BLASTP 7.6.0


Query=fugu4_744946 |jgi|Takru4|744946|fgh5_pg.C_scaffold_2306000002
        (250 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002dlo |16|NM_153603|P83436|COG7_HUMAN|COG7|NM_153603|NP...     29   5.549
hg18||uc003wff |7|NM_004911|P13667|PDIA4_HUMAN|PDIA4|NM_004911|N...     29   5.549

>hg18||uc002dlo
        |16|NM_153603|P83436|COG7_HUMAN|COG7|NM_153603|NP_705831|component of
        oligomeric golgi complex 7

          Length = 770

 Score =  29 bits (63), Expect = 5.549
 Identities = 16/43 (37%), Positives = 22/43 (51%)

Query: 178 LEEHGVYIEQLAESVRGTVLYVAADNLGAHSLAGFQESFGADQ 220
           |   | . .|||  .  |     .|.    ||||||||   |.
Sbjct: 479 LRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTDK 521

>hg18||uc003wff
        |7|NM_004911|P13667|PDIA4_HUMAN|PDIA4|NM_004911|NP_004902|protein
        disulfide isomerase-associated 4

          Length = 645

 Score =  29 bits (63), Expect = 5.549
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query:  1 MSNIEGPDQLTEVEEENPLQDDIEGEFESEDDIQ-DLEIQLERNLAAL 47
          ..  ||||.      || ..|. | | | .|. . |||.. |  .  |
Sbjct: 21 VAGAEGPDE-DSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVL 67

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,290,635
Number of Sequences: 45480
Number of Extensions: 191290635
Number of Successful Extensions: 11080124
Number of sequences better than 0.0: 0
BLASTP 7.6.0