BLASTP 7.6.0


Query=fugu4_745434 |jgi|Takru4|745434|fgh5_pg.C_scaffold_2652000002
        (158 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002xau |20|NM_021202|Q8IXH6|T53I2_HUMAN|TP53INP2|NM_0212...     39   0.003
hg18||uc003yhg |8|NM_033285|Q96A56|T53I1_HUMAN|TP53INP1|NM_03328...     30   1.069
hg18||uc001iqo |10|NM_207371|Q6ZMX4|Q6ZMX4_HUMAN|FLJ45187|NM_207...     28   4.062
hg18||uc003xee |8|NM_006158|NA|NA|NEFL|NM_006158|NP_006149|neuro...     27   6.928

>hg18||uc002xau
        |20|NM_021202|Q8IXH6|T53I2_HUMAN|TP53INP2|NM_021202|NP_067025|tumor
        protein p53 inducible nuclear protein 2

          Length = 220

 Score =  39 bits (88), Expect = 0.003
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 110 LQRARSQTERKKLGRRALHRQNLAKARLSWADRCYGHSK---QPCQRLYNY 157
           ||||| . ||  |  .|. |||  .|| |   |    |    ||||| .||
Sbjct: 172 LQRARQRAERHALSAKAVQRQN--RARESRPRRSKNQSSFIYQPCQRQFNY 220

>hg18||uc003yhg
        |8|NM_033285|Q96A56|T53I1_HUMAN|TP53INP1|NM_033285|NP_150601|tumor
        protein p53 inducible nuclear protein 1

          Length = 240

 Score =  30 bits (66), Expect = 1.069
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 111 QRARSQTERKKLGRRALHRQNLAKARLSWADRCYGHS----KQPCQRLYNY 157
           |  .  .||. | | .| |||| .       |   |.     ||| | |||
Sbjct: 193 QWIKEHSERQPLNRNSLRRQNLTR---DCHPRQVKHNGWVVHQPCPRQYNY 240

>hg18||uc001iqo
        |10|NM_207371|Q6ZMX4|Q6ZMX4_HUMAN|FLJ45187|NM_207371|NP_997254|hypothet
        ical protein LOC387640

          Length = 818

 Score =  28 bits (61), Expect = 4.062
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query:   3 GRLLSHLMGNVGSDEEGAEDPSEQLREQEEGG 34
           |  ||    .| |.||  |   |.  |.||||
Sbjct: 309 GSSLSSSSNSVSSEEEEEEGEEEEEEEEEEGG 340

>hg18||uc003xee |8|NM_006158|NA|NA|NEFL|NM_006158|NP_006149|neurofilament, light
        polypeptide 68kDa

          Length = 543

 Score =  27 bits (59), Expect = 6.928
 Identities = 10/19 (52%), Positives = 16/19 (84%)

Query:  16 DEEGAEDPSEQLREQEEGG 34
           .|| |.. ||. .|.||||
Sbjct: 494 EEEAAKEESEEAKEEEEGG 512

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,994,661
Number of Sequences: 45480
Number of Extensions: 193994661
Number of Successful Extensions: 11136213
Number of sequences better than 0.0: 0
BLASTP 7.6.0