BLASTP 7.6.0


Query=fugu4_745414 |jgi|Takru4|745414|fgh5_pg.C_scaffold_2632000001
        (320 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hpa |4|NM_006168|P78426|NKX61_HUMAN|NKX6-1|NM_006168|...    308   9e-084
hg18||uc001llr |10|NM_177400|Q5JSF3|Q5JSF3_HUMAN|NKX6-2|NM_17740...    253   2e-067
hg18||uc003izz |4_random|NM_018942|NA|NA|HMX1|NM_018942|NP_06181...     83   4e-016
hg18||uc001ksw |10|NM_005521|P31314|TLX1_HUMAN|TLX1|NM_005521|NP...     81   2e-015
hg18||uc003mbf |5|NM_021025|O43711|TLX3_HUMAN|TLX3|NM_021025|NP_...     80   3e-015
hg18||uc001lhc |10|NM_005519|NA|NA|HMX2|NM_005519|NP_005510|home...     77   3e-014
hg18||uc002smb |2|NM_016170|O43763|TLX2_HUMAN|TLX2|NM_016170|NP_...     77   3e-014
hg18||uc001hmv |1|NM_021958|Q9NZ75|Q9NZ75_HUMAN|HLX1|NM_021958|N...     73   4e-013
hg18||uc001ldh |10|NM_004098|Q04743|EMX2_HUMAN|EMX2|NM_004098|NP...     73   4e-013
hg18||uc003gmx |4|NM_001189|P78367|NKX32_HUMAN|BAPX1|NM_001189|N...     73   4e-013
hg18||uc003wnc |7|AY927458|NA|NA|HLXB9|NM_005515|NP_005506|homeo...     72   8e-013
hg18||uc003wnd |7|NM_005515|P50219|HLXB9_HUMAN|HLXB9|NM_005515|N...     72   8e-013
hg18||uc001kid |10|NM_002729|Q03014|HHEX_HUMAN|HHEX|NM_002729|NP...     71   1e-012
hg18||uc002uhn |2|NM_004405|Q07687|DLX2_HUMAN|DLX2|NM_004405|NP_...     71   1e-012
hg18||uc002sin |2|NM_004097|NA|NA|EMX1|NM_004097|NP_004088|empty...     71   2e-012
hg18||uc002uhl |2|NM_178120|P56177|DLX1_HUMAN|DLX1|NM_178120|NP_...     71   2e-012
hg18||uc002shh |2|NM_012476|Q9UIW0|VAX2_HUMAN|VAX2|NM_012476|NP_...     70   4e-012
hg18||uc003uom |7|NM_005222|NA|NA|DLX6|NM_005222|NP_005213|dista...     70   4e-012
hg18||uc002sil |2|NM_001040404|Q04741-2|Q04741-2|EMX1|NM_0010404...     69   7e-012
hg18||uc002ipy |17|NM_005220|O60479|DLX3_HUMAN|DLX3|NM_005220|NP...     69   9e-012
hg18||uc002vvw |2|NM_001485|P52951|GBX2_HUMAN|GBX2|NM_001485|NP_...     69   9e-012
hg18||uc003uon |7|NM_005221|P56178|DLX5_HUMAN|DLX5|NM_005221|NP_...     69   9e-012
hg18||uc003xdt |8|NM_006167|Q99801|NKX31_HUMAN|NKX3-1|NM_006167|...     69   9e-012
hg18||uc003xdu |8|AF249672|Q99801-3|Q99801-3|NKX3-1|NM_006167|NA...     69   9e-012
hg18||uc001qfc |11|NM_003658|Q6NT51|Q6NT51_HUMAN|BARX2|NM_003658...     68   1e-011
hg18||uc004aue |9|NM_021570|Q5VXQ6|Q5VXQ6_HUMAN|BARX1|NM_021570|...     68   1e-011
hg18||uc002inw |17|NM_024016|P17481|HXB8_HUMAN|HOXB8|NM_024016|N...     68   2e-011
hg18||uc001rok |12|NM_001004329|Q6ZNG2|Q6ZNG2_HUMAN|DBX2|NM_0010...     67   2e-011
hg18||uc001seu |12|NM_014620|Q86TF7|Q86TF7_HUMAN|HOXC4|NM_014620...     67   2e-011
hg18||uc001sex |12|NM_153633|Q86TF7|Q86TF7_HUMAN|HOXC4|NM_153633...     67   2e-011
hg18||uc003gif |4|NM_002448|P28360|MSX1_HUMAN|MSX1|NM_002448|NP_...     67   2e-011
hg18||uc003sys |7|NM_006896|P31268|HXA7_HUMAN|HOXA7|NM_006896|NP...     67   2e-011
hg18||uc001kpu |10|NM_145285|NA|NA|NKX2-3|NM_145285|NP_660328|NK...     67   3e-011
hg18||uc002inp |17|NM_024015|P17483|HXB4_HUMAN|HOXB4|NM_024015|N...     67   3e-011
hg18||uc004cbp |9|NM_020064|Q9BZE3|BARH1_HUMAN|BARHL1|NM_020064|...     67   3e-011
hg18||uc002uks |2|NM_014621|P09016|HXD4_HUMAN|HOXD4|NM_014621|NP...     66   5e-011
hg18||uc001wtt |14|NM_003317|P43699|TITF1_HUMAN|TITF1|NM_003317|...     66   6e-011
hg18||uc001wtu |14|NM_001079668|Q7KZF6|Q7KZF6_HUMAN|TITF1|NM_001...     66   6e-011
hg18||uc001wtv |14|D50740|P43699|TITF1_HUMAN|TITF1|NM_003317|NP_...     66   6e-011
hg18||uc003sym |7|NM_002141|Q00056|HXA4_HUMAN|HOXA4|NM_002141|NP...     66   6e-011
hg18||uc001dns |1|NM_020063|Q9NY43|BARH2_HUMAN|BARHL2|NM_020063|...     65   8e-011
hg18||uc002inv |17|NM_004502|Q96BQ6|Q96BQ6_HUMAN|HOXB7|NM_004502...     65   1e-010
hg18||uc002ipv |17|NM_138281|Q92988|DLX4_HUMAN|DLX4|NM_138281|NP...     65   1e-010
hg18||uc002ipw |17|NM_001934|Q92988-2|Q92988-2|DLX4|NM_001934|NP...     65   1e-010
hg18||uc003skg |7|NM_001080461|NA|NA|UNCX4.1|NM_001080461|NP_001...     65   1e-010
hg18||uc003mcy |5|NM_002449|Q53XM4|Q53XM4_HUMAN|MSX2|NM_002449|N...     64   2e-010
hg18||uc001urt |13|NM_000209|P52945|IPF1_HUMAN|PDX1|NM_000209|NP...     64   3e-010
hg18||uc002ins |17|NM_018952|P17509|HXB6_HUMAN|HOXB6|NM_018952|N...     63   4e-010
hg18||uc003mcm |5|NM_004387|P52952|NKX25_HUMAN|NKX2-5|NM_004387|...     63   4e-010
hg18||uc001ser |12|NM_022658|P31273|HXC8_HUMAN|HOXC8|NM_022658|N...     63   5e-010
hg18||uc003syh |7|NM_006735|O43364|HXA2_HUMAN|HOXA2|NM_006735|NP...     62   7e-010
hg18||uc003syo |7|NM_024014|P31267|HXA6_HUMAN|HOXA6|NM_024014|NP...     62   7e-010
hg18||uc001ghe |1|NM_006902|P54821-2|P54821-2|PRRX1|NM_006902|NP...     62   1e-009
hg18||uc001ghf |1|NM_022716|P54821|PRRX1_HUMAN|PRRX1|NM_022716|N...     62   1e-009
hg18||uc002ukn |2|CR613054|NA|NA|HOXD8|NM_019558|NP_062458|homeo...     62   1e-009
hg18||uc002uko |2|NM_019558|P13378|HXD8_HUMAN|HOXD8|NM_019558|NP...     62   1e-009
hg18||uc002ukp |2|BC090853|Q8IXZ1|Q8IXZ1_HUMAN|HOXD8|NM_019558|N...     62   1e-009
hg18||uc002wsi |20|NM_002509|O95096|NKX22_HUMAN|NKX2-2|NM_002509...     62   1e-009
hg18||uc001ksx |10|NM_006562|P52954|LBX1_HUMAN|LBX1|NM_006562|NP...     61   1e-009
hg18||uc001wtx |14|NM_014360|Q8IUT7|Q8IUT7_HUMAN|NKX2-8|NM_01436...     61   1e-009
hg18||uc002tlm |2|NM_001426|Q4ZG44|Q4ZG44_HUMAN|EN1|NM_001426|NP...     60   3e-009
hg18||uc004aud |9|BC009458|Q96GH8|Q96GH8_HUMAN|BARX1|NM_021570|N...     60   3e-009
hg18||uc004byh |9|NM_016307|Q99811|PRRX2_HUMAN|PRRX2|NM_016307|N...     60   3e-009
hg18||uc002ukt |2|NM_006898|P31249|HXD3_HUMAN|HOXD3|NM_006898|NP...     60   4e-009
hg18||uc003syj |7|NM_030661|O43365|HXA3_HUMAN|HOXA3|NM_030661|NP...     60   4e-009
hg18||uc003syk |7|NM_153631|O43365|HXA3_HUMAN|HOXA3|NM_153631|NP...     60   4e-009
hg18||uc001kuu |10|NM_005029|O75364|PITX3_HUMAN|PITX3|NM_005029|...     59   6e-009
hg18||uc002lhx |18|NM_013435|Q9Y2V3|RX_HUMAN|RAX|NM_013435|NP_03...     59   6e-009
hg18||uc003stc |7|NM_005924|P50222|MEOX2_HUMAN|MEOX2|NM_005924|N...     59   6e-009
hg18||uc003std |7|X82629|P50222|MEOX2_HUMAN|MEOX2|NM_005924|NP_0...     59   6e-009
hg18||uc002inr |17|NM_002147|P09067|HXB5_HUMAN|HOXB5|NM_002147|N...     59   7e-009
hg18||uc003hpa |4|NM_006168|P78426|NKX61_HUMAN|NKX6-1|NM_006168|...     59   9e-009
hg18||uc003kfg |5|NM_032109|Q5XKR4|Q5XKR4_HUMAN|OTP|NM_032109|NP...     59   9e-009
hg18||uc003syi |7|NM_153632|O43365|HXA3_HUMAN|HOXA3|NM_153632|NP...     59   9e-009
hg18||uc002inn |17|U59298|P14651|HXB3_HUMAN|HOXB3|NM_002146|NP_0...     58   1e-008
hg18||uc002ino |17|NM_002146|P14651|HXB3_HUMAN|HOXB3|NM_002146|N...     58   1e-008
hg18||uc001ses |12|NM_153693|P09630-2|P09630-2|HOXC6|NM_153693|N...     58   2e-008
hg18||uc001sev |12|NM_004503|P09630|HXC6_HUMAN|HOXC6|NM_004503|N...     58   2e-008
hg18||uc002inm |17|NM_002145|P14652|HXB2_HUMAN|HOXB2|NM_002145|N...     58   2e-008
hg18||uc002slv |2|AY203953|Q6XYB7|Q6XYB7_HUMAN|LBX2|NA|NA|LP3727        58   2e-008
hg18||uc002slw |2|NM_001009812|Q7Z5Y8|Q7Z5Y8_HUMAN|LBX2|NM_00100...     58   2e-008
hg18||uc003iac |4|NM_000325|Q99697-2|Q99697-2|PITX2|NM_000325|NP...     58   2e-008
hg18||uc003iad |4|NM_153426|Q99697|PITX2_HUMAN|PITX2|NM_153426|N...     58   2e-008
hg18||uc003iae |4|NM_153427|Q99697-3|Q99697-3|PITX2|NM_153427|NP...     58   2e-008
hg18||uc003iaf |4|AK127829|Q99697|PITX2_HUMAN|PITX2|NM_153426|NP...     58   2e-008
hg18||uc003wmb |7|NM_001427|P19622|HME2_HUMAN|EN2|NM_001427|NP_0...     58   2e-008
hg18||uc001sew |12|NM_018953|Q00444|HXC5_HUMAN|HOXC5|NM_018953|N...     57   2e-008
hg18||uc003lah |5|NM_002653|P78337|PITX1_HUMAN|PITX1|NM_002653|N...     57   4e-008
hg18||uc003lai |5|BC003685|P78337|PITX1_HUMAN|PITX1|NM_002653|NP...     57   4e-008
hg18||uc003sye |7|NM_005522|P49639|HXA1_HUMAN|HOXA1|NM_005522|NP...     57   4e-008
hg18||uc003syn |7|NM_019102|P20719|HXA5_HUMAN|HOXA5|NM_019102|NP...     57   4e-008
hg18||uc002ink |17|NM_002144|P14653|HXB1_HUMAN|HOXB1|NM_002144|N...     56   5e-008
hg18||uc003lrq |5|NM_001804|P47902|CDX1_HUMAN|CDX1|NM_001804|NP_...     56   6e-008
hg18||uc004cph |X|NM_000451|O15266|SHOX_HUMAN|SHOX|NM_000451|NP_...     56   6e-008
hg18||uc004cpi |X|NM_006883|Q5HYX6|Q5HYX6_HUMAN|SHOX|NM_006883|N...     56   6e-008
hg18||uc004fou |Y|NM_000451|O15266|SHOX_HUMAN|SHOX|NM_000451|NP_...     56   6e-008
hg18||uc004fov |Y|NM_006883|Q5HYX6|Q5HYX6_HUMAN|SHOX|NM_006883|N...     56   6e-008
hg18||uc001urv |13|NM_001265|Q99626|CDX2_HUMAN|CDX2|NM_001265|NP...     55   8e-008
hg18||uc003szd |7|NM_001989|P49640|EVX1_HUMAN|EVX1|NM_001989|NP_...     55   1e-007
hg18||uc002lyr |19|NM_032753|Q96IS3|Q96IS3_HUMAN|RAXL1|NM_032753...     55   1e-007

>hg18||uc003hpa |4|NM_006168|P78426|NKX61_HUMAN|NKX6-1|NM_006168|NP_006159|NK6
        transcription factor related, locus 1

          Length = 367

 Score =  308 bits (787), Expect = 9e-084
 Identities = 152/181 (83%), Positives = 155/181 (85%), Gaps = 4/181 (2%)

Query: 139 AAAVAVARYPKPLADLPGRTPIFWPGVMQSPHWRDARFACSPHQNSVLLDKDGKRKHTRP 198
           ||  || |||||||.|||||||||||||||| ||||| ||.||| |.|||||||||||||
Sbjct: 182 AAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRP 241

Query: 199 TFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMAT 258
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 242 TFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMAT 301

Query: 259 AKKKQDSETERLKGXXXXXXXXXXXXKPLDPNSDDEKITQLLKKHKP----GSALLLHTS 314
           ||||||||||||||            ||||||||||||||||||||     |  |||| |
Sbjct: 302 AKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGLLLHAS 361

Query: 315 E 315
           |
Sbjct: 362 E 362

>hg18||uc001llr |10|NM_177400|Q5JSF3|Q5JSF3_HUMAN|NKX6-2|NM_177400|NP_796374|NK6
        transcription factor related, locus 2

          Length = 277

 Score =  253 bits (646), Expect = 2e-067
 Identities = 127/172 (73%), Positives = 140/172 (81%), Gaps = 2/172 (1%)

Query: 141 AVAVAR-YPKPLADLPGRTPIFWPGVMQSPHWRDARFACSPHQNSVLLDKDGKRKHTRPT 199
           | |||| ||||||.|||| |||||||.|   ||| | |  |     .||||||.||.|||
Sbjct:  96 AAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLA-GPAPAGGVLDKDGKKKHSRPT 154

Query: 200 FSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATA 259
           |||||||||||||||||||||||||||||||||||||||||||||||||||.||||||.|
Sbjct: 155 FSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASA 214

Query: 260 KKKQDSETERLKGXXXXXXXXXXXXKPLDPNSDDEKITQLLKKHKPGSALLL 311
           ||||||. |.||             .||||||||||||.||||||| .  |.
Sbjct: 215 KKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALV 266

>hg18||uc003izz |4_random|NM_018942|NA|NA|HMX1|NM_018942|NP_061815|homeo box (H6
        family) 1

          Length = 348

 Score =  83 bits (204), Expect = 4e-016
 Identities = 38/69 (55%), Positives = 51/69 (73%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           |..| ||  ||  |.| || ||.  .||.  ||| || || .||.|||.|||||| ||..
Sbjct: 201 GRKKKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKR 260

Query: 251 KHAAEMATA 259
           . |||.  |
Sbjct: 261 QLAAELEAA 269

>hg18||uc001ksw |10|NM_005521|P31314|TLX1_HUMAN|TLX1|NM_005521|NP_005512|T-cell
        leukemia, homeobox 1

          Length = 330

 Score =  81 bits (198), Expect = 2e-015
 Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 158 TPIFWPGVMQSPHWRDARFACSPHQNSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKY 217
           | . .| .  .  .   ||   |.||        |.|  | .|.  ||  ||| | . ||
Sbjct: 170 TGLTFPWMESNRRYTKDRFTGHPYQNRT----PPKKKKPRTSFTRLQICELEKRFHRQKY 225

Query: 218 LAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKK 262
           ||  ||| || .| ||..||| ||||||||||.. | |    ...
Sbjct: 226 LASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQ 270

>hg18||uc003mbf |5|NM_021025|O43711|TLX3_HUMAN|TLX3|NM_021025|NP_066305|T-cell
        leukemia, homeobox 3

          Length = 291

 Score =  80 bits (196), Expect = 3e-015
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 5/86 (5%)

Query: 180 PHQNSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 239
           |.||        |||  | .||  ||  ||| | . ||||  ||| || || ||..||| 
Sbjct: 157 PYQNRT----PPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKT 212

Query: 240 WFQNRRTKWRKKHAAEMATAKKKQDS 265
           ||||||||||..  ||   |...| |
Sbjct: 213 WFQNRRTKWRRQ-TAEEREAERQQAS 237

>hg18||uc001lhc |10|NM_005519|NA|NA|HMX2|NM_005519|NP_005510|homeo box (H6
        family) 2

          Length = 273

 Score =  77 bits (188), Expect = 3e-014
 Identities = 35/67 (52%), Positives = 48/67 (71%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           .| ||  ||  |.. || ||.  .||.  ||| || || .||.||| |||||| ||... 
Sbjct: 149 KKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQL 208

Query: 253 AAEMATA 259
           .||.  |
Sbjct: 209 SAELEAA 215

>hg18||uc002smb |2|NM_016170|O43763|TLX2_HUMAN|TLX2|NM_016170|NP_057254|T-cell
        leukemia, homeobox 2

          Length = 284

 Score =  77 bits (188), Expect = 3e-014
 Identities = 40/76 (52%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 180 PHQNSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 239
           |.||        |||  | .||  |.  ||. | . ||||  ||| || .| ||..||| 
Sbjct: 148 PYQNRT----PPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKT 203

Query: 240 WFQNRRTKWRKKHAAE 255
           ||||||||||.. | |
Sbjct: 204 WFQNRRTKWRRQTAEE 219

>hg18||uc001hmv
        |1|NM_021958|Q9NZ75|Q9NZ75_HUMAN|HLX1|NM_021958|NP_068777|H2.0-like
        homeo box 1

          Length = 488

 Score =  73 bits (178), Expect = 4e-013
 Identities = 40/75 (53%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           ||  .|  ||  |   ||| ||  ||.  |.| .||  ||.|..|||||||||| |||  
Sbjct: 275 KRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWR-- 332

Query: 252 HAAEMATAKKKQDSE 266
           |. | | |.| .| |
Sbjct: 333 HSKE-AQAQKDKDKE 346

>hg18||uc001ldh |10|NM_004098|Q04743|EMX2_HUMAN|EMX2|NM_004098|NP_004089|empty
        spiracles homolog 2

          Length = 252

 Score =  73 bits (178), Expect = 4e-013
 Identities = 45/127 (35%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 148 PKPLADLPGRTP-IFWPGVMQSPHWRDARFA---CSPHQNSVLLDKDGKRKHTRPTFSGQ 203
           | ||     | |  |.| ..    .   ||     ||    .      | |  |  ||  
Sbjct: 105 PHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPS 164

Query: 204 QIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQ 263
           |.  ||  ||.  |. | || .||.|| .||.||||||||||||....   |  .  ...
Sbjct: 165 QLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQK 224

Query: 264 DSETERL 270
              |  .
Sbjct: 225 KKGTHHI 231

>hg18||uc003gmx
        |4|NM_001189|P78367|NKX32_HUMAN|BAPX1|NM_001189|NP_001180|bagpipe
        homeobox 1

          Length = 333

 Score =  73 bits (178), Expect = 4e-013
 Identities = 33/63 (52%), Positives = 46/63 (73%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           ..| .|  ||  |.| ||. |   .||.||||| || || .||.|||.|||||| | ...
Sbjct: 205 RKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRR 264

Query: 252 HAA 254
             |
Sbjct: 265 QMA 267

>hg18||uc003wnc |7|AY927458|NA|NA|HLXB9|NM_005515|NP_005506|homeo box HB9

          Length = 189

 Score =  72 bits (175), Expect = 8e-013
 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 5/82 (6%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           || .  |  |. ||.  ||  |.  |||. |.|  .| || .||.|||.|||||| ||..
Sbjct:  27 GKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 86

Query: 251 KHAAEMATAKKKQDSETERLKG 272
                   ||..   | |. ||
Sbjct:  87 S-----KKAKEQAAQEAEKQKG 103

>hg18||uc003wnd |7|NM_005515|P50219|HLXB9_HUMAN|HLXB9|NM_005515|NP_005506|homeo
        box HB9

          Length = 401

 Score =  72 bits (175), Expect = 8e-013
 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 5/82 (6%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           || .  |  |. ||.  ||  |.  |||. |.|  .| || .||.|||.|||||| ||..
Sbjct: 239 GKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 298

Query: 251 KHAAEMATAKKKQDSETERLKG 272
                   ||..   | |. ||
Sbjct: 299 S-----KKAKEQAAQEAEKQKG 315

>hg18||uc001kid
        |10|NM_002729|Q03014|HHEX_HUMAN|HHEX|NM_002729|NP_002720|hematopoietica
        lly expressed homeobox

          Length = 270

 Score =  71 bits (173), Expect = 1e-012
 Identities = 36/72 (50%), Positives = 44/72 (61%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           |||  .  ||  |   ||| ||  |||. ||| |||  | ..| ||| |||||| |||. 
Sbjct: 136 KRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRL 195

Query: 252 HAAEMATAKKKQ 263
                 . ||..
Sbjct: 196 KQENPQSNKKEE 207

>hg18||uc002uhn
        |2|NM_004405|Q07687|DLX2_HUMAN|DLX2|NM_004405|NP_004396|distal-less
        homeobox 2

          Length = 328

 Score =  71 bits (173), Expect = 1e-012
 Identities = 33/62 (53%), Positives = 48/62 (77%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | .  |  .|  |. ||.. |..|.||| |||| || |||.|..|||.||||||.|.
Sbjct: 148 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKF 207

Query: 249 RK 250
           .|
Sbjct: 208 KK 209

>hg18||uc002sin |2|NM_004097|NA|NA|EMX1|NM_004097|NP_004088|empty spiracles
        homolog 1 isoform 1

          Length = 290

 Score =  71 bits (172), Expect = 2e-012
 Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 3/102 (2%)

Query: 157 RTPI-FWPGVMQSPHWRDARFACSPHQNSVLLDKD--GKRKHTRPTFSGQQIFALEKTFE 213
           | |. |.| |...  .     |    |. .||      | |  |  ||  |.  ||. ||
Sbjct: 153 RDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFE 212

Query: 214 QTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAE 255
           .  |. | || .|| || ..|.||||||||||||....   |
Sbjct: 213 KNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEE 254

>hg18||uc002uhl
        |2|NM_178120|P56177|DLX1_HUMAN|DLX1|NM_178120|NP_835221|distal-less
        homeobox 1 isoform 1

          Length = 255

 Score =  71 bits (172), Expect = 2e-012
 Identities = 33/62 (53%), Positives = 47/62 (75%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | .  |  .|  |. || . |.||.||| |||| || |||.|..|||.||||.|.|.
Sbjct: 124 KGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKF 183

Query: 249 RK 250
           .|
Sbjct: 184 KK 185

>hg18||uc002shh |2|NM_012476|Q9UIW0|VAX2_HUMAN|VAX2|NM_012476|NP_036608|ventral
        anterior homeobox 2

          Length = 290

 Score =  70 bits (169), Expect = 4e-012
 Identities = 34/80 (42%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 187 LDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRT 246
           || | . | || .|. .|.. ||  |.. .|. | ||  ||  | ..|.|||||||||||
Sbjct:  97 LDLD-RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRT 155

Query: 247 KWRKKHAAEMATAKKKQDSE 266
           | .|  . ..        ||
Sbjct: 156 KQKKDQSRDLEKRASSSASE 175

>hg18||uc003uom |7|NM_005222|NA|NA|DLX6|NM_005222|NP_005213|distal-less homeobox
        6

          Length = 265

 Score =  70 bits (169), Expect = 4e-012
 Identities = 33/62 (53%), Positives = 46/62 (74%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | .  |  .|  |. ||   |.||.||| |||| || |||.|..|||.||||.|.|.
Sbjct: 135 KGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKF 194

Query: 249 RK 250
           .|
Sbjct: 195 KK 196

>hg18||uc002sil
        |2|NM_001040404|Q04741-2|Q04741-2|EMX1|NM_001040404|NP_001035494|empty
        spiracles homolog 1 isoform 2

          Length = 119

 Score =  69 bits (167), Expect = 7e-012
 Identities = 32/64 (50%), Positives = 44/64 (68%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           | |  |  ||  |.  ||. ||.  |. | || .|| || ..|.||||||||||||....
Sbjct:  20 KPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQ 79

Query: 252 HAAE 255
              |
Sbjct:  80 KLEE 83

>hg18||uc002ipy
        |17|NM_005220|O60479|DLX3_HUMAN|DLX3|NM_005220|NP_005211|distal-less
        homeobox 3

          Length = 287

 Score =  69 bits (166), Expect = 9e-012
 Identities = 31/62 (50%), Positives = 46/62 (74%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | .  |  .|  |. ||.. |.. .||| |||| ||  ||.|..|||.||||||.|.
Sbjct: 125 KPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKF 184

Query: 249 RK 250
           .|
Sbjct: 185 KK 186

>hg18||uc002vvw
        |2|NM_001485|P52951|GBX2_HUMAN|GBX2|NM_001485|NP_001476|gastrulation
        brain homeo box 2

          Length = 348

 Score =  69 bits (166), Expect = 9e-012
 Identities = 32/80 (40%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           || .  |  |. .|.  ||| |   |||.  ||...|..| ..| |||.|||||| ||..
Sbjct: 245 GKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 304

Query: 251 KHAAEMATAKKKQDSETERL 270
             |   | .|  . |   ..
Sbjct: 305 VKAGN-ANSKTGEPSRNPKI 323

>hg18||uc003uon
        |7|NM_005221|P56178|DLX5_HUMAN|DLX5|NM_005221|NP_005212|distal-less
        homeobox 5

          Length = 289

 Score =  69 bits (166), Expect = 9e-012
 Identities = 32/62 (51%), Positives = 47/62 (75%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | .  |  .|  |. ||.. |..|.||| |||| || |||.|..|||.||||.|.| 
Sbjct: 133 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI 192

Query: 249 RK 250
           .|
Sbjct: 193 KK 194

>hg18||uc003xdt |8|NM_006167|Q99801|NKX31_HUMAN|NKX3-1|NM_006167|NP_006158|NK3
        transcription factor related, locus 1

          Length = 234

 Score =  69 bits (166), Expect = 9e-012
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           .| .|  ||  |.  ||. |   |||. |||| || .| .||.|||.|||||| | ..| 
Sbjct: 124 QKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQ 183

Query: 253 -AAEMATAKK 261
            ..|.   .|
Sbjct: 184 LSSELGDLEK 193

>hg18||uc003xdu |8|AF249672|Q99801-3|Q99801-3|NKX3-1|NM_006167|NA|NK3
        transcription factor related, locus 1

          Length = 159

 Score =  69 bits (166), Expect = 9e-012
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           .| .|  ||  |.  ||. |   |||. |||| || .| .||.|||.|||||| | ..| 
Sbjct:  49 QKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQ 108

Query: 253 -AAEMATAKK 261
            ..|.   .|
Sbjct: 109 LSSELGDLEK 118

>hg18||uc001qfc
        |11|NM_003658|Q6NT51|Q6NT51_HUMAN|BARX2|NM_003658|NP_003649|BarH-like
        homeobox 2

          Length = 279

 Score =  68 bits (165), Expect = 1e-011
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           | . .|  |.  |.  ||| |.. |||. |.|  || |||.|. ||| |.|||| ||.|
Sbjct: 132 KPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKK 190

>hg18||uc004aue
        |9|NM_021570|Q5VXQ6|Q5VXQ6_HUMAN|BARX1|NM_021570|NP_067545|BarH-like
        homeobox 1

          Length = 225

 Score =  68 bits (165), Expect = 1e-011
 Identities = 31/62 (50%), Positives = 43/62 (69%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |  | . .|  |.  |.  ||| ||. |||. |.|  || |||... ||| |.|||| ||
Sbjct: 109 KAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKW 168

Query: 249 RK 250
           .|
Sbjct: 169 KK 170

>hg18||uc002inw
        |17|NM_024016|P17481|HXB8_HUMAN|HOXB8|NM_024016|NP_076921|homeobox B8

          Length = 243

 Score =  68 bits (164), Expect = 2e-011
 Identities = 32/79 (40%), Positives = 47/79 (59%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           |.  | |.|  |   ||| |    ||    |  ....||.|| |||.|||||| ||.|..
Sbjct: 146 RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 205

Query: 253 AAEMATAKKKQDSETERLK 271
             .   . | .  | |. |
Sbjct: 206 NKDKFPSSKCEQEELEKQK 224

>hg18||uc001rok
        |12|NM_001004329|Q6ZNG2|Q6ZNG2_HUMAN|DBX2|NM_001004329|NP_001004329|dev
        eloping brain homeobox 2

          Length = 339

 Score =  67 bits (163), Expect = 2e-011
 Identities = 32/68 (47%), Positives = 45/68 (66%)

Query: 197 RPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEM 256
           |  ||  |  |||| |.. ||..  .| .|| .||. |||||.|||||| |||     |.
Sbjct: 190 RAVFSEDQRKALEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNRRMKWRNSKEKEV 249

Query: 257 ATAKKKQD 264
            . .  |.
Sbjct: 250 LSNRCIQE 257

>hg18||uc001seu
        |12|NM_014620|Q86TF7|Q86TF7_HUMAN|HOXC4|NM_014620|NP_055435|homeobox
        C4

          Length = 264

 Score =  67 bits (163), Expect = 2e-011
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           |. | .|  .. ||.  ||| |   .||    |  .|.|| ..| |.|.|||||| ||.|
Sbjct: 154 GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK 213

Query: 251 KH 252
            |
Sbjct: 214 DH 215

>hg18||uc001sex
        |12|NM_153633|Q86TF7|Q86TF7_HUMAN|HOXC4|NM_153633|NP_705897|homeobox
        C4

          Length = 264

 Score =  67 bits (163), Expect = 2e-011
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           |. | .|  .. ||.  ||| |   .||    |  .|.|| ..| |.|.|||||| ||.|
Sbjct: 154 GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK 213

Query: 251 KH 252
            |
Sbjct: 214 DH 215

>hg18||uc003gif |4|NM_002448|P28360|MSX1_HUMAN|MSX1|NM_002448|NP_002439|msh
        homeobox 1

          Length = 303

 Score =  67 bits (163), Expect = 2e-011
 Identities = 44/110 (40%), Positives = 60/110 (54%), Gaps = 14/110 (12%)

Query: 155 PGRTPIFWPGVMQSPHWRDARFACSPHQN----SVLLDKDGKRKHTRPTFSGQQIFALEK 210
           | |||  |   ||||     ||.  | .     .  | |    .  |  |.  |. |||.
Sbjct: 140 PERTP--W---MQSP-----RFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALER 189

Query: 211 TFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAK 260
            | | .||.  |||  . || .||.|||.|||||| | ..   ||.   |
Sbjct: 190 KFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLK 239

>hg18||uc003sys
        |7|NM_006896|P31268|HXA7_HUMAN|HOXA7|NM_006896|NP_008827|homeobox A7

          Length = 230

 Score =  67 bits (163), Expect = 2e-011
 Identities = 31/67 (46%), Positives = 42/67 (62%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           ||  | |..  |   ||| |   .||    |  .|..| .|| |.|.|||||| ||.|.|
Sbjct: 130 RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 189

Query: 253 AAEMATA 259
             |  ||
Sbjct: 190 KDEGPTA 196

>hg18||uc001kpu |10|NM_145285|NA|NA|NKX2-3|NM_145285|NP_660328|NK2 transcription
        factor related, locus 3

          Length = 293

 Score =  67 bits (161), Expect = 3e-011
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 189 KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 248
           |   |.  |  ||  |.| ||. |.| .||. |||  || || .| .|||.|||||| | 
Sbjct: 144 KPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKC 203

Query: 249 RKK 251
           ...
Sbjct: 204 KRQ 206

>hg18||uc002inp
        |17|NM_024015|P17483|HXB4_HUMAN|HOXB4|NM_024015|NP_076920|homeobox B4

          Length = 251

 Score =  67 bits (161), Expect = 3e-011
 Identities = 27/62 (43%), Positives = 41/62 (66%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           |. | .|  .. ||.  ||| |   .||    |  .|..| ..| |.|.|||||| ||.|
Sbjct: 160 GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK 219

Query: 251 KH 252
            |
Sbjct: 220 DH 221

>hg18||uc004cbp
        |9|NM_020064|Q9BZE3|BARH1_HUMAN|BARHL1|NM_020064|NP_064448|BarH-like 1

          Length = 327

 Score =  67 bits (161), Expect = 3e-011
 Identities = 29/62 (46%), Positives = 44/62 (70%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           | .  |  |.  |.  ||..||. |||.  .|  || || .|..||| |.|||||||...
Sbjct: 177 KPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQ 236

Query: 252 HA 253
            |
Sbjct: 237 TA 238

>hg18||uc002uks
        |2|NM_014621|P09016|HXD4_HUMAN|HOXD4|NM_014621|NP_055436|homeobox D4

          Length = 255

 Score =  66 bits (160), Expect = 5e-011
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 181 HQNSVLLD-KDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 239
           | |||  .   |. | .|  .. ||.  ||| |   .||    |  .|..| ..| |.|.
Sbjct: 141 HVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKI 200

Query: 240 WFQNRRTKWRKKHAAEMATAKKKQDSET 267
           |||||| ||.| |       .    | .
Sbjct: 201 WFQNRRMKWKKDHKLPNTKGRSSSSSSS 228

>hg18||uc001wtt
        |14|NM_003317|P43699|TITF1_HUMAN|TITF1|NM_003317|NP_003308|thyroid
        transcription factor 1 isoform 2

          Length = 371

 Score =  66 bits (159), Expect = 6e-011
 Identities = 31/73 (42%), Positives = 47/73 (64%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           |.  |  ||  |.. ||. |.| |||. |||  ||  . .| .|||.|||| | | ... 
Sbjct: 161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQA 220

Query: 253 AAEMATAKKKQDS 265
             . |  . .|||
Sbjct: 221 KDKAAQQQLQQDS 233

>hg18||uc001wtu
        |14|NM_001079668|Q7KZF6|Q7KZF6_HUMAN|TITF1|NM_001079668|NP_001073136|th
        yroid transcription factor 1 isoform 1

          Length = 401

 Score =  66 bits (159), Expect = 6e-011
 Identities = 31/73 (42%), Positives = 47/73 (64%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           |.  |  ||  |.. ||. |.| |||. |||  ||  . .| .|||.|||| | | ... 
Sbjct: 191 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQA 250

Query: 253 AAEMATAKKKQDS 265
             . |  . .|||
Sbjct: 251 KDKAAQQQLQQDS 263

>hg18||uc001wtv |14|D50740|P43699|TITF1_HUMAN|TITF1|NM_003317|NP_003308|thyroid
        transcription factor 1 isoform 2

          Length = 371

 Score =  66 bits (159), Expect = 6e-011
 Identities = 31/73 (42%), Positives = 47/73 (64%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           |.  |  ||  |.. ||. |.| |||. |||  ||  . .| .|||.|||| | | ... 
Sbjct: 161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQA 220

Query: 253 AAEMATAKKKQDS 265
             . |  . .|||
Sbjct: 221 KDKAAQQQLQQDS 233

>hg18||uc003sym
        |7|NM_002141|Q00056|HXA4_HUMAN|HOXA4|NM_002141|NP_002132|homeobox A4

          Length = 320

 Score =  66 bits (159), Expect = 6e-011
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 191 GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           |. | .|  .. ||.  ||| |   .||    |  .|..| ..| |||.|||||| ||.|
Sbjct: 213 GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKK 272

Query: 251 KH 252
            |
Sbjct: 273 DH 274

>hg18||uc001dns
        |1|NM_020063|Q9NY43|BARH2_HUMAN|BARHL2|NM_020063|NP_064447|BarH-like 2

          Length = 387

 Score =  65 bits (158), Expect = 8e-011
 Identities = 29/62 (46%), Positives = 44/62 (70%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           | .  |  ||  |.  ||..||. |||.  .|  || .| .|..||| |.|||||||...
Sbjct: 231 KPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQ 290

Query: 252 HA 253
            |
Sbjct: 291 TA 292

>hg18||uc002inv
        |17|NM_004502|Q96BQ6|Q96BQ6_HUMAN|HOXB7|NM_004502|NP_004493|homeobox
        B7

          Length = 217

 Score =  65 bits (157), Expect = 1e-010
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 2/78 (2%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK-- 250
           ||  | |..  |   ||| |   .||    |  .|..| .|| |.|.|||||| ||.|  
Sbjct: 137 RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN 196

Query: 251 KHAAEMATAKKKQDSETE 268
           | |    | . . ..| |
Sbjct: 197 KTAGPGTTGQDRAEAEEE 214

>hg18||uc002ipv
        |17|NM_138281|Q92988|DLX4_HUMAN|DLX4|NM_138281|NP_612138|distal-less
        homeobox 4 isoform a

          Length = 240

 Score =  65 bits (157), Expect = 1e-010
 Identities = 29/59 (49%), Positives = 44/59 (74%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           | .  |  .|  |.  | . |. |.||| ||||.||  ||.|..|||.||||.|.|..|
Sbjct: 116 KLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK 174

>hg18||uc002ipw
        |17|NM_001934|Q92988-2|Q92988-2|DLX4|NM_001934|NP_001925|distal-less
        homeobox 4 isoform b

          Length = 168

 Score =  65 bits (157), Expect = 1e-010
 Identities = 29/59 (49%), Positives = 44/59 (74%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 250
           | .  |  .|  |.  | . |. |.||| ||||.||  ||.|..|||.||||.|.|..|
Sbjct:  44 KLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK 102

>hg18||uc003skg |7|NM_001080461|NA|NA|UNCX4.1|NM_001080461|NP_001073930|Unc4.1
        homeobox

          Length = 531

 Score =  65 bits (156), Expect = 1e-010
 Identities = 33/81 (40%), Positives = 44/81 (54%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           ||. ||  |.| |.  ||| | .. |     |  ||  | . ||.|.||||||| |||||
Sbjct: 104 KRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKK 163

Query: 252 HAAEMATAKKKQDSETERLKG 272
              .    .   .|      |
Sbjct: 164 ENTKKGPGRPAHNSHPTTCSG 184

>hg18||uc003mcy |5|NM_002449|Q53XM4|Q53XM4_HUMAN|MSX2|NM_002449|NP_002440|msh
        homeobox 2

          Length = 267

 Score =  64 bits (155), Expect = 2e-010
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 187 LDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRT 246
           | |    .  |  |.  |. |||. | | .||.  |||  . || .||.|||.|||||| 
Sbjct: 136 LRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRA 195

Query: 247 KWRKKHAAEMATAK 260
           | ..   ||.   |
Sbjct: 196 KAKRLQEAELEKLK 209

>hg18||uc001urt
        |13|NM_000209|P52945|IPF1_HUMAN|PDX1|NM_000209|NP_000200|pancreatic and
        duodenal homeobox 1

          Length = 283

 Score =  64 bits (153), Expect = 3e-010
 Identities = 27/60 (45%), Positives = 38/60 (63%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           . | ||  ..  |.  ||| |   ||.. | |  ||  | .||  .|.|||||| ||.|.
Sbjct: 145 ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 204

>hg18||uc002ins
        |17|NM_018952|P17509|HXB6_HUMAN|HOXB6|NM_018952|NP_061825|homeobox B6

          Length = 224

 Score =  63 bits (152), Expect = 4e-010
 Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 5/89 (5%)

Query: 183 NSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQ 242
           ||      |.|   | |..  |   ||| |   .||    |  .|..| .|| |.|.|||
Sbjct: 138 NSSSFGPSGRR--GRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQ 195

Query: 243 NRRTKWRKKH---AAEMATAKKKQDSETE 268
           ||| ||.|.    .|   .|..... . |
Sbjct: 196 NRRMKWKKESKLLSASQLSAEEEEEKQAE 224

>hg18||uc003mcm |5|NM_004387|P52952|NKX25_HUMAN|NKX2-5|NM_004387|NP_004378|NK2
        transcription factor related, locus 5

          Length = 324

 Score =  63 bits (152), Expect = 4e-010
 Identities = 28/60 (46%), Positives = 43/60 (71%)

Query: 192 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK 251
           .|.  |  ||  |.. ||. |.| .||. ||| .||  | .| .|||.|||||| | ...
Sbjct: 137 RRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQ 196

>hg18||uc001ser
        |12|NM_022658|P31273|HXC8_HUMAN|HOXC8|NM_022658|NP_073149|homeobox C8

          Length = 242

 Score =  63 bits (151), Expect = 5e-010
 Identities = 29/76 (38%), Positives = 44/76 (57%)

Query: 193 RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKH 252
           |.  | |.|  |   ||| |    ||    |  ....||.|| |||.|||||| ||.|..
Sbjct: 149 RRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 208

Query: 253 AAEMATAKKKQDSETE 268
             .     . ..   |
Sbjct: 209 NKDKLPGARDEEKVEE 224

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0