BLASTP 7.6.0


Query=fugu4_745612 |jgi|Takru4|745612|fgh5_pg.C_scaffold_2806000001
        (371 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_0...     35   0.137
hg18||uc002zpv |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|...     29   7.510
hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8      29   7.510
hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       29   7.510
hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       29   7.510
hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       29   7.510

>hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_001714|dystonin
        isoform 1e precursor

          Length = 2649

 Score =  35 bits (79), Expect = 0.137
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query:  270 RRYMRNLKNAWEFSEDEMKRFMEVLNVTEAQTLRTTVAVINQRNQLKECII---NIQDKL 326
            || .  .    | .| |..|  ..    ||.       ..| ||||.|       ..| |
Sbjct: 1197 RRELETIVREKEAAERELERVRQLTIEAEAKRAAVEENLLNFRNQLEENTFTRRTLEDHL 1256

Query:  327 KFIELKKTQIDQEKALYIKCKEKMKANKNYEEDV 360
            |  .|    ..|.|    |  |...  .. ||..
Sbjct: 1257 KRKDLSLNDLEQQKN---KLMEELRRKRDNEEEL 1287

>hg18||uc002zpv
        |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|NP_002679|septin 5

          Length = 369

 Score =  29 bits (64), Expect = 7.510
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 126 SQTSDVIMYQIFGFEGKTLPFSLTVVDTPGYG 157
           ||| ... . .   | | .   ||.|||||.|
Sbjct:  83 SQTVEILKHTV-DIEEKGVKLKLTIVDTPGFG 113

>hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8

          Length = 483

 Score =  29 bits (64), Expect = 7.510
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query:  81 ILLLGETGTGKSALINVLVN 100
           || .|||| ||| |.| | |
Sbjct:  47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 429

 Score =  29 bits (64), Expect = 7.510
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query:  81 ILLLGETGTGKSALINVLVN 100
           || .|||| ||| |.| | |
Sbjct:  47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 442

 Score =  29 bits (64), Expect = 7.510
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query:  81 ILLLGETGTGKSALINVLVN 100
           || .|||| ||| |.| | |
Sbjct:  47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 440

 Score =  29 bits (64), Expect = 7.510
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query:  81 ILLLGETGTGKSALINVLVN 100
           || .|||| ||| |.| | |
Sbjct:  47 ILCVGETGIGKSTLMNTLFN 66

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,424,984
Number of Sequences: 45480
Number of Extensions: 65424984
Number of Successful Extensions: 5071428
Number of sequences better than 0.0: 0
BLASTP 7.6.0