BLASTP 7.6.0


Query=fugu4_745691 |jgi|Takru4|745691|fgh5_pg.C_scaffold_2877000003
        (230 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003nxc |6|NM_025258|Q9Y334|G7C_HUMAN|C6orf27|NM_025258|N...     32   0.439
hg18||uc003rjo |6_cox_hap1|NM_025258|Q9Y334|G7C_HUMAN|C6orf27|NM...     32   0.439

>hg18||uc003nxc |6|NM_025258|Q9Y334|G7C_HUMAN|C6orf27|NM_025258|NP_079534|NG37
        protein

          Length = 852

 Score =  32 bits (72), Expect = 0.439
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query:  65 SENRESATGADMLLVLMFVLLPGFLHGFIP-----LLSPGSITHRVITERAILRKTAEV 118
           .|  .|  |   ||.|  .| |     | |     | .||||||. .|| | |  | ..
Sbjct:   4 TEVPQSHPGPSALLLLQLLLPP--TSAFFPNIWSLLAAPGSITHQDLTEEAALNVTLQL 60

>hg18||uc003rjo
        |6_cox_hap1|NM_025258|Q9Y334|G7C_HUMAN|C6orf27|NM_025258|NP_079534|NG37
        protein

          Length = 852

 Score =  32 bits (72), Expect = 0.439
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query:  65 SENRESATGADMLLVLMFVLLPGFLHGFIP-----LLSPGSITHRVITERAILRKTAEV 118
           .|  .|  |   ||.|  .| |     | |     | .||||||. .|| | |  | ..
Sbjct:   4 TEVPQSHPGPSALLLLQLLLPP--TSAFFPNIWSLLAAPGSITHQDLTEEAALNVTLQL 60

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0