BLASTP 7.6.0


Query=fugu4_744446 |jgi|Takru4|744446|fgh5_pg.C_scaffold_2070000002
        (191 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003uys |7|BC066592|P39880-3|P39880-3|CUTL1|NM_181552|NP_...     28   5.952
hg18||uc003uyt |7|NM_001913|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP...     28   5.952
hg18||uc003uyu |7|NM_181500|Q13948|CASP_HUMAN|CUTL1|NM_181500|NP...     28   5.952
hg18||uc003uyv |7|AK125097|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_...     28   5.952
hg18||uc003uyw |7|AK122726|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_...     28   5.952

>hg18||uc003uys |7|BC066592|P39880-3|P39880-3|CUTL1|NM_181552|NP_853530|CCAAT
        displacement protein isoform a

          Length = 1516

 Score =  28 bits (61), Expect = 5.952
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query:  74 DMRQTSKRLDTTSDPIARGKLWLEQSRKGAVERVTQFR 111
           |..|  . || |.  .|  .   |||||  .|.  .|.
Sbjct:  16 DLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFK 53

>hg18||uc003uyt |7|NM_001913|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 678

 Score =  28 bits (61), Expect = 5.952
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query:  74 DMRQTSKRLDTTSDPIARGKLWLEQSRKGAVERVTQFR 111
           |..|  . || |.  .|  .   |||||  .|.  .|.
Sbjct:  16 DLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFK 53

>hg18||uc003uyu |7|NM_181500|Q13948|CASP_HUMAN|CUTL1|NM_181500|NP_852477|CCAAT
        displacement protein isoform c

          Length = 676

 Score =  28 bits (61), Expect = 5.952
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query:  74 DMRQTSKRLDTTSDPIARGKLWLEQSRKGAVERVTQFR 111
           |..|  . || |.  .|  .   |||||  .|.  .|.
Sbjct:  16 DLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFK 53

>hg18||uc003uyv |7|AK125097|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 662

 Score =  28 bits (61), Expect = 5.952
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query:  74 DMRQTSKRLDTTSDPIARGKLWLEQSRKGAVERVTQFR 111
           |..|  . || |.  .|  .   |||||  .|.  .|.
Sbjct:  16 DLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFK 53

>hg18||uc003uyw |7|AK122726|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 632

 Score =  28 bits (61), Expect = 5.952
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query:  74 DMRQTSKRLDTTSDPIARGKLWLEQSRKGAVERVTQFR 111
           |..|  . || |.  .|  .   |||||  .|.  .|.
Sbjct:  16 DLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFK 53

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0