BLASTP 7.6.0


Query=fugu4_745441 |jgi|Takru4|745441|fgh5_pg.C_scaffold_2660000001
        (197 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003eev |3|NM_000388|P41180|CASR_HUMAN|CASR|NM_000388|NP_...    143   2e-034
hg18||uc003pxj |6|NM_148963|Q5T6X5|GPC6A_HUMAN|GPRC6A|NM_148963|...    104   9e-023
hg18||uc003eew |3|U20760|P41180-2|P41180-2|CASR|NM_000388|NP_000...    102   3e-022
hg18||uc001pcp |11|NM_000842|P41594-2|P41594-2|GRM5|NM_000842|NP...     98   6e-021
hg18||uc001pcq |11|D28539|P41594|MGR5_HUMAN|GRM5|NM_000842|NP_00...     98   6e-021
hg18||uc003pxk |6|AY435126|Q5T6X5-2|Q5T6X5-2|GPRC6A|NM_148963|NP...     96   2e-020
hg18||uc001aep |1|NM_152228|Q7RTX0|TS1R3_HUMAN|TAS1R3|NM_152228|...     90   2e-018
hg18||uc002qut |1_random|NM_152228|NA|NA|TAS1R3|NM_152228|NP_689...     90   2e-018
hg18||uc003qll |6|L76631|Q59HC2|Q59HC2_HUMAN|GRM1|NA|NA|Glutamat...     84   7e-017
hg18||uc003qlm |6|NM_000838|Q13255|MGR1_HUMAN|GRM1|NM_000838|NP_...     84   7e-017
hg18||uc003vlr |7|NM_000845|O00222|MGR8_HUMAN|GRM8|NM_000845|NP_...     81   8e-016
hg18||uc003vlt |7|AJ236921|O00222-2|O00222-2|GRM8|NA|NA|Metabotr...     81   8e-016
hg18||uc003pxl |6|AY435127|Q5T6X5-3|Q5T6X5-3|GPRC6A|NM_148963|NP...     71   6e-013
hg18||uc001ant |1|NM_138697|Q7RTX1|TS1R1_HUMAN|TAS1R1|NM_138697|...     61   7e-010
hg18||uc001anu |1|NM_177540|Q7RTX1-2|Q7RTX1-2|TAS1R1|NM_177540|N...     61   7e-010
hg18||uc001bba |1|NM_152232|Q8TE23|TS1R2_HUMAN|TAS1R2|NM_152232|...     50   2e-006
hg18||uc001ant |1|NM_138697|Q7RTX1|TS1R1_HUMAN|TAS1R1|NM_138697|...     49   3e-006
hg18||uc003dbp |3|NM_000839|Q14416|MGR2_HUMAN|GRM2|NM_000839|NP_...     45   6e-005
hg18||uc001anv |1|NM_177541|Q7RTX1-4|Q7RTX1-4|TAS1R1|NM_177541|N...     42   5e-004
hg18||uc003ytw |8|NM_003235|P01266|THYG_HUMAN|TG|NM_003235|NP_00...     32   0.566
hg18||uc002bwr |15|NM_024652|Q38SD2-3|Q38SD2-3|LRRK1|NM_024652|N...     28   6.257
hg18||uc002bul |15|NM_000875|P08069|IGF1R_HUMAN|IGF1R|NM_000875|...     28   8.172

>hg18||uc003eev
        |3|NM_000388|P41180|CASR_HUMAN|CASR|NM_000388|NP_000379|calcium-sensing
        receptor

          Length = 1078

 Score =  143 bits (358), Expect = 2e-034
 Identities = 72/173 (41%), Positives = 101/173 (58%), Gaps = 3/173 (1%)

Query:  27 CSKFTTINPKQVLAQLKTVNFSQN-GYAVSFDANGDPVASYELVNWKKS-GSGSIEVVPV 84
           |.    .   |||  |. .||. | |  |.||  || | .| ..||  |   |||    |
Sbjct: 449 CADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEV 508

Query:  85 GYYDASLPEGQEFRIFRD-ITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQC 143
           |||.    .|.   |  . | |    ..|| | ||  |  |||| . .|.| ||..||.|
Sbjct: 509 GYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVEC 568

Query: 144 PEGEISNVTDSPECIPCLDDFWPNPERNACFLKPVEFLSFNEVLGIILAVFSV 196
           |.|| |. ||.  |  | |||| |    .|  | .||||. |  || | .|.|
Sbjct: 569 PDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAV 621

>hg18||uc003pxj |6|NM_148963|Q5T6X5|GPC6A_HUMAN|GPRC6A|NM_148963|NP_683766|G
        protein-coupled receptor, family C, group 6,

          Length = 926

 Score =  104 bits (258), Expect = 9e-023
 Identities = 64/198 (32%), Positives = 100/198 (50%), Gaps = 19/198 (9%)

Query:   5 AVYAIAHAIHNAVCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQNGYAVSFDANGDPVA 64
           ||.|. .|| . .||  .    |       | ..|  || | |.    .  |||.||   
Sbjct: 418 AVFALGYAIRD-LCQARD----CQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNT 472

Query:  65 SYELVNWKKSGSGSIEVVPVGYYDAS-----LPEGQEFRIFRDITWVDGRKQVPVSVCSD 119
            |..| ||.  .| . |  .  ||       .|. .    ||..      ||.  | || 
Sbjct: 473 GYDVVLWKEI-NGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNL------KQIQ-SKCSK 524

Query: 120 SCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLD-DFWPNPERNACFLKPV 178
            |  |  |   . . ||||.|  |||   .| || | |. | .   |       || | |
Sbjct: 525 ECSPGQMKKTTRSQHICCYECQNCPENHYTNQTDMPHCLLCNNKTHWAPVRSTMCFEKEV 584

Query: 179 EFLSFNEVLGIILAVFSV 196
           |.|..|. | |.| . |.
Sbjct: 585 EYLNWNDSLAILLLILSL 602

>hg18||uc003eew
        |3|U20760|P41180-2|P41180-2|CASR|NM_000388|NP_000379|calcium-sensing
        receptor

          Length = 1088

 Score =  102 bits (253), Expect = 3e-022
 Identities = 45/94 (47%), Positives = 61/94 (64%)

Query: 103 ITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLD 162
           .|.|    ||| | ||  |  |||| . .|.| ||..||.||.|| |. ||.  |  | |
Sbjct: 538 LTFVLSVLQVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPD 597

Query: 163 DFWPNPERNACFLKPVEFLSFNEVLGIILAVFSV 196
           ||| |    .|  | .||||. |  || | .|.|
Sbjct: 598 DFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAV 631

>hg18||uc001pcp
        |11|NM_000842|P41594-2|P41594-2|GRM5|NM_000842|NP_000833|glutamate
        receptor, metabotropic 5 precursor

          Length = 1180

 Score =  98 bits (242), Expect = 6e-021
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 14/198 (7%)

Query:   2 VYKAVYAIAHAIHN---AVCQDTNATTRCSKFTTINPKQVLAQLKTVNFS-QNGYAVSFD 57
           |  |.|..|. .||   ..|        |     |. ...|  |   ||.  .|  . ||
Sbjct: 400 VINAIYSMAYGLHNMQMSLC--PGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFD 457

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
            |||    ||..|.|. |    . . || .|       | ..  |  |   .  .  |||
Sbjct: 458 ENGDSPGRYEIMNFKEMGKDYFDYINVGSWD-----NGELKMDDDEVW-SKKSNIIRSVC 511

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |. | .|  ||..||.  ||. |  | | |   | |   |  |    ||  .   | | |
Sbjct: 512 SEPCEKGQIKVIRKGEVSCCWTCTPCKENEY--VFDEYTCKACQLGSWPTDDLTGCDLIP 569

Query: 178 VEFLSFNEVLGIILAVFS 195
           |..| . .   |   ||.
Sbjct: 570 VQYLRWGDPEPIAAVVFA 587

>hg18||uc001pcq |11|D28539|P41594|MGR5_HUMAN|GRM5|NM_000842|NP_000833|glutamate
        receptor, metabotropic 5 precursor

          Length = 1212

 Score =  98 bits (242), Expect = 6e-021
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 14/198 (7%)

Query:   2 VYKAVYAIAHAIHN---AVCQDTNATTRCSKFTTINPKQVLAQLKTVNFS-QNGYAVSFD 57
           |  |.|..|. .||   ..|        |     |. ...|  |   ||.  .|  . ||
Sbjct: 400 VINAIYSMAYGLHNMQMSLC--PGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFD 457

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
            |||    ||..|.|. |    . . || .|       | ..  |  |   .  .  |||
Sbjct: 458 ENGDSPGRYEIMNFKEMGKDYFDYINVGSWD-----NGELKMDDDEVW-SKKSNIIRSVC 511

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |. | .|  ||..||.  ||. |  | | |   | |   |  |    ||  .   | | |
Sbjct: 512 SEPCEKGQIKVIRKGEVSCCWTCTPCKENEY--VFDEYTCKACQLGSWPTDDLTGCDLIP 569

Query: 178 VEFLSFNEVLGIILAVFS 195
           |..| . .   |   ||.
Sbjct: 570 VQYLRWGDPEPIAAVVFA 587

>hg18||uc003pxk |6|AY435126|Q5T6X5-2|Q5T6X5-2|GPRC6A|NM_148963|NP_683766|G
        protein-coupled receptor, family C, group 6,

          Length = 751

 Score =  96 bits (238), Expect = 2e-020
 Identities = 56/166 (33%), Positives = 85/166 (51%), Gaps = 14/166 (8%)

Query:  37 QVLAQLKTVNFSQNGYAVSFDANGDPVASYELVNWKKSGSGSIEVVPVGYYDAS-----L 91
           |.|  || | |.    .  |||.||    |..| ||.  .| . |  .  ||       .
Sbjct: 270 QLLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWKEI-NGHMTVTKMAEYDLQNDVFII 328

Query:  92 PEGQEFRIFRDITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNV 151
           |. .    ||..      ||.  | ||  |  |  |   . . ||||.|  |||   .| 
Sbjct: 329 PDQETKNEFRNL------KQIQ-SKCSKECSPGQMKKTTRSQHICCYECQNCPENHYTNQ 381

Query: 152 TDSPECIPCLD-DFWPNPERNACFLKPVEFLSFNEVLGIILAVFSV 196
           || | |. | .   |       || | ||.|..|. | |.| . |.
Sbjct: 382 TDMPHCLLCNNKTHWAPVRSTMCFEKEVEYLNWNDSLAILLLILSL 427

>hg18||uc001aep |1|NM_152228|Q7RTX0|TS1R3_HUMAN|TAS1R3|NM_152228|NP_689414|taste
        receptor, type 1, member 3

          Length = 852

 Score =  90 bits (221), Expect = 2e-018
 Identities = 65/192 (33%), Positives = 92/192 (47%), Gaps = 14/192 (7%)

Query:   2 VYKAVYAIAHAIHNAVCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQNGYAVSFDANGD 61
           || |||..| |.|| .    || . |     . | |.|  .  . |   |  . ||..|.
Sbjct: 393 VYAAVYSVAQALHNTL--QCNA-SGCPAQDPVKPWQLLENMYNLTFHVGGLPLRFDSSGN 449

Query:  62 PVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVCSDSC 121
               |.|  |   ||    .  || .. ||   .       | |     | ||| ||  |
Sbjct: 450 VDMEYDLKLWVWQGSVP-RLHDVGRFNGSLRTER-----LKIRWHTSDNQKPVSRCSRQC 503

Query: 122 PQG-TRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNA-CFLKPVE 179
            .|  |.|  ||   |||||| |  |      |   |  |  | | .|||.  || .   
Sbjct: 504 QEGQVRRV--KGFHSCCYDCVDCEAGSYRQNPDDIACTFCGQDEW-SPERSTRCFRRRSR 560

Query: 180 FLSFNEVLGIIL 191
           ||.. |   ..|
Sbjct: 561 FLAWGEPAVLLL 572

>hg18||uc002qut |1_random|NM_152228|NA|NA|TAS1R3|NM_152228|NP_689414|taste
        receptor, type 1, member 3

          Length = 852

 Score =  90 bits (221), Expect = 2e-018
 Identities = 65/192 (33%), Positives = 92/192 (47%), Gaps = 14/192 (7%)

Query:   2 VYKAVYAIAHAIHNAVCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQNGYAVSFDANGD 61
           || |||..| |.|| .    || . |     . | |.|  .  . |   |  . ||..|.
Sbjct: 393 VYAAVYSVAQALHNTL--QCNA-SGCPAQDPVKPWQLLENMYNLTFHVGGLPLRFDSSGN 449

Query:  62 PVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVCSDSC 121
               |.|  |   ||    .  || .. ||   .       | |     | ||| ||  |
Sbjct: 450 VDMEYDLKLWVWQGSVP-RLHDVGRFNGSLRTER-----LKIRWHTSDNQKPVSRCSRQC 503

Query: 122 PQG-TRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNA-CFLKPVE 179
            .|  |.|  ||   |||||| |  |      |   |  |  | | .|||.  || .   
Sbjct: 504 QEGQVRRV--KGFHSCCYDCVDCEAGSYRQNPDDIACTFCGQDEW-SPERSTRCFRRRSR 560

Query: 180 FLSFNEVLGIIL 191
           ||.. |   ..|
Sbjct: 561 FLAWGEPAVLLL 572

>hg18||uc003qll |6|L76631|Q59HC2|Q59HC2_HUMAN|GRM1|NA|NA|Glutamate receptor,
        metabotropic 1 variant (Fragment)

          Length = 906

 Score =  84 bits (207), Expect = 7e-017
 Identities = 58/198 (29%), Positives = 94/198 (47%), Gaps = 14/198 (7%)

Query:   2 VYKAVYAIAHAI---HNAVCQDTNATTRCSKFTTINPKQVLAQL-KTVNFSQNGYAVSFD 57
           |  |.||.|| .   |.|.|        |     |.  ..|  | |.     .|  | ||
Sbjct: 413 VINAIYAMAHGLQNMHHALC--PGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFD 470

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
             ||    |...| . . .   . | || .   .    ...|  .      .  |  |||
Sbjct: 471 EKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMN------KSGVVRSVC 524

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |. | .|  ||..||.  ||. |  | | |   | |   |  |   .||| .   |   |
Sbjct: 525 SEPCLKGQIKVIRKGEVSCCWICTACKENEY--VQDEFTCKACDLGWWPNADLTGCEPIP 582

Query: 178 VEFLSFNEVLGIILAVFS 195
           | .| .. .  ||   ||
Sbjct: 583 VRYLEWSNIESIIAIAFS 600

>hg18||uc003qlm
        |6|NM_000838|Q13255|MGR1_HUMAN|GRM1|NM_000838|NP_000829|glutamate
        receptor, metabotropic 1

          Length = 1194

 Score =  84 bits (207), Expect = 7e-017
 Identities = 58/198 (29%), Positives = 94/198 (47%), Gaps = 14/198 (7%)

Query:   2 VYKAVYAIAHAI---HNAVCQDTNATTRCSKFTTINPKQVLAQL-KTVNFSQNGYAVSFD 57
           |  |.||.|| .   |.|.|        |     |.  ..|  | |.     .|  | ||
Sbjct: 413 VINAIYAMAHGLQNMHHALC--PGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFD 470

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
             ||    |...| . . .   . | || .   .    ...|  .      .  |  |||
Sbjct: 471 EKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMN------KSGVVRSVC 524

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |. | .|  ||..||.  ||. |  | | |   | |   |  |   .||| .   |   |
Sbjct: 525 SEPCLKGQIKVIRKGEVSCCWICTACKENEY--VQDEFTCKACDLGWWPNADLTGCEPIP 582

Query: 178 VEFLSFNEVLGIILAVFS 195
           | .| .. .  ||   ||
Sbjct: 583 VRYLEWSNIESIIAIAFS 600

>hg18||uc003vlr
        |7|NM_000845|O00222|MGR8_HUMAN|GRM8|NM_000845|NP_000836|glutamate
        receptor, metabotropic 8 precursor

          Length = 908

 Score =  81 bits (198), Expect = 8e-016
 Identities = 63/202 (31%), Positives = 98/202 (48%), Gaps = 18/202 (8%)

Query:   2 VYKAVYAIAHAIHNA---VCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQN-GYAVSFD 57
           |  |||..|.|.||    .|        | . .||. |..|  .. |||. . |  |.|.
Sbjct: 405 VIDAVYSMAYALHNMHKDLC--PGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFN 462

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
            |||    |..  .. .   | |   .|..   |    |     |. |       | |||
Sbjct: 463 ENGDAPGRYDIFQYQITNK-STEYKVIGHWTNQLHLKVE-----DMQWAHREHTHPASVC 516

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |  |  | ||   || | ||. | .| ||    | |   |  |  |  ||  |  | | |
Sbjct: 517 SLPCKPGERKKTVKGVP-CCWHCERC-EGYNYQV-DELSCELCPLDQRPNMNRTGCQLIP 573

Query: 178 VEFLSFNE---VLGIILAVFSV 196
           .  | ..    |. . .|.  .
Sbjct: 574 IIKLEWHSPWAVVPVFVAILGI 595

>hg18||uc003vlt |7|AJ236921|O00222-2|O00222-2|GRM8|NA|NA|Metabotropic glutamate
        receptor 8 precursor (mGluR8)

          Length = 908

 Score =  81 bits (198), Expect = 8e-016
 Identities = 63/202 (31%), Positives = 98/202 (48%), Gaps = 18/202 (8%)

Query:   2 VYKAVYAIAHAIHNA---VCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQN-GYAVSFD 57
           |  |||..|.|.||    .|        | . .||. |..|  .. |||. . |  |.|.
Sbjct: 405 VIDAVYSMAYALHNMHKDLC--PGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFN 462

Query:  58 ANGDPVASYELVNWKKSGSGSIEVVPVGYYDASLPEGQEFRIFRDITWVDGRKQVPVSVC 117
            |||    |..  .. .   | |   .|..   |    |     |. |       | |||
Sbjct: 463 ENGDAPGRYDIFQYQITNK-STEYKVIGHWTNQLHLKVE-----DMQWAHREHTHPASVC 516

Query: 118 SDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERNACFLKP 177
           |  |  | ||   || | ||. | .| ||    | |   |  |  |  ||  |  | | |
Sbjct: 517 SLPCKPGERKKTVKGVP-CCWHCERC-EGYNYQV-DELSCELCPLDQRPNMNRTGCQLIP 573

Query: 178 VEFLSFNE---VLGIILAVFSV 196
           .  | ..    |. . .|.  .
Sbjct: 574 IIKLEWHSPWAVVPVFVAILGI 595

>hg18||uc003pxl |6|AY435127|Q5T6X5-3|Q5T6X5-3|GPRC6A|NM_148963|NP_683766|G
        protein-coupled receptor, family C, group 6,

          Length = 855

 Score =  71 bits (173), Expect = 6e-013
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 115 SVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLD-DFWPNPERNAC 173
           | ||  |  |  |   . . ||||.|  |||   .| || | |. | .   |       |
Sbjct: 449 SKCSKECSPGQMKKTTRSQHICCYECQNCPENHYTNQTDMPHCLLCNNKTHWAPVRSTMC 508

Query: 174 FLKPVEFLSFNEVLGIILAVFSV 196
           | | ||.|..|. | |.| . |.
Sbjct: 509 FEKEVEYLNWNDSLAILLLILSL 531

>hg18||uc001ant |1|NM_138697|Q7RTX1|TS1R1_HUMAN|TAS1R1|NM_138697|NP_619642|sweet
        taste receptor T1r isoform b

          Length = 841

 Score =  61 bits (147), Expect = 7e-010
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 103 ITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLD 162
           | |     ||| ||||  | .| ..|.  |   ||..|| |  |   | .|   | ||  
Sbjct: 483 IQWHGKDNQVPKSVCSSDCLEGHQRVV-TGFHHCCFECVPCGAGTFLNKSDLYRCQPCGK 541

Query: 163 DFWPNPERNACFLKPVEFLSFNE 185
           . |       || . | ||.  |
Sbjct: 542 EEWAPEGSQTCFPRTVVFLALRE 564

>hg18||uc001anu |1|NM_177540|Q7RTX1-2|Q7RTX1-2|TAS1R1|NM_177540|NP_803884|sweet
        taste receptor T1r isoform c

          Length = 587

 Score =  61 bits (147), Expect = 7e-010
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 103 ITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLD 162
           | |     ||| ||||  | .| ..|.  |   ||..|| |  |   | .|   | ||  
Sbjct: 229 IQWHGKDNQVPKSVCSSDCLEGHQRVV-TGFHHCCFECVPCGAGTFLNKSDLYRCQPCGK 287

Query: 163 DFWPNPERNACFLKPVEFLSFNE 185
           . |       || . | ||.  |
Sbjct: 288 EEWAPEGSQTCFPRTVVFLALRE 310

>hg18||uc001bba |1|NM_152232|Q8TE23|TS1R2_HUMAN|TAS1R2|NM_152232|NP_689418|taste
        receptor, type 1, member 2

          Length = 839

 Score =  50 bits (118), Expect = 2e-006
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query:   2 VYKAVYAIAHAIHNAVCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQNGYAVSFDANGD 61
           || ||||.|||.|. .  | .  |.      . | |.| ..  |||.   . . ||  ||
Sbjct: 388 VYSAVYAVAHALHSLLGCDKSTCTK----RVVYPWQLLEEIWKVNFTLLDHQIFFDPQGD 443

Query:  62 PVASYELVNWK 72
                |.| |.
Sbjct: 444 VALHLEIVQWQ 454

>hg18||uc001ant |1|NM_138697|Q7RTX1|TS1R1_HUMAN|TAS1R1|NM_138697|NP_619642|sweet
        taste receptor T1r isoform b

          Length = 841

 Score =  49 bits (116), Expect = 3e-006
 Identities = 25/73 (34%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query:   3 YKAVYAIAHAIHNAVCQDTNATTRCSKFTTINPKQVLAQLKTVNFSQNGYAVSFDANGDP 62
           |.||||.|| .|  .   . | .|      . | |.| |.  |.|  .   |.|. | ||
Sbjct: 390 YRAVYAVAHGLHQLLGCASGACSR----GRVYPWQLLEQIHKVHFLLHKDTVAFNDNRDP 445

Query:  63 VASYELVNWKKSG 75
           ..|| .. |  .|
Sbjct: 446 LSSYNIIAWDWNG 458

>hg18||uc003dbp
        |3|NM_000839|Q14416|MGR2_HUMAN|GRM2|NM_000839|NP_000830|glutamate
        receptor, metabotropic 2 precursor

          Length = 872

 Score =  45 bits (104), Expect = 6e-005
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 12/100 (12%)

Query:   2 VYKAVYAIAHAIHN---AVCQDTNATTRCSKFTTINPKQVLAQ-LKTVNF------SQNG 51
           |  ||||.|||.||   |.|   | |  |     .| ...    .  | |      .   
Sbjct: 381 VVNAVYAMAHALHNMHRALC--PNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTH 438

Query:  52 YAVSFDANGDPVASYELVNWKKSGSGSIEVVPVGYYDASL 91
             | ||  || .  | .  . ..|||      |||.   |
Sbjct: 439 NEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGL 478

>hg18||uc001anv |1|NM_177541|Q7RTX1-4|Q7RTX1-4|TAS1R1|NM_177541|NP_803885|sweet
        taste receptor T1r isoform d

          Length = 324

 Score =  42 bits (96), Expect = 5e-004
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 103 ITWVDGRKQVPVSVCSDSCPQGTRKVLQKGKPICCYDCVQCPEGEISN 150
           | |     ||| ||||  | .| ..|.  |   ||..|| |  |   |
Sbjct: 229 IQWHGKDNQVPKSVCSSDCLEGHQRVV-TGFHHCCFECVPCGAGTFLN 275

>hg18||uc003ytw
        |8|NM_003235|P01266|THYG_HUMAN|TG|NM_003235|NP_003226|thyroglobulin

          Length = 2768

 Score =  32 bits (70), Expect = 0.566
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 4/59 (6%)

Query:  121 CPQGTRKVLQKGKPICCYDCVQCPEGEISNVTDSPECIPCLDDFWPNPERN-ACFLKPV 178
            | .|  .||          ||.||||  |      |||||   |.     . ||   ||
Sbjct: 1440 CSEGFYQVLTSEASQDGLGCVKCPEGSYS---QDEECIPCPVGFYQEQAGSLACVPCPV 1495

>hg18||uc002bwr
        |15|NM_024652|Q38SD2-3|Q38SD2-3|LRRK1|NM_024652|NP_078928|leucine-rich
        repeat kinase 1

          Length = 2015

 Score =  28 bits (61), Expect = 6.257
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query:   49 QNGYAVSFDANGDPVASYELVNWKKSGSGSIEVV 82
            | |  |.||     | | . |||||  || ...|
Sbjct: 1087 QEGLLVTFDGGYLSVESSD-VNWKKKKSGGMKIV 1119

>hg18||uc002bul
        |15|NM_000875|P08069|IGF1R_HUMAN|IGF1R|NM_000875|NP_000866|insulin-like
        growth factor 1 receptor precursor

          Length = 1367

 Score =  28 bits (60), Expect = 8.172
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 139 DCVQ-CPEGEISNVTDSPECIPC 160
           .|.| || | | | . |  ||||
Sbjct: 302 ECMQECPSGFIRNGSQSMYCIPC 324

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0