BLASTP 7.6.0


Query=fugu4_744881 |jgi|Takru4|744881|fgh5_pg.C_scaffold_2257000004
        (331 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002zpv |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|...     32   0.759
hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8      31   1.691
hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       31   1.691
hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       31   1.691
hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8       31   1.691
hg18||uc002gbl |17|AF098638|Q15276-2|Q15276-2|RABEP1|NM_004703|N...     31   2.208
hg18||uc002gbm |17|NM_004703|Q15276|RABE1_HUMAN|RABEP1|NM_004703...     31   2.208
hg18||uc002jif |17|NM_018672|Q8WWZ7|ABCA5_HUMAN|ABCA5|NM_018672|...     31   2.208
hg18||uc002jig |17|NM_172232|Q8WWZ7|ABCA5_HUMAN|ABCA5|NM_172232|...     31   2.208
hg18||uc002jih |17|AJ512612|Q8WWZ7-2|Q8WWZ7-2|ABCA5|NM_172232|NP...     31   2.208
hg18||uc003kqn |5|NM_022828|Q6ZMY0|Q6ZMY0_HUMAN|YTHDC2|NM_022828...     31   2.208
hg18||uc002tew |2|NM_144710|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_144710|N...     30   2.884
hg18||uc002tex |2|NM_178584|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_178584|N...     30   2.884
hg18||uc002tey |2|BC050345|Q86VP5|Q86VP5_HUMAN|SEPT10|NA|NA|SEPT...     30   2.884
hg18||uc002wbc |2|NM_001008491|Q15019|SEPT2_HUMAN|SEPT2|NM_00100...     30   2.884
hg18||uc002wbd |2|NM_006155|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|N...     30   2.884
hg18||uc002wbf |2|NM_001008492|Q15019|SEPT2_HUMAN|SEPT2|NM_00100...     30   2.884
hg18||uc002wbg |2|NM_004404|Q15019|SEPT2_HUMAN|SEPT2|NM_004404|N...     30   2.884
hg18||uc002wbh |2|BC033559|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP...     30   2.884
hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|...     30   2.884
hg18||uc003xgm |8|AB075870|Q68CJ6|Q68CJ6_HUMAN|HMFN0672|NA|NA|Hy...     30   2.884
hg18||uc002dxy |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|...     30   4.920
hg18||uc002egl |16|AY187246|NA|NA|NOD2|NA|NA|Homo sapiens NOD2 p...     30   4.920
hg18||uc002egm |16|NM_022162|Q9HC29|CAR15_HUMAN|NOD2|NM_022162|N...     30   4.920
hg18||uc002iwk |17|DQ895541|O43236-2|O43236-2|SEPT4|NM_080416|NP...     30   4.920
hg18||uc002iwl |17|AK094579|NA|NA|CE5B3 alpha|NA|NA|Homo sapiens...     30   4.920
hg18||uc002iwm |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|...     30   4.920
hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP...     30   4.920
hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|N...     30   4.920
hg18||uc002iwp |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415...     30   4.920
hg18||uc002dxy |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|...     29   6.425
hg18||uc002iwm |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|...     29   6.425
hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP...     29   6.425
hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|N...     29   6.425
hg18||uc002iwp |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415...     29   6.425
hg18||uc003fdq |3|NM_025047|Q9H655|Q9H655_HUMAN|ARL14|NM_025047|...     29   6.425
hg18||uc003hkj |4|NM_018243|Q9NVA2|SEP11_HUMAN|SEPT11|NM_018243|...     29   6.425
hg18||uc004ers |X|NM_145800|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|...     29   6.425
hg18||uc004ert |X|NM_145802|Q5JTK1|Q5JTK1_HUMAN|SEPT6|NM_145802|...     29   6.425
hg18||uc004eru |X|NM_145799|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145799|...     29   6.425
hg18||uc004erv |X|NM_015129|Q14141|SEPT6_HUMAN|SEPT6|NM_015129|N...     29   6.425
hg18||uc002aom |15|NM_006660|O76031|CLPX_HUMAN|CLPX|NM_006660|NP...     29   8.392
hg18||uc003bbr |22|NM_145733|Q9UH03|SEPT3_HUMAN|SEPT3|NM_145733|...     29   8.392
hg18||uc003bbs |22|NM_019106|Q9UH03-2|Q9UH03-2|SEPT3|NM_019106|N...     29   8.392

>hg18||uc002zpv
        |22|NM_002688|Q99719|SEPT5_HUMAN|SEPT5|NM_002688|NP_002679|septin 5

          Length = 369

 Score =  32 bits (72), Expect = 0.759
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query:  86 EIVEDEQTVSQCE--SQTSDVIVYQIFGFEGGALPYSLTIIDTPGYGDTRRVKR-----D 138
           .. .| . .|  |  ||| ... . .   |   .   |||.||||.||            
Sbjct:  68 DLYKDRKLLSAEERISQTVEILKHTV-DIEEKGVKLKLTIVDTPGFGDAVNNTECWKPIT 126

Query: 139 AIISQRLYDWFRSEDGIH 156
             . |.   .|| | |..
Sbjct: 127 DYVDQQFEQYFRDESGLN 144

>hg18||uc003kxr |5|AF440762|Q92599|SEPT8_HUMAN|SEPT8|NA|NA|Septin-8

          Length = 483

 Score =  31 bits (69), Expect = 1.691
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.| | |
Sbjct: 47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxs |5|AF440761|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 429

 Score =  31 bits (69), Expect = 1.691
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.| | |
Sbjct: 47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxu |5|CR590471|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 442

 Score =  31 bits (69), Expect = 1.691
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.| | |
Sbjct: 47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc003kxv |5|AK057797|Q92599-2|Q92599-2|SEPT8|NA|NA|Septin-8

          Length = 440

 Score =  31 bits (69), Expect = 1.691
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.| | |
Sbjct: 47 ILCVGETGIGKSTLMNTLFN 66

>hg18||uc002gbl
        |17|AF098638|Q15276-2|Q15276-2|RABEP1|NM_004703|NP_004694|rabaptin, RAB
        GTPase binding effector protein 1

          Length = 829

 Score =  31 bits (68), Expect = 2.208
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 265 RFLAEVEPQKLKMTTAVLKEQIRLEACIK-NLQERITFLEMKQSEIHKTREALA 317
           |  |.   .|||     |||||. | |.| ||.| .      | ||   .| .|
Sbjct: 692 RTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETL------QLEIENCKEEIA 739

>hg18||uc002gbm
        |17|NM_004703|Q15276|RABE1_HUMAN|RABEP1|NM_004703|NP_004694|rabaptin,
        RAB GTPase binding effector protein 1

          Length = 862

 Score =  31 bits (68), Expect = 2.208
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 265 RFLAEVEPQKLKMTTAVLKEQIRLEACIK-NLQERITFLEMKQSEIHKTREALA 317
           |  |.   .|||     |||||. | |.| ||.| .      | ||   .| .|
Sbjct: 692 RTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETL------QLEIENCKEEIA 739

>hg18||uc002jif
        |17|NM_018672|Q8WWZ7|ABCA5_HUMAN|ABCA5|NM_018672|NP_061142|ATP-binding
        cassette, sub-family A , member 5

          Length = 1642

 Score =  31 bits (68), Expect = 2.208
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query:  13 KELIH-GGSPKVYQLKPKSKNIGTLKRMTLGEKDANTENKTILLLGETGTGKSTLINAL 70
           || |   |  | |  . | .|.  |. ..        | .   ||| .|||||||.| |
Sbjct: 475 KEAIRISGIQKTY--RKKGENVEALRNLSFD----IYEGQITALLGHSGTGKSTLMNIL 527

>hg18||uc002jig
        |17|NM_172232|Q8WWZ7|ABCA5_HUMAN|ABCA5|NM_172232|NP_758424|ATP-binding
        cassette, sub-family A , member 5

          Length = 1642

 Score =  31 bits (68), Expect = 2.208
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query:  13 KELIH-GGSPKVYQLKPKSKNIGTLKRMTLGEKDANTENKTILLLGETGTGKSTLINAL 70
           || |   |  | |  . | .|.  |. ..        | .   ||| .|||||||.| |
Sbjct: 475 KEAIRISGIQKTY--RKKGENVEALRNLSFD----IYEGQITALLGHSGTGKSTLMNIL 527

>hg18||uc002jih
        |17|AJ512612|Q8WWZ7-2|Q8WWZ7-2|ABCA5|NM_172232|NP_758424|ATP-binding
        cassette, sub-family A , member 5

          Length = 925

 Score =  31 bits (68), Expect = 2.208
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query:  13 KELIH-GGSPKVYQLKPKSKNIGTLKRMTLGEKDANTENKTILLLGETGTGKSTLINAL 70
           || |   |  | |  . | .|.  |. ..        | .   ||| .|||||||.| |
Sbjct: 475 KEAIRISGIQKTY--RKKGENVEALRNLSFD----IYEGQITALLGHSGTGKSTLMNIL 527

>hg18||uc003kqn |5|NM_022828|Q6ZMY0|Q6ZMY0_HUMAN|YTHDC2|NM_022828|NP_073739|YTH
        domain containing 2

          Length = 1430

 Score =  31 bits (68), Expect = 2.208
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query:  49 ENKTILLLGETGTGKSTLI 67
           ||| .|..||||.||.| |
Sbjct: 208 ENKVVLIVGETGSGKTTQI 226

>hg18||uc002tew |2|NM_144710|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_144710|NP_653311|septin
        10 isoform 1

          Length = 454

 Score =  30 bits (67), Expect = 2.884
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| ||||||. | |
Sbjct: 69 ILCVGETGIGKSTLIDTLFN 88

>hg18||uc002tex |2|NM_178584|Q9P0V9-2|Q9P0V9-2|SEPT10|NM_178584|NP_848699|septin
        10 isoform 2

          Length = 431

 Score =  30 bits (67), Expect = 2.884
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| ||||||. | |
Sbjct: 46 ILCVGETGIGKSTLIDTLFN 65

>hg18||uc002tey |2|BC050345|Q86VP5|Q86VP5_HUMAN|SEPT10|NA|NA|SEPT10 protein

          Length = 544

 Score =  30 bits (67), Expect = 2.884
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| ||||||. | |
Sbjct: 69 ILCVGETGIGKSTLIDTLFN 88

>hg18||uc002wbc
        |2|NM_001008491|Q15019|SEPT2_HUMAN|SEPT2|NM_001008491|NP_001008491|sept
        in 2

          Length = 361

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 39 TLMVVGESGLGKSTLINSL 57

>hg18||uc002wbd |2|NM_006155|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP_006146|septin
        2

          Length = 361

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 39 TLMVVGESGLGKSTLINSL 57

>hg18||uc002wbf
        |2|NM_001008492|Q15019|SEPT2_HUMAN|SEPT2|NM_001008492|NP_001008492|sept
        in 2

          Length = 361

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 39 TLMVVGESGLGKSTLINSL 57

>hg18||uc002wbg |2|NM_004404|Q15019|SEPT2_HUMAN|SEPT2|NM_004404|NP_004395|septin
        2

          Length = 361

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 39 TLMVVGESGLGKSTLINSL 57

>hg18||uc002wbh |2|BC033559|Q15019|SEPT2_HUMAN|SEPT2|NM_006155|NP_006146|septin
        2

          Length = 371

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 39 TLMVVGESGLGKSTLINSL 57

>hg18||uc003tex |7|NM_001788|Q309B3|Q309B3_HUMAN|SEPT7|NM_001788|NP_001779|cell
        division cycle 10 isoform 1

          Length = 418

 Score =  30 bits (67), Expect = 2.884
 Identities = 12/19 (63%), Positives = 18/19 (94%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |....||.| |||||||.|
Sbjct: 33 TLMVVGESGLGKSTLINSL 51

>hg18||uc003xgm |8|AB075870|Q68CJ6|Q68CJ6_HUMAN|HMFN0672|NA|NA|Hypothetical
        protein HMFN0672 (Fragment)

          Length = 796

 Score =  30 bits (67), Expect = 2.884
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query:  53 ILLLGETGTGKSTLINALVNYAI 75
           | | | || |||.||||..  |.
Sbjct: 103 IALFGSTGAGKSSLINAIIQQAM 125

>hg18||uc002dxy
        |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|NP_443070|septin 1

          Length = 367

 Score =  30 bits (65), Expect = 4.920
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |... ||.| |||||||.|
Sbjct: 27 TLMVAGESGLGKSTLINSL 45

>hg18||uc002egl |16|AY187246|NA|NA|NOD2|NA|NA|Homo sapiens NOD2 protein (NOD2)
        mRNA, complete cds

          Length = 598

 Score =  30 bits (65), Expect = 4.920
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 47 NTENKTILLLGETGTGKSTLINAL 70
          | .  |.|..|| |.|||||.  |
Sbjct: 67 NDDADTVLVVGEAGSGKSTLLQRL 90

>hg18||uc002egm
        |16|NM_022162|Q9HC29|CAR15_HUMAN|NOD2|NM_022162|NP_071445|nucleotide-bi
        nding oligomerization domain

          Length = 1040

 Score =  30 bits (65), Expect = 4.920
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query:  47 NTENKTILLLGETGTGKSTLINAL 70
           | .  |.|..|| |.|||||.  |
Sbjct: 289 NDDADTVLVVGEAGSGKSTLLQRL 312

>hg18||uc002iwk |17|DQ895541|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 331

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct:  57 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 97

>hg18||uc002iwl |17|AK094579|NA|NA|CE5B3 alpha|NA|NA|Homo sapiens CE5B3 alpha
        mRNA for Bradeion alpha, complete cds

          Length = 331

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct:  57 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 97

>hg18||uc002iwm
        |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|NP_004565|septin 4
        isoform 1

          Length = 478

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct: 204 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 244

>hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 379

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct: 105 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 145

>hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 459

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct: 185 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 225

>hg18||uc002iwp
        |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415|NP_536340|septin 4
        isoform 2

          Length = 274

 Score =  30 bits (65), Expect = 4.920
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 121 LTIIDTPGYGD----TRRVKRDA-IISQRLYDWFRSEDGIH 156
           |||.||||.||    |   |  |  | |.   .|| | |..
Sbjct: 185 LTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLN 225

>hg18||uc002dxy
        |16|NM_052838|Q8WYJ6|SEPT1_HUMAN|SEPT1|NM_052838|NP_443070|septin 1

          Length = 367

 Score =  29 bits (64), Expect = 6.425
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query:  87 IVEDEQTVSQCESQTSDVIVYQIFG--FEGGALPYSLTIIDTPGYGDT 132
           . || | | .  .. .  .  .  |   | | .   ||..||||.||.
Sbjct:  50 LYEDRQ-VPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDS 96

>hg18||uc002iwm
        |17|NM_004574|O43236|SEPT4_HUMAN|SEPT4|NM_004574|NP_004565|septin 4
        isoform 1

          Length = 478

 Score =  29 bits (64), Expect = 6.425
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query:  52 TILLLGETGTGKSTLINAL 70
           |... ||.| |||||.|.|
Sbjct: 146 TLMVAGESGLGKSTLVNSL 164

>hg18||uc002iwn |17|CR597931|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 379

 Score =  29 bits (64), Expect = 6.425
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 52 TILLLGETGTGKSTLINAL 70
          |... ||.| |||||.|.|
Sbjct: 47 TLMVAGESGLGKSTLVNSL 65

>hg18||uc002iwo |17|NM_080416|O43236-2|O43236-2|SEPT4|NM_080416|NP_536341|septin
        4 isoform 3

          Length = 459

 Score =  29 bits (64), Expect = 6.425
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query:  52 TILLLGETGTGKSTLINAL 70
           |... ||.| |||||.|.|
Sbjct: 127 TLMVAGESGLGKSTLVNSL 145

>hg18||uc002iwp
        |17|NM_080415|Q9H315|Q9H315_HUMAN|SEPT4|NM_080415|NP_536340|septin 4
        isoform 2

          Length = 274

 Score =  29 bits (64), Expect = 6.425
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query:  52 TILLLGETGTGKSTLINAL 70
           |... ||.| |||||.|.|
Sbjct: 127 TLMVAGESGLGKSTLVNSL 145

>hg18||uc003fdq
        |3|NM_025047|Q9H655|Q9H655_HUMAN|ARL14|NM_025047|NP_079323|ADP-ribosyla
        tion factor 7

          Length = 192

 Score =  29 bits (64), Expect = 6.425
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 40 TLGEKDANTENKTILLLGETGTGKSTLINAL 70
          .|| |.  |.   .||||    |||||.  |
Sbjct:  3 SLGSKNPQTKQAQVLLLGLDSAGKSTLLYKL 33

>hg18||uc003hkj
        |4|NM_018243|Q9NVA2|SEP11_HUMAN|SEPT11|NM_018243|NP_060713|septin 11

          Length = 429

 Score =  29 bits (64), Expect = 6.425
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.. | |
Sbjct: 44 ILCVGETGIGKSTLMDTLFN 63

>hg18||uc004ers
        |X|NM_145800|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145800|NP_665799|septin 6
        isoform A

          Length = 427

 Score =  29 bits (64), Expect = 6.425
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.. | |
Sbjct: 45 ILCVGETGLGKSTLMDTLFN 64

>hg18||uc004ert
        |X|NM_145802|Q5JTK1|Q5JTK1_HUMAN|SEPT6|NM_145802|NP_665801|septin 6
        isoform D

          Length = 429

 Score =  29 bits (64), Expect = 6.425
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.. | |
Sbjct: 45 ILCVGETGLGKSTLMDTLFN 64

>hg18||uc004eru
        |X|NM_145799|Q5JTK3|Q5JTK3_HUMAN|SEPT6|NM_145799|NP_665798|septin 6
        isoform A

          Length = 427

 Score =  29 bits (64), Expect = 6.425
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.. | |
Sbjct: 45 ILCVGETGLGKSTLMDTLFN 64

>hg18||uc004erv |X|NM_015129|Q14141|SEPT6_HUMAN|SEPT6|NM_015129|NP_055944|septin
        6 isoform B

          Length = 434

 Score =  29 bits (64), Expect = 6.425
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 53 ILLLGETGTGKSTLINALVN 72
          || .|||| |||||.. | |
Sbjct: 45 ILCVGETGLGKSTLMDTLFN 64

>hg18||uc002aom |15|NM_006660|O76031|CLPX_HUMAN|CLPX|NM_006660|NP_006651|ClpX
        caseinolytic protease X homolog

          Length = 633

 Score =  29 bits (63), Expect = 8.392
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query:  22 KVYQLKPKSKNIGTLKRMTLGEKDANTENKTILLLGETGTGKSTLINAL 70
           .| |  |. |  | .  .     |   |   ||||| ||.||. |   |
Sbjct: 260 QVNQQIPQEKRGGEV--LDSSHDDIKLEKSNILLLGPTGSGKTLLAQTL 306

>hg18||uc003bbr
        |22|NM_145733|Q9UH03|SEPT3_HUMAN|SEPT3|NM_145733|NP_663786|septin 3
        isoform A

          Length = 345

 Score =  29 bits (63), Expect = 8.392
 Identities = 11/19 (57%), Positives = 14/19 (73%)

Query: 113 EGGALPYSLTIIDTPGYGD 131
           | | .   ||.|||||.||
Sbjct: 100 EEGGVKMKLTVIDTPGFGD 118

>hg18||uc003bbs |22|NM_019106|Q9UH03-2|Q9UH03-2|SEPT3|NM_019106|NP_061979|septin
        3 isoform B

          Length = 337

 Score =  29 bits (63), Expect = 8.392
 Identities = 11/19 (57%), Positives = 14/19 (73%)

Query: 113 EGGALPYSLTIIDTPGYGD 131
           | | .   ||.|||||.||
Sbjct: 100 EEGGVKMKLTVIDTPGFGD 118

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,829,679
Number of Sequences: 45480
Number of Extensions: 192829679
Number of Successful Extensions: 11009187
Number of sequences better than 0.0: 0
BLASTP 7.6.0