BLASTP 7.6.0


Query=fugu4_745495 |jgi|Takru4|745495|fgh5_pg.C_scaffold_2705000001
        (156 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002wnq |20|NM_130811|P60880|SNP25_HUMAN|SNAP25|NM_130811...    180   8e-046
hg18||uc002wnr |20|NM_003081|Q5U0B5|Q5U0B5_HUMAN|SNAP25|NM_00308...    176   1e-044
hg18||uc002wns |20|AK094560|NA|NA|SNAP25|NA|NA|Homo sapiens cDNA...    165   3e-041
hg18||uc001zpz |15|NM_003825|O00161|SNP23_HUMAN|SNAP23|NM_003825...    158   3e-039
hg18||uc001zqa |15|NM_130798|O00161-2|O00161-2|SNAP23|NM_130798|...     76   2e-014
hg18||uc001zqa |15|NM_130798|O00161-2|O00161-2|SNAP23|NM_130798|...     63   1e-010
hg18||uc002jyg |17|AB046838|Q9HCF4|ALO17_HUMAN|KIAA1618|NA|NA|Pr...     29   2.306
hg18||uc001ror |12|CR749833|Q68CP9-3|Q68CP9-3|ARID2|NM_152641|NP...     27   8.762
hg18||uc001ros |12|NM_152641|Q68CP9|ARID2_HUMAN|ARID2|NM_152641|...     27   8.762
hg18||uc001rou |12|BC038726|NA|NA|ARID2|NM_152641|NP_689854|AT r...     27   8.762

>hg18||uc002wnq
        |20|NM_130811|P60880|SNP25_HUMAN|SNAP25|NM_130811|NP_570824|synaptosoma
        l-associated protein 25 isoform

          Length = 206

 Score =  180 bits (455), Expect = 8e-046
 Identities = 95/155 (61%), Positives = 117/155 (75%), Gaps = 9/155 (5%)

Query:   1 QLERIEEGLDQINSDMKEAEKNLTDLDRCCGLCA--CDKLKAFEESGAYKAVWGGASSQD 58
           ||||||||.|||| |||||||||||| . ||||   |.|||.   | |||  ||  ..||
Sbjct:  56 QLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKS---SDAYKKAWG--NNQD 110

Query:  59 AVVSNQPPSTHVVDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLKSMVIDMR 118
            ||..||    |||||| | .|||.|||||.| ||.||.|||  |  |.|||. | .|| 
Sbjct: 111 GVVASQP--ARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMG 168

Query: 119 NEIDTQRDQMDRVQGKATLNVSRIDHANQKATNLM 153
           ||||||  |.||.  ||  | .||| |||.|| ..
Sbjct: 169 NEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203

>hg18||uc002wnr
        |20|NM_003081|Q5U0B5|Q5U0B5_HUMAN|SNAP25|NM_003081|NP_003072|synaptosom
        al-associated protein 25 isoform

          Length = 206

 Score =  176 bits (445), Expect = 1e-044
 Identities = 91/155 (58%), Positives = 116/155 (74%), Gaps = 9/155 (5%)

Query:   1 QLERIEEGLDQINSDMKEAEKNLTDLDRCCGL--CACDKLKAFEESGAYKAVWGGASSQD 58
           ||.|.|||.. || ||||||||| || .||||  | |.|||.   | |||  ||  ..||
Sbjct:  56 QLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKS---SDAYKKAWG--NNQD 110

Query:  59 AVVSNQPPSTHVVDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLKSMVIDMR 118
            ||..||    |||||| | .|||.|||||.| ||.||.|||  |  |.|||. | .|| 
Sbjct: 111 GVVASQP--ARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMG 168

Query: 119 NEIDTQRDQMDRVQGKATLNVSRIDHANQKATNLM 153
           ||||||  |.||.  ||  | .||| |||.|| ..
Sbjct: 169 NEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203

>hg18||uc002wns |20|AK094560|NA|NA|SNAP25|NA|NA|Homo sapiens cDNA: FLJ23079 fis,
        clone LNG06039, highly similar to D21267 Homo sapiens mRNA

          Length = 143

 Score =  165 bits (416), Expect = 3e-041
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 9/147 (6%)

Query:   9 LDQINSDMKEAEKNLTDLDRCCGLCA--CDKLKAFEESGAYKAVWGGASSQDAVVSNQPP 66
           .|||| |||||||||||| . ||||   |.|||.   | |||  ||  ..|| ||..|| 
Sbjct:   1 MDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKS---SDAYKKAWG--NNQDGVVASQP- 54

Query:  67 STHVVDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLKSMVIDMRNEIDTQRD 126
              |||||| | .|||.|||||.| ||.||.|||  |  |.|||. | .|| ||||||  
Sbjct:  55 -ARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNR 113

Query: 127 QMDRVQGKATLNVSRIDHANQKATNLM 153
           |.||.  ||  | .||| |||.|| ..
Sbjct: 114 QIDRIMEKADSNKTRIDEANQRATKML 140

>hg18||uc001zpz
        |15|NM_003825|O00161|SNP23_HUMAN|SNAP23|NM_003825|NP_003816|synaptosoma
        l-associated protein 23 isoform

          Length = 211

 Score =  158 bits (398), Expect = 3e-039
 Identities = 86/159 (54%), Positives = 107/159 (67%), Gaps = 6/159 (3%)

Query:   1 QLERIEEGLDQINSDMKEAEKNLTDLDRCCGLCA--CDKLKAFEESGAYKAVW--GGASS 56
           || |||||||||| ||.| || ||.|..|||||   |.. | ||   |||  |  || .|
Sbjct:  51 QLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENS 110

Query:  57 QDAVVSNQP-PSTH-VVDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLKSMV 114
              ||| || | |.  . .      |||||.|.|.| |||||||||  ||||.|||| | 
Sbjct: 111 PCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMA 170

Query: 115 IDMRNEIDTQRDQMDRVQGKATLNVSRIDHANQKATNLM 153
           ... |||| |  |. |.  ||  |  ||| || .|  |.
Sbjct: 171 LNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 209

>hg18||uc001zqa
        |15|NM_130798|O00161-2|O00161-2|SNAP23|NM_130798|NP_570710|synaptosomal
        -associated protein 23 isoform

          Length = 158

 Score =  76 bits (185), Expect = 2e-014
 Identities = 37/67 (55%), Positives = 47/67 (70%)

Query:  87 VTHDGREDEMEENLAHVGSIVGNLKSMVIDMRNEIDTQRDQMDRVQGKATLNVSRIDHAN 146
           .|.| |||||||||  ||||.|||| | ... |||| |  |. |.  ||  |  ||| ||
Sbjct:  90 ITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIAN 149

Query: 147 QKATNLM 153
            .|  |.
Sbjct: 150 ARAKKLI 156

>hg18||uc001zqa
        |15|NM_130798|O00161-2|O00161-2|SNAP23|NM_130798|NP_570710|synaptosomal
        -associated protein 23 isoform

          Length = 158

 Score =  63 bits (151), Expect = 1e-010
 Identities = 26/35 (74%), Positives = 30/35 (85%)

Query:  1 QLERIEEGLDQINSDMKEAEKNLTDLDRCCGLCAC 35
          || |||||||||| ||.| || ||.|..||||| |
Sbjct: 51 QLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVC 85

>hg18||uc002jyg |17|AB046838|Q9HCF4|ALO17_HUMAN|KIAA1618|NA|NA|Protein ALO17
        (ALK lymphoma oligomerization partner on chromosome 17)

          Length = 1281

 Score =  29 bits (63), Expect = 2.306
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query:    7 EGLDQINSDMKEAEKNLTDLD--RCCGLCACDKLKAF 41
            | ||||| .. .|.| | |.   || || |    | |
Sbjct: 1122 ETLDQINQELIQAKKLLQDISEARCKGLQALSLRKEF 1158

>hg18||uc001ror |12|CR749833|Q68CP9-3|Q68CP9-3|ARID2|NM_152641|NP_689854|AT rich
        interactive domain 2 (ARID, RFX-like)

          Length = 1788

 Score =  27 bits (58), Expect = 8.762
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query:   71 VDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLK 111
            | ||.| .|     ||   .    . .||  ||||..   |
Sbjct: 1258 VHERKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRK 1298

>hg18||uc001ros |12|NM_152641|Q68CP9|ARID2_HUMAN|ARID2|NM_152641|NP_689854|AT
        rich interactive domain 2 (ARID, RFX-like)

          Length = 1835

 Score =  27 bits (58), Expect = 8.762
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query:   71 VDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLK 111
            | ||.| .|     ||   .    . .||  ||||..   |
Sbjct: 1258 VHERKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRK 1298

>hg18||uc001rou |12|BC038726|NA|NA|ARID2|NM_152641|NP_689854|AT rich interactive
        domain 2 (ARID, RFX-like)

          Length = 1127

 Score =  27 bits (58), Expect = 8.762
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query:  71 VDEREIMIMSGGYIRRVTHDGREDEMEENLAHVGSIVGNLK 111
           | ||.| .|     ||   .    . .||  ||||..   |
Sbjct: 592 VHERKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRK 632

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,273,556
Number of Sequences: 45480
Number of Extensions: 192273556
Number of Successful Extensions: 11036881
Number of sequences better than 0.0: 0
BLASTP 7.6.0