696

>hg18||uc003lit
        |5|NM_018940|Q9Y5E2|PCDB7_HUMAN|PCDHB7|NM_018940|NP_061763|protocadheri
        n beta 7 precursor

          Length = 793

 Score =  199 bits (504), Expect = 2e-050
 Identities = 113/294 (38%), Positives = 173/294 (58%), Gaps = 6/294 (2%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|. . |.||| | | |. ||. | |||.|   . |..| | |   |  ..| .|  .  
Sbjct: 437 ITVLVSDVNDNAPAFTQTSYTLFVRENNSPALPIGSVSATDRDSGTNAQVIYSLLPSQDP 496

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 497 HLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRVLVLDAND 556

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 557 NSPFVLYPLQNSSAPCTEPLPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 616

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||   |||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 617 VWAHNGEVRTARLLSERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLRLPEA 676

Query: 241 PLEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXK-CQKPKASKAAPPCRNSV 293
               |  . | .|||. | |||             . |..   |.|||  | ||
Sbjct: 677 --APDQANSLTVYLVVALASVSSLFLLSVLLFVAVRLCRR---SRAAPVGRCSV 725

>hg18||uc003ljt
        |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|NP_114443|protocadheri
        n gamma subfamily A, 5 isoform 2

          Length = 813

 Score =  198 bits (503), Expect = 2e-050
 Identities = 108/262 (41%), Positives = 157/262 (59%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. |.||| |.|||. |.  |||||  |  . |.|| |||  .|  . | . |      
Sbjct: 440 LKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDSGDNARVTYSLAEDTFQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  ..    . | |||.||||||||. . ..||||| 
Sbjct: 500 PLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPPLSSNVSLSLFVLDQNDNT 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 560 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFAV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
             . ||.|| |    ||   | |||  .|.| | |||| |. ..  .      .||  . 
Sbjct: 620 GLHTGEVRTARALLDRDALKQSLVVAVEDHGQPPLSATFTVTVAVADRIPDILADLGSIK 679

Query: 242 LEYDIFS-DLNLYLVIGLGSVS 262
              |    || ||||. . .||
Sbjct: 680 TPIDPEDLDLTLYLVVAVAAVS 701

>hg18||uc003lju
        |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918|NP_061741|protocadher
        in gamma subfamily A, 5 isoform 1

          Length = 931

 Score =  198 bits (503), Expect = 2e-050
 Identities = 108/262 (41%), Positives = 157/262 (59%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           |.. |.||| |.|||. |.  |||||  |  . |.|| |||  .|  . | . |      
Sbjct: 440 LKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDSGDNARVTYSLAEDTFQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  ..    . | |||.||||||||. . ..||||| 
Sbjct: 500 PLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPPLSSNVSLSLFVLDQNDNT 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..|.||. ..  ||..
Sbjct: 560 PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFAV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
             . ||.|| |    ||   | |||  .|.| | |||| |. ..  .      .||  . 
Sbjct: 620 GLHTGEVRTARALLDRDALKQSLVVAVEDHGQPPLSATFTVTVAVADRIPDILADLGSIK 679

Query: 242 LEYDIFS-DLNLYLVIGLGSVS 262
              |    || ||||. . .||
Sbjct: 680 TPIDPEDLDLTLYLVVAVAAVS 701

>hg18||uc003lkz
        |5|NM_032407|Q9Y5F6-2|Q9Y5F6-2|PCDHGC5|NM_032407|NP_115783|protocadheri
        n gamma subfamily C, 5 isoform 2

          Length = 878

 Score =  198 bits (502), Expect = 3e-050
 Identities = 106/267 (39%), Positives = 154/267 (57%), Gaps = 13/267 (4%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |  ||  . ||  ||.|| .. | |||  .|  | | |.  ..   
Sbjct: 442 LNISDVNDNAPRFNQQLYTAYILENRPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGA 501

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
             |    .||||| ..  .|||||. .     .  |||||||| .| |.|. ..|.||||
Sbjct: 502 PASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNA 561

Query: 123 PVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLL-QVTDATLFSL 181
           | .. |         ...|||   |||| || |.| |. ||. ..| || | |   || .
Sbjct: 562 PAVLHPRPDWEHSAPQRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLV 621

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
             . ||.|| |     |   |..||. .|||.|.||.| |. |      |    |  |.|
Sbjct: 622 STHTGEVRTARALLEDDSDTQQVVVLVRDNGDPSLSSTATVLL------VLEDEDPEEMP 675

Query: 242 LEYDIF------SDLNLYLVIGLGSVS 262
              |        ||| |||.. | .||
Sbjct: 676 KSSDFLIHPPERSDLTLYLIVALATVS 702

>hg18||uc003lla
        |5|NM_018929|Q9Y5F6|PCDGM_HUMAN|PCDHGC5|NM_018929|NP_061752|protocadher
        in gamma subfamily C, 5 isoform 1

          Length = 944

 Score =  198 bits (502), Expect = 3e-050
 Identities = 106/267 (39%), Positives = 154/267 (57%), Gaps = 13/267 (4%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |  ||  . ||  ||.|| .. | |||  .|  | | |.  ..   
Sbjct: 442 LNISDVNDNAPRFNQQLYTAYILENRPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGA 501

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
             |    .||||| ..  .|||||. .     .  |||||||| .| |.|. ..|.||||
Sbjct: 502 PASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNA 561

Query: 123 PVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLL-QVTDATLFSL 181
           | .. |         ...|||   |||| || |.| |. ||. ..| || | |   || .
Sbjct: 562 PAVLHPRPDWEHSAPQRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLV 621

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
             . ||.|| |     |   |..||. .|||.|.||.| |. |      |    |  |.|
Sbjct: 622 STHTGEVRTARALLEDDSDTQQVVVLVRDNGDPSLSSTATVLL------VLEDEDPEEMP 675

Query: 242 LEYDIF------SDLNLYLVIGLGSVS 262
              |        ||| |||.. | .||
Sbjct: 676 KSSDFLIHPPERSDLTLYLIVALATVS 702

>hg18||uc003ljp
        |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|NP_114442|protocadheri
        n gamma subfamily A, 4 isoform 2

          Length = 820

 Score =  198 bits (501), Expect = 3e-050
 Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..|...||||| | || . |.  . |||  || . |.|| |||  .|  . | . |    
Sbjct: 438 ISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |||   | || | .||||  ..    . | ||| ||||||||. . ..||||
Sbjct: 498 GAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           | | |. | .   ||   |  ||| | | || ||.|.| ||  |. ..| ||. ..  ||
Sbjct: 558 NVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ..  . ||.|| |    ||   |||||| .|.| | ||||||. ..  ..     .||  
Sbjct: 618 AVGLHTGEVRTARALLDRDALKQRLVVVVQDHGQPPLSATVTLTVAVADSIPDVLADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      | | ||||. . .||
Sbjct: 678 LKPSADPDDSGLTLYLVVAVAAVS 701

>hg18||uc003ljq
        |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917|NP_061740|protocadher
        in gamma subfamily A, 4 isoform 1

          Length = 931

 Score =  198 bits (501), Expect = 3e-050
 Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 2/264 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ..|...||||| | || . |.  . |||  || . |.|| |||  .|  . | . |    
Sbjct: 438 ISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQ 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
              .|   |||   | || | .||||  ..    . | ||| ||||||||. . ..||||
Sbjct: 498 GAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           | | |. | .   ||   |  ||| | | || ||.|.| ||  |. ..| ||. ..  ||
Sbjct: 558 NVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ..  . ||.|| |    ||   |||||| .|.| | ||||||. ..  ..     .||  
Sbjct: 618 AVGLHTGEVRTARALLDRDALKQRLVVVVQDHGQPPLSATVTLTVAVADSIPDVLADLGS 677

Query: 240 V-PLEYDIFSDLNLYLVIGLGSVS 262
           . |      | | ||||. . .||
Sbjct: 678 LKPSADPDDSGLTLYLVVAVAAVS 701

>hg18||uc003ljb
        |5|NM_018934|Q9Y5E9|PCDBE_HUMAN|PCDHB14|NM_018934|NP_061757|protocadher
        in beta 14 precursor

          Length = 798

 Score =  197 bits (500), Expect = 5e-050
 Identities = 105/262 (40%), Positives = 158/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|. | |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 437 ITVLLSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSLLPPQDR 496

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  .|| | . | | ||| |||   | ....| ||
Sbjct: 497 HLPLASLVSINADNGHLFALRSLDYEALQEFEFRVGATDRGSPALSSEALVRVLVLDAND 556

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 557 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 616

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 617 VWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 676

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 677 APAQAQADSLTVYLVVALASVS 698

>hg18||uc003lip
        |5|NM_018938|Q9Y5E5|PCDB4_HUMAN|PCDHB4|NM_018938|NP_061761|protocadheri
        n beta 4 precursor

          Length = 795

 Score =  197 bits (499), Expect = 6e-050
 Identities = 103/262 (39%), Positives = 158/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|... |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 436 ITVQVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP 495

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 496 HLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGASDRGSPALSSEALVRVLVLDTND 555

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 556 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 615

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 616 VWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 675

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 676 APAQAQADSLTVYLVVALASVS 697

>hg18||uc003liq
        |5|NM_015669|Q9Y5E4|PCDB5_HUMAN|PCDHB5|NM_015669|NP_056484|protocadheri
        n beta 5 precursor

          Length = 795

 Score =  197 bits (499), Expect = 6e-050
 Identities = 104/262 (39%), Positives = 158/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 436 ITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQNP 495

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 496 HLRLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRVLVLDAND 555

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  |||
Sbjct: 556 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFS 615

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 616 MWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 675

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 676 APAQAQADSLTVYLVVALASVS 697

>hg18||uc003liw |5|NM_019119|NA|NA|PCDHB9|NM_019119|NP_061992|protocadherin beta
        9 precursor

          Length = 797

 Score =  196 bits (497), Expect = 1e-049
 Identities = 104/262 (39%), Positives = 158/262 (60%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .||.. |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 437 ITLQVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP 496

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 497 HLPLASLVSINADNGHLFALRSLDYEALQAFDFRVGASDRGSPALSSEALVRVLVLDAND 556

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 557 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFG 616

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 617 VWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 676

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 677 APAQAQADLLTVYLVVALASVS 698

>hg18||uc003lja
        |5|NM_018933|Q9Y5F0|PCDBD_HUMAN|PCDHB13|NM_018933|NP_061756|protocadher
        in beta 13 precursor

          Length = 798

 Score =  196 bits (496), Expect = 1e-049
 Identities = 104/262 (39%), Positives = 157/262 (59%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           ||. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  
Sbjct: 437 MTVLIADVNDNAPAFTQTSYTLFVRENNSPALHIRSVSATDRDSGTNAQVTYSLLPPQDP 496

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           .  .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| ||
Sbjct: 497 HLPLTSLVSINADNGHLFALRSLDYEALQGFQFRVGASDHGSPALSSEALVRVVVLDAND 556

Query: 121 NAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFS 180
           |.| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || 
Sbjct: 557 NSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATELGLFG 616

Query: 181 LDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV 240
           .  .|||.|| |. | ||    ||||. |||| |  ||| |. .  |.   . |  | | 
Sbjct: 617 VWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEA 676

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
                    | .|||. | |||
Sbjct: 677 APTQAQADLLTVYLVVALASVS 698

>hg18||uc003lke
        |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|NP_115270|protocadheri
        n gamma subfamily B, 5 isoform 2

          Length = 818

 Score =  195 bits (495), Expect = 2e-049
 Identities = 110/323 (34%), Positives = 178/323 (55%), Gaps = 3/323 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |. | . | ||| ||| .. . | | ||  |  . | |.  ..   
Sbjct: 436 LHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPL 495

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
           ...   |.. . | ..  . ||||  . |   ..||| ||| ||.|||. ... |.||||
Sbjct: 496 ALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNA 555

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | .. |     || . . .||. . | || ||.|.| || ||. ..| .|| ..  ||||
Sbjct: 556 PRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSL 615

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
               ||.|| |    ||   |||.|  .| | | |||| |. |   ..  .   |.|. |
Sbjct: 616 GLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRP 675

Query: 242 LEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQKPKASKAAPPCRNSVISERNSTI 301
           .  |  ..|  |||. |  .|             . ..  .| ||  |    .  ..  .
Sbjct: 676 VPSDPQAELQFYLVVALALISVLFLLAVILAVALRLRR-SSSPAAWSCFQPGLCVKSGPV 734

Query: 302 ADSTLVSND-AYWYSLFLAETRK 323
                      | |.| .| | |
Sbjct: 735 VPPNYSQGTLPYSYNLCVAHTGK 757

>hg18||uc003lkf
        |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925|NP_061748|protocadher
        in gamma subfamily B, 5 isoform 1

          Length = 923

 Score =  195 bits (495), Expect = 2e-049
 Identities = 110/323 (34%), Positives = 178/323 (55%), Gaps = 3/323 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |. | . | ||| ||| .. . | | ||  |  . | |.  ..   
Sbjct: 436 LHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPL 495

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
           ...   |.. . | ..  . ||||  . |   ..||| ||| ||.|||. ... |.||||
Sbjct: 496 ALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNA 555

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | .. |     || . . .||. . | || ||.|.| || ||. ..| .|| ..  ||||
Sbjct: 556 PRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSL 615

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
               ||.|| |    ||   |||.|  .| | | |||| |. |   ..  .   |.|. |
Sbjct: 616 GLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRP 675

Query: 242 LEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQKPKASKAAPPCRNSVISERNSTI 301
           .  |  ..|  |||. |  .|             . ..  .| ||  |    .  ..  .
Sbjct: 676 VPSDPQAELQFYLVVALALISVLFLLAVILAVALRLRR-SSSPAAWSCFQPGLCVKSGPV 734

Query: 302 ADSTLVSND-AYWYSLFLAETRK 323
                      | |.| .| | |
Sbjct: 735 VPPNYSQGTLPYSYNLCVAHTGK 757

>hg18||uc003lkx
        |5|NM_032406|Q9Y5F7-2|Q9Y5F7-2|PCDHGC4|NM_032406|NP_115782|protocadheri
        n gamma subfamily C, 4 isoform 2

          Length = 871

 Score =  195 bits (495), Expect = 2e-049
 Identities = 105/261 (40%), Positives = 155/261 (59%), Gaps = 1/261 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |  . . | ||| || || || | |||   |  . | .||    . 
Sbjct: 443 LNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV 502

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
           | |   |.||. | ..  ..||||  .   | ..||| |.||||| |.| . ..| ||||
Sbjct: 503 SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRLFVLDLNDNA 562

Query: 123 PVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSLD 182
           | .. |    ||.  . .| |   | |. || |.|.|| .|. ..||||.  | .||.. 
Sbjct: 563 PAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVS 622

Query: 183 QYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVPL 242
           .| ||.||       |   |.||.| ||.|.| || .||. .|  |       || |   
Sbjct: 623 RYAGEVRTAVPIP-ADLPPQKLVIVVKDSGSPPLSTSVTLLVSLEEDTHPVVPDLRESSA 681

Query: 243 EYDIFSDLNLYLVIGLGSVSF 263
             .  | | ||| . | .. |
Sbjct: 682 PREGESRLTLYLAVSLVAICF 702

>hg18||uc003lky
        |5|NM_018928|Q9Y5F7|PCDGL_HUMAN|PCDHGC4|NM_018928|NP_061751|protocadher
        in gamma subfamily C, 4 isoform 1

          Length = 938

 Score =  195 bits (495), Expect = 2e-049
 Identities = 105/261 (40%), Positives = 155/261 (59%), Gaps = 1/261 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           | . |.||| | | |  . . | ||| || || || | |||   |  . | .||    . 
Sbjct: 443 LNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV 502

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
           | |   |.||. | ..  ..||||  .   | ..||| |.||||| |.| . ..| ||||
Sbjct: 503 SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRLFVLDLNDNA 562

Query: 123 PVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSLD 182
           | .. |    ||.  . .| |   | |. || |.|.|| .|. ..||||.  | .||.. 
Sbjct: 563 PAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVS 622

Query: 183 QYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVPL 242
           .| ||.||       |   |.||.| ||.|.| || .||. .|  |       || |   
Sbjct: 623 RYAGEVRTAVPIP-ADLPPQKLVIVVKDSGSPPLSTSVTLLVSLEEDTHPVVPDLRESSA 681

Query: 243 EYDIFSDLNLYLVIGLGSVSF 263
             .  | | ||| . | .. |
Sbjct: 682 PREGESRLTLYLAVSLVAICF 702

>hg18||uc003ljz
        |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|NP_114476|protocadheri
        n gamma subfamily A, 7 isoform 2

          Length = 817

 Score =  195 bits (494), Expect = 2e-049
 Identities = 107/262 (40%), Positives = 156/262 (59%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           ... | ||| | || | |.. . |||  || .  .|| | |  .|  . | . |  |   
Sbjct: 440 MQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  .|    . | ||| ||||||.|. . ..||||| 
Sbjct: 500 PVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNP 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..| ||. ..  ||..
Sbjct: 560 PEILYPALPTDGSTGMELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
             | ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  . 
Sbjct: 620 GLYTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLE 679

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
           | .     || ||||. . .||
Sbjct: 680 PSDGPYNYDLTLYLVVAVATVS 701

>hg18||uc003lka
        |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920|NP_061743|protocadher
        in gamma subfamily A, 7 isoform 1

          Length = 932

 Score =  195 bits (494), Expect = 2e-049
 Identities = 107/262 (40%), Positives = 156/262 (59%), Gaps = 2/262 (0%)

Query:   3 LELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANT 62
           ... | ||| | || | |.. . |||  || .  .|| | |  .|  . | . |  |   
Sbjct: 440 MQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGA 499

Query:  63 SMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNA 122
            .|   ||| . | || |..||||  .|    . | ||| ||||||.|. . ..||||| 
Sbjct: 500 PVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNP 559

Query: 123 PVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           | |. |     ||   |  ||| . | || ||.|.| ||  |. ..| ||. ..  ||..
Sbjct: 560 PEILYPALPTDGSTGMELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAV 619

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEV- 240
             | ||.|| |    ||   | |||  .|.| | ||||||. ..  ..  .  .||  . 
Sbjct: 620 GLYTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLE 679

Query: 241 PLEYDIFSDLNLYLVIGLGSVS 262
           | .     || ||||. . .||
Sbjct: 680 PSDGPYNYDLTLYLVVAVATVS 701

>hg18||uc003liy
        |5|NM_018931|Q9Y5F2|PCDBB_HUMAN|PCDHB11|NM_018931|NP_061754|protocadher
        in beta 11 precursor

          Length = 797

 Score =  194 bits (491), Expect = 5e-049
 Identities = 103/261 (39%), Positives = 157/261 (60%)

Query:   2 TLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIAN 61
           |. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | .|  .  .
Sbjct: 438 TVLVSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSLLPPQDLH 497

Query:  62 TSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDN 121
             .. | ||| ..|.|. |.. |||  . | | . | | ||| |||   | ....| |||
Sbjct: 498 LPLASLVSINTDNGHLFALRSLDYEALQAFDFRVGATDRGSPALSSEALVRVLVLDANDN 557

Query: 122 APVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSL 181
           .| .. | .   .   | .||. . | || ||.|.| ||  |. ..||||. |.  || .
Sbjct: 558 SPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGV 617

Query: 182 DQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTEVP 241
             .|||.|| |. | ||    ||||. |||| |  ||| |...  |.   . |  | |  
Sbjct: 618 WAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLQVLLVDGFSQPYLPLPEAA 677

Query: 242 LEYDIFSDLNLYLVIGLGSVS 262
                   | .|||. | |||
Sbjct: 678 PAQAQADSLTVYLVVALASVS 698

>hg18||uc003lkm
        |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|NP_115272|protocadheri
        n gamma subfamily B, 7 isoform 2

          Length = 808

 Score =  194 bits (491), Expect = 5e-049
 Identities = 101/302 (33%), Positives = 171/302 (56%), Gaps = 2/302 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . |.||| | | || | . | ||| ||| .. ..| |||   |  . | ..  .. 
Sbjct: 438 ITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPDFGLNGRVSYSLIASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           . ..|   |.. . | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 SRTLSSYVSVSAQSGVVFAQRAFDHEQLRTFELTLQARDQGSPALSANVSLRVLVGDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     || . . .||.   | || ||.|.| || ||. ..| ..| ..  ||
Sbjct: 558 NAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVVQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.| .|    .|   |||.|  .| | | |||| |. |   ..  .   | ..
Sbjct: 618 SLGLRTGEVRMVRALGDKDSVRQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDFSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQKPKASKAAPPCRNSVISERNS 299
            |   |  ...  |||. |  .|             . ..   |  |  |  ||.  .. 
Sbjct: 678 HPTPSDSQAEMQFYLVVALALISVLFLLAVILAIALRLRQ-SFSPTAGDCFESVLCSKSG 736

Query: 300 TI 301
            .
Sbjct: 737 PV 738

>hg18||uc003lkn
        |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927|NP_061750|protocadher
        in gamma subfamily B, 7 isoform 1

          Length = 929

 Score =  194 bits (491), Expect = 5e-049
 Identities = 101/302 (33%), Positives = 171/302 (56%), Gaps = 2/302 (0%)

Query:   1 MTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIA 60
           .|| . |.||| | | || | . | ||| ||| .. ..| |||   |  . | ..  .. 
Sbjct: 438 ITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPDFGLNGRVSYSLIASDLE 497

Query:  61 NTSMSMLFSINPEDGNLYGLKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQND 120
           . ..|   |.. . | ..  . ||.|  . |   ..||| ||| ||.|||. ... |.||
Sbjct: 498 SRTLSSYVSVSAQSGVVFAQRAFDHEQLRTFELTLQARDQGSPALSANVSLRVLVGDRND 557

Query: 121 NAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLF 179
           ||| .. |     || . . .||.   | || ||.|.| || ||. ..| ..| ..  ||
Sbjct: 558 NAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVVQASEPGLF 617

Query: 180 SLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGNPALSATVTIKLSTVETAVKAYSDLTE 239
           ||    ||.| .|    .|   |||.|  .| | | |||| |. |   ..  .   | ..
Sbjct: 618 SLGLRTGEVRMVRALGDKDSVRQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDFSD 677

Query: 240 VPLEYDIFSDLNLYLVIGLGSVSFXXXXXXXXXXXXKCQKPKASKAAPPCRNSVISERNS 299
            |   |  ...  |||. |  .|             . ..   |  |  |  ||.  .. 
Sbjct: 678 HPTPSDSQAEMQFYLVVALALISVLFLLAVILAIALRLRQ-SFSPTAGDCFESVLCSKSG 736

Query: 300 TI 301
            .
Sbjct: 737 PV 738

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,464,252
Number of Sequences: 45480
Number of Extensions: 194464252
Number of Successful Extensions: 11249806
Number of sequences better than 0.0: 0
BLASTP 7.6.0