BLASTP 7.6.0


Query=fugu4_744633 |jgi|Takru4|744633|fgh5_pg.C_scaffold_2146000001
        (733 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004axg |9|CR749320|Q68DP5|Q68DP5_HUMAN|KIAA1529|NM_02089...     61   4e-009
hg18||uc004axe |9|NM_020893|Q5VV25|Q5VV25_HUMAN|KIAA1529|NM_0208...     52   3e-006
hg18||uc004axe |9|NM_020893|Q5VV25|Q5VV25_HUMAN|KIAA1529|NM_0208...     35   0.241
hg18||uc004axf |9|BC047097|Q86Y65|Q86Y65_HUMAN|KIAA1529|NM_02089...     35   0.241
hg18||uc004axg |9|CR749320|Q68DP5|Q68DP5_HUMAN|KIAA1529|NM_02089...     35   0.241
hg18||uc002mrz |19|NM_138783|Q96CK0|ZN653_HUMAN|ZNF653|NM_138783...     35   0.315
hg18||uc001hqr |1|NM_003607|Q5VT25-5|Q5VT25-5|CDC42BPA|NM_003607...     31   5.945
hg18||uc001hqs |1|NM_014826|Q5VT25-3|Q5VT25-3|CDC42BPA|NM_014826...     31   5.945
hg18||uc002axa |15|NM_001038640|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001...     30   7.765
hg18||uc002azs |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_0010386...     30   7.765
hg18||uc002azv |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_0010386...     30   7.765

>hg18||uc004axg
        |9|CR749320|Q68DP5|Q68DP5_HUMAN|KIAA1529|NM_020893|NP_065944|hypothetic
        al protein LOC57653

          Length = 1701

 Score =  61 bits (147), Expect = 4e-009
 Identities = 36/142 (25%), Positives = 73/142 (51%)

Query:  197 TFTHRLDSFSSTLQERLDTHMKHTQDCQSSCCHMVQLRLEEIGANVTQHLSSFRFFSEGG 256
            | . .| . |.|| . | ...  ||    |    ..  | ..  .  . .   | |||||
Sbjct:  992 TRSQKLVTLSNTLHQELLSYVDVTQVSLRSFRQYLEESLGKLRYSNIEFIKHCRLFSEGG 1051

Query:  257 NFAPQEVKVFQRRLTEEIKMLTVSEENIYREQEEFQLTSFQQVKEVADRLQEKINLLKPE 316
            ||.|.|.     || .|   . . |  |    |. .     |  .| .. . | . |  .
Sbjct: 1052 NFSPKEINSLCSRLEKEAARIELVESVIMLNMEKLENEYLDQANDVINKFESKFHNLSVD 1111

Query:  317 VKLREKVQKMMRTTQLLLKTEV 338
            .   ||.|...   |. .| .|
Sbjct: 1112 LIFIEKIQRLLTNLQVKIKCQV 1133

>hg18||uc004axe
        |9|NM_020893|Q5VV25|Q5VV25_HUMAN|KIAA1529|NM_020893|NP_065944|hypotheti
        cal protein LOC57653

          Length = 1646

 Score =  52 bits (122), Expect = 3e-006
 Identities = 25/89 (28%), Positives = 48/89 (53%)

Query:  250 RFFSEGGNFAPQEVKVFQRRLTEEIKMLTVSEENIYREQEEFQLTSFQQVKEVADRLQEK 309
            . |||||||.|.|.     || .|   . . |  |    |. .     |  .| .. . |
Sbjct: 1016 QLFSEGGNFSPKEINSLCSRLEKEAARIELVESVIMLNMEKLENEYLDQANDVINKFESK 1075

Query:  310 INLLKPEVKLREKVQKMMRTTQLLLKTEV 338
             . |  ..   ||.|...   |. .| .|
Sbjct: 1076 FHNLSVDLIFIEKIQRLLTNLQVKIKCQV 1104

>hg18||uc004axe
        |9|NM_020893|Q5VV25|Q5VV25_HUMAN|KIAA1529|NM_020893|NP_065944|hypotheti
        cal protein LOC57653

          Length = 1646

 Score =  35 bits (80), Expect = 0.241
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query:  41 MMNGFILGNRRSVAHLMLLLQEDTLHLESLLRLNWEECVSHWR 83
           .||  .||||...| | . | | ||  |   |  |.  |  |.
Sbjct: 449 VMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWK 491

>hg18||uc004axf
        |9|BC047097|Q86Y65|Q86Y65_HUMAN|KIAA1529|NM_020893|NP_065944|hypothetic
        al protein LOC57653

          Length = 877

 Score =  35 bits (80), Expect = 0.241
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query:  41 MMNGFILGNRRSVAHLMLLLQEDTLHLESLLRLNWEECVSHWR 83
           .||  .||||...| | . | | ||  |   |  |.  |  |.
Sbjct: 310 VMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWK 352

>hg18||uc004axg
        |9|CR749320|Q68DP5|Q68DP5_HUMAN|KIAA1529|NM_020893|NP_065944|hypothetic
        al protein LOC57653

          Length = 1701

 Score =  35 bits (80), Expect = 0.241
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query:  41 MMNGFILGNRRSVAHLMLLLQEDTLHLESLLRLNWEECVSHWR 83
           .||  .||||...| | . | | ||  |   |  |.  |  |.
Sbjct: 310 VMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWK 352

>hg18||uc002mrz |19|NM_138783|Q96CK0|ZN653_HUMAN|ZNF653|NM_138783|NP_620138|zinc
        finger protein 653

          Length = 615

 Score =  35 bits (79), Expect = 0.315
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 314 KPEVKLREKVQKMMRTTQLLLKTEVPVDISNQQYSLIS--RRLVSLKMMMADSQVCPHQV 371
           .|| . | |  ..|    ||     | .  .| |  .|  .  |.|      ..||||  
Sbjct: 445 EPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQVYVALSSFQNHVNLVHRKGKTKVCPHPG 504

Query: 372 SSHALAVSNHLRKY 385
                 .|||||..
Sbjct: 505 CGKKFYLSNHLRRH 518

>hg18||uc001hqr
        |1|NM_003607|Q5VT25-5|Q5VT25-5|CDC42BPA|NM_003607|NP_003598|CDC42-bindi
        ng protein kinase alpha isoform B

          Length = 1719

 Score =  31 bits (68), Expect = 5.945
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 498 KRREELEHLVCSLDELLRSLPSVMI-------SIHEQQQCTKLKEDVDRVRFKLEETL 548
           | ||. ||    |.  |  |    |       ||  ||. |||| |...     || |
Sbjct: 647 KLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEEL 704

>hg18||uc001hqs
        |1|NM_014826|Q5VT25-3|Q5VT25-3|CDC42BPA|NM_014826|NP_055641|CDC42-bindi
        ng protein kinase alpha isoform A

          Length = 1638

 Score =  31 bits (68), Expect = 5.945
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 498 KRREELEHLVCSLDELLRSLPSVMI-------SIHEQQQCTKLKEDVDRVRFKLEETL 548
           | ||. ||    |.  |  |    |       ||  ||. |||| |...     || |
Sbjct: 566 KLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEEL 623

>hg18||uc002axa
        |15|NM_001038640|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|go
        lgi autoantigen, golgin subfamily a, 6

          Length = 693

 Score =  30 bits (67), Expect = 7.765
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 270 LTEEIKMLTVSEENIYREQEEFQLTSFQQVKEVADRLQEKINLLKPE-VKLREKVQKMMR 328
           |..| |     .| . ||||  ..   ... |  .||.|.   |. .  .||.. |.. .
Sbjct: 331 LSKEQKQRLQEQEEMLREQEAQRVREQERLCEQNERLREQQKTLQEQGERLRKQEQRLRK 390

Query: 329 TTQLLLKTE 337
             . | | |
Sbjct: 391 QEERLRKEE 399

>hg18||uc002azs
        |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|golgi
        autoantigen, golgin subfamily a, 6

          Length = 681

 Score =  30 bits (67), Expect = 7.765
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 270 LTEEIKMLTVSEENIYREQEEFQLTSFQQVKEVADRLQEKINLLKPE-VKLREKVQKMMR 328
           |..| |     .| . ||||  ..   ... |  .||.|.   |. .  .||.. |.. .
Sbjct: 319 LSKEQKQRLQEQEEMLREQEAQRVREQERLCEQNERLREQQKTLQEQGERLRKQEQRLRK 378

Query: 329 TTQLLLKTE 337
             . | | |
Sbjct: 379 QEERLRKEE 387

>hg18||uc002azv
        |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|golgi
        autoantigen, golgin subfamily a, 6

          Length = 681

 Score =  30 bits (67), Expect = 7.765
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 270 LTEEIKMLTVSEENIYREQEEFQLTSFQQVKEVADRLQEKINLLKPE-VKLREKVQKMMR 328
           |..| |     .| . ||||  ..   ... |  .||.|.   |. .  .||.. |.. .
Sbjct: 319 LSKEQKQRLQEQEEMLREQEAQRVREQERLCEQNERLREQQKTLQEQGERLRKQEQRLRK 378

Query: 329 TTQLLLKTE 337
             . | | |
Sbjct: 379 QEERLRKEE 387

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0