BLASTP 7.6.0


Query=fugu4_744428 |jgi|Takru4|744428|fgh5_pg.C_scaffold_2066000003
        (1585 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|N...    411   4e-114
hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|N...    303   2e-081
hg18||uc001azt |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|N...     84   1e-015
hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_...     82   7e-015
hg18||uc002gmp |17|NM_017534|Q86T56|Q86T56_HUMAN|MYH2|NM_017534|...     82   7e-015
hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP...     76   4e-013
hg18||uc003hfp |4|AF112221|Q7L099-2|Q7L099-2|RUFY3|NM_014961|NP_...     75   6e-013
hg18||uc003hfq |4|NM_014961|Q7L099|RUFY3_HUMAN|RUFY3|NM_014961|N...     75   6e-013
hg18||uc003hfr |4|NM_001037442|NA|NA|RUFY3|NM_001037442|NP_00103...     75   6e-013
hg18||uc002aeg |15|NM_032866|Q7Z2L3|Q7Z2L3_HUMAN|CGNL1|NM_032866...     74   2e-012
hg18||uc003upw |7|NR_002147|Q9H6N6|Q9H6N6_HUMAN|MYH16|NA|NA|CDNA...     72   5e-012
hg18||uc003mka |5|NM_025158|Q96T51|RUFY1_HUMAN|RUFY1|NM_025158|N...     72   7e-012
hg18||uc003mkb |5|NM_001040452|Q96T51-2|Q96T51-2|RUFY1|NM_001040...     72   7e-012
hg18||uc003mkc |5|NM_001040451|Q96T51-2|Q96T51-2|RUFY1|NM_001040...     72   7e-012
hg18||uc002ysw |21|NM_001001132|Q15811-2|Q15811-2|ITSN1|NM_00100...     69   4e-011
hg18||uc002ysx |21|DQ679756|Q0PW95|Q0PW95_HUMAN|ITSN1|NM_0010011...     69   4e-011
hg18||uc002ysy |21|DQ679757|Q0PW94|Q0PW94_HUMAN|ITSN1|NM_0010011...     69   4e-011
hg18||uc002ysz |21|DQ679754|Q1ED40|Q1ED40_HUMAN|ITSN1|NM_0010011...     69   4e-011
hg18||uc002yta |21|NM_003024|Q15811|ITSN1_HUMAN|ITSN1|NM_003024|...     69   4e-011
hg18||uc002ytb |21|BC116185|Q14BD4|Q14BD4_HUMAN|ITSN1|NM_003024|...     69   4e-011
hg18||uc002ytc |21|DQ386455|Q20BK3|Q20BK3_HUMAN|ITSN1|NA|NA|Inte...     69   4e-011
hg18||uc002yte |21|DQ679755|Q0PW96|Q0PW96_HUMAN|ITSN1|NM_0010011...     69   4e-011
hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP...     69   4e-011
hg18||uc002tec |2|NM_181453|Q8IWJ2-2|Q8IWJ2-2|GCC2|NM_181453|NP_...     67   1e-010
hg18||uc002ted |2|NM_014635|Q8IWJ2|GCC2_HUMAN|GCC2|NM_014635|NP_...     67   1e-010
hg18||uc003dhr |3|NM_015576|O15083|ERC2_HUMAN|ERC2|NM_015576|NP_...     67   1e-010
hg18||uc001fec |1|NM_152263|Q5VU71|Q5VU71_HUMAN|TPM3|NM_152263|N...     66   4e-010
hg18||uc001eyj |1|NM_020770|Q9P2M7|CING_HUMAN|CGN|NM_020770|NP_0...     65   9e-010
hg18||uc001fea |1|NM_153649|P06753-2|P06753-2|TPM3|NM_153649|NP_...     62   4e-009
hg18||uc001fed |1|AF474157|Q8TCG3|Q8TCG3_HUMAN|TPM3|NM_153649|NP...     62   4e-009
hg18||uc001feb |1|NM_001043352|P06753-3|P06753-3|TPM3|NM_0010433...     62   6e-009
hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1...     62   6e-009
hg18||uc002ddv |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001...     62   7e-009
hg18||uc002ddw |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844...     62   7e-009
hg18||uc002ddx |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001...     62   7e-009
hg18||uc002ddy |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|...     62   7e-009
hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|N...     61   1e-008
hg18||uc001ucg |12|BC126305|A0AVD3|A0AVD3_HUMAN|CLIP1|NM_002956|...     60   3e-008
hg18||uc001uch |12|NM_002956|P30622|RSN_HUMAN|CLIP1|NM_002956|NP...     60   3e-008
hg18||uc001uci |12|NM_198240|P30622-2|P30622-2|CLIP1|NM_198240|N...     60   3e-008
hg18||uc001ucj |12|AB209115|Q59GJ4|Q59GJ4_HUMAN|CLIP1|NM_002956|...     60   3e-008
hg18||uc001qiz |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP...     59   6e-008
hg18||uc001qjd |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP...     59   6e-008
hg18||uc003cgv |3|NM_002078|Q13439|GOGA4_HUMAN|GOLGA4|NM_002078|...     58   8e-008
hg18||uc003cgw |3|AB209693|Q13439-4|Q13439-4|GOLGA4|NM_002078|NP...     58   8e-008
hg18||uc003cgx |3|U31906|Q13439-4|Q13439-4|GOLGA4|NM_002078|NP_0...     58   8e-008
hg18||uc003lzg |5|NM_012485|Q2VPE6|Q2VPE6_HUMAN|HMMR|NM_012485|N...     58   8e-008
hg18||uc003okk |6|NM_022047|Q9H4E7|Q9H4E7_HUMAN|DEF6|NM_022047|N...     58   8e-008
hg18||uc001azt |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|N...     57   1e-007
hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_...     57   1e-007
hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP...     57   2e-007
hg18||uc003lzf |5|NM_012484|O75330|HMMR_HUMAN|HMMR|NM_012484|NP_...     56   3e-007
hg18||uc003lzh |5|BC108904|O75330|HMMR_HUMAN|HMMR|NM_012484|NP_0...     56   4e-007
hg18||uc001qjb |12|NM_178040|Q8IUD2|RB6I2_HUMAN|ERC1|NM_178040|N...     55   5e-007
hg18||uc001qjc |12|NM_178039|Q8IUD2-3|Q8IUD2-3|ERC1|NM_178039|NP...     55   5e-007
hg18||uc001qja |12|NM_015064|Q8IUD2-4|Q8IUD2-4|ERC1|NM_015064|NP...     55   7e-007
hg18||uc002vth |2|BX538172|Q6Y7W6|PERQ2_HUMAN|TNRC15|NM_015575|N...     55   7e-007
hg18||uc002vti |2|NM_015575|Q6Y7W6|PERQ2_HUMAN|TNRC15|NM_015575|...     55   7e-007
hg18||uc002vtj |2|AB014542|Q6Y7W6-3|Q6Y7W6-3|TNRC15|NM_015575|NP...     55   7e-007
hg18||uc002vtk |2|BX537885|Q6Y7W6|PERQ2_HUMAN|TNRC15|NM_015575|N...     55   7e-007
hg18||uc002vtq |2|BX647172|NA|NA|TNRC15|NM_015575|NP_056390|trin...     55   7e-007
hg18||uc001ucg |12|BC126305|A0AVD3|A0AVD3_HUMAN|CLIP1|NM_002956|...     55   9e-007
hg18||uc001uch |12|NM_002956|P30622|RSN_HUMAN|CLIP1|NM_002956|NP...     55   9e-007
hg18||uc001uci |12|NM_198240|P30622-2|P30622-2|CLIP1|NM_198240|N...     55   9e-007
hg18||uc002adr |15|NM_018365|Q9NUP4|Q9NUP4_HUMAN|MNS1|NM_018365|...     55   9e-007
hg18||uc003vnu |7|AK124447|Q6ZVK7|Q6ZVK7_HUMAN|KIAA1793|NA|NA|CD...     55   9e-007
hg18||uc002igj |17|U93871|O15483|O15483_HUMAN|RPIP8|NM_006695|NP...     52   4e-006
hg18||uc001ukz |12|NM_005895|Q08378|GOGA3_HUMAN|GOLGA3|NM_005895...     52   8e-006
hg18||uc001ula |12|AB027133|Q08378-2|Q08378-2|GOLGA3|NM_005895|N...     52   8e-006
hg18||uc003eei |3|NM_004487|Q14789|GOGB1_HUMAN|GOLGB1|NM_004487|...     52   8e-006
hg18||uc003eej |3|D25542|NA|NA|GOLGB1|NA|NA|Homo sapiens cDNA cl...     52   8e-006
hg18||uc001hkm |1|NM_016343|Q5VVM7|Q5VVM7_HUMAN|CENPF|NM_016343|...     51   1e-005
hg18||uc002igk |17|CR622819|O15483|O15483_HUMAN|RPIP8|NM_006695|...     50   3e-005
hg18||uc002gli |17|NM_001025579|Q9GZM8-2|Q9GZM8-2|NDEL1|NM_00102...     49   5e-005
hg18||uc002glj |17|NM_030808|Q9GZM8|NDEL1_HUMAN|NDEL1|NM_030808|...     49   5e-005
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...     48   8e-005
hg18||uc002xcn |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_0010...     48   8e-005
hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP...     47   1e-004
hg18||uc002igi |17|NM_006695|O60651|O60651_HUMAN|RPIP8|NM_006695...     47   1e-004
hg18||uc002igl |17|AB209802|Q59EK9|Q59EK9_HUMAN|RPIP8|NA|NA|RaP2...     47   1e-004
hg18||uc002gll |17|NM_005964|Q149N4|Q149N4_HUMAN|MYH10|NM_005964...     46   3e-004
hg18||uc002glm |17|AB210026|Q4LE45|Q4LE45_HUMAN|MYH10|NM_005964|...     46   3e-004
hg18||uc003ahn |22|NM_001017437|Q569K6|Q569K6_HUMAN|LOC550631|NM...     46   3e-004
hg18||uc002gjp |17|NM_001037144|Q8N137-2|Q8N137-2|CNTROB|NM_0010...     45   5e-004
hg18||uc002gjq |17|NM_053051|Q8N137|CNTRB_HUMAN|CNTROB|NM_053051...     45   5e-004
hg18||uc002gjr |17|BC014055|Q8N137-3|Q8N137-3|CNTROB|NM_053051|N...     45   5e-004
hg18||uc003cgp |3|NM_006309|Q9Y608|LRRF2_HUMAN|LRRFIP2|NM_006309...     45   5e-004
hg18||uc001efq |1|AF273043|Q5VXJ5|Q5VXJ5_HUMAN|SYCP1|NM_003176|N...     45   7e-004
hg18||uc001efr |1|NM_003176|Q5VT04|Q5VT04_HUMAN|SYCP1|NM_003176|...     45   7e-004
hg18||uc001ezp |1|BC131827|NA|NA|BC131827|NA|NA|Homo sapiens cDN...     45   7e-004
hg18||uc001eyk |1|BX647343|NA|NA|KIAA1319|NA|NA|Homo sapiens mRN...     45   9e-004
hg18||uc002vcw |2|BC125053|Q08AR7|Q08AR7_HUMAN|PIP5K3|NM_152671|...     45   9e-004
hg18||uc002vcy |2|AK127769|NA|NA|PIP5K3|NM_015040|NP_055855|phos...     45   9e-004
hg18||uc002vcz |2|NM_015040|Q9Y2I7|FYV1_HUMAN|PIP5K3|NM_015040|N...     45   9e-004
hg18||uc003cgq |3|NM_017724|Q9Y608-2|Q9Y608-2|LRRFIP2|NM_017724|...     45   9e-004
hg18||uc003cgt |3|BC053668|Q9Y608-2|Q9Y608-2|LRRFIP2|NM_017724|N...     45   9e-004
hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1...     45   9e-004
hg18||uc003bgc |22|NM_148674|Q8NDV3|SMC1B_HUMAN|SMC1B|NM_148674|...     43   0.004
hg18||uc003bgd |22|BC126208|A0AV46|A0AV46_HUMAN|SMC1B|NM_148674|...     43   0.004
hg18||uc003bge |22|AJ504806|NA|NA|SMC1B|NM_148674|NP_683515|SMC1...     43   0.004

>hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|NP_078789|FYVE
        and coiled-coil domain containing 1

          Length = 1478

 Score =  411 bits (1056), Expect = 4e-114
 Identities = 263/828 (31%), Positives = 446/828 (53%), Gaps = 26/828 (3%)

Query:  621 RIEATNMCVEDRERKLLDDNLHLEEILQKTLVEKEAFECQIKKLEHANRXXXXXXXXXXX 680
            ... | .    .| .|   |  ||. ||  .   .  | ... |.   .           
Sbjct:  599 QLDDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQG 658

Query:  681 XXXXXXXXXDSLTAKIVLLDKNLTVSQRSQAELLEKIQEAEAKLCDQTFERGLLQARVDE 740
                      |.      .. .|   ....  .  .. | || |  .  |   |.  |..
Sbjct:  659 SLASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQ 718

Query:  741 LERRSVDMHDEKGAAESNEKMQKP-----DTERG----SPPM--ESKETPFRLVIAEAQL 789
             .. .   | |  | ||  . |         |.|     ||   |..|   .| ...|||
Sbjct:  719 CQQLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQL 778

Query:  790 ELNXXXXXXXXXXXXXXXAQLLAGNEERMKVQALQEVTESSREDLRVLTEQLKAQVEDLN 849
            |..               |.. |  ... |||.   . |.   . . | .||| | | ||
Sbjct:  779 EVHQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALN 838

Query:  850 RRHVDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSR 909
            | || |.|.  ||| ||  ||  ||| |     |.   .|. .. |   .   ||... .
Sbjct:  839 RAHVQELLQCSEREGALQEERADEAQQR---EEELRALQEELSQAKCSSEEAQLEHAELQ 895

Query:  910 EALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLR 969
            | ||||||. ||||. || || | |            |.. || |.|. |  .  .  |.
Sbjct:  896 EQLHRANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQ 955

Query:  970 QENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHR 1029
            || . |  ...  .    .   || .| . .. |....| .  |. .|  ||| | . ..
Sbjct:  956 QEKESLQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQ 1015

Query: 1030 SQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQ 1089
            |.|.   .| . .  .|  .  ..   |  .....       ...   .  .|| .  . 
Sbjct: 1016 SRLKNAGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSNHLAECQAAML 1075

Query: 1090 QKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKI 1149
            .|..|   |. .| |.. .|  |    ||  . | .   ...  | .  |.|||| ||| 
Sbjct: 1076 RKDKEGAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKK 1135

Query: 1150 NLEERLVELIREKDALWQKNDALEFEQKLRDEET---ERDVNHCVGCHTQFSWWLRKYNC 1206
             |||||.||.|.|||||||.|||||.|||  ||    . . |||. |  .||| .|...|
Sbjct: 1136 YLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHC 1195

Query: 1207 RLCGRPFCYYCCSNNVSTQPGGSRERCCVHCYNQHSAVVERHPQEEVSNSAPGTPFSRLL 1266
            |.||| ||||||.| | .. || .||||  |. |  .     |    | .. | |   | 
Sbjct: 1196 RICGRIFCYYCCNNYVLSKHGGKKERCCRACF-QKLSEGPGSPDSSGSGTSQGEPSPALS 1254

Query: 1267 HAGRALTTAPGAEGVD----KLDDGIFDIITEEEVSGVYDSDSLSFSTACSPGHGQQGAA 1322
             |      | | .| .      || .|||||.||.  . .| |    |          ||
Sbjct: 1255 PASPG-PQATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAA 1313

Query: 1323 QLSNSASTGDIASEDVEDVSAAVQDAEIYLLKSGELTLDVHFTVDDISGFEDSCRDLFIK 1382
            .   ....  .  || ||.    ||.|| ||||||| . |  |||.|. | .  |.||..
Sbjct: 1314 EQDTTSTS--LTPEDTEDMPVG-QDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVR 1370

Query: 1383 SSCYSTISIIMKAPGPTVTWTFTSEPKSISFSVVYRESTDTPLEQAKV 1430
            || || | | .     |..| |.|.|||||||||..|. ||||.| ||
Sbjct: 1371 SSTYSLIPITVPEAALTISWVFSSDPKSISFSVVFQEAEDTPLDQCKV 1418

>hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|NP_078789|FYVE
        and coiled-coil domain containing 1

          Length = 1478

 Score =  303 bits (774), Expect = 2e-081
 Identities = 149/211 (70%), Positives = 175/211 (82%), Gaps = 3/211 (1%)

Query:  45 NAVFELSKEYQECGEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCL 104
           .|| |||||.|| ||||.||| .|||| .||||||||||||| | || .|||||||| ||
Sbjct:  19 DAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEKATLLGNKKDYWDYFCACL 78

Query: 105 IKIKGANDGIRFVKSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDR 164
            |.||||||||||||| ||.|||||||||||||||||||||||||| .| ||||.|.| |
Sbjct:  79 AKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYAR 138

Query: 165 SPFLKSHLTADIINNLYELNQIHFDVAARGYDLDADWPKFARRTIST-PSAFLWKPPSRC 223
           ||||.  |..||.  |||| .. ||.|.||.|||| || |||||..|  ||.||||||| 
Sbjct: 139 SPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFARRTLTTGSSAYLWKPPSRS 198

Query: 224 SSINSLVSSYSHLQPQEGFPVSDLSHSLLGE 254
           ||..||||||  || ||     ||.  |  |
Sbjct: 199 SSMSSLVSSY--LQTQEMVSNFDLNSPLNNE 227

>hg18||uc001azt
        |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 2017

 Score =  84 bits (206), Expect = 1e-015
 Identities = 130/570 (22%), Positives = 220/570 (38%), Gaps = 71/570 (12%)

Query:  653 EKEAFECQIKKLEHANRXXXXXXXXXXXXXXXXXXXXDSLTAKIVLLDKNLTVSQRSQAE 712
            | |    |...||                        | | |.   . . || ..  . |
Sbjct:  660 ELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVE 719

Query:  713 L---LEKIQEAEAKLCD-----QTFERGLLQARVDELERRSVDMHDEKGAAESNEKMQKP 764
            |   . |..  || | |           | | ..| | |    . .|| | .  ..  . 
Sbjct:  720 LELSMTKLRAEEASLQDSLSKLSALNESLAQDKLD-LNRLVAQLEEEKSALQGRQRQAEQ 778

Query:  765 DTERGSPPMESKETPFRLVIAEAQLELNXXXXXXXXXXXXXXXAQLLAGNEERMKVQALQ 824
            .        |  |        | .||                 ||         ..  |.
Sbjct:  779 EATVAREEQERLE--------ELRLEQEVARQGLEGSLRVAEQAQ----EALEQQLPTLR 826

Query:  825 EVTESSREDLRVLTEQLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAGLATEV 884
                  .| |  |. ||  . ..| .    |  |  |  |   ||..  |.  |||| ..
Sbjct:  827 HERSQLQEQLAQLSRQLSGREQELEQAR-REAQRQVEALERAAREKEALAKEHAGLAVQL 885

Query:  885 TTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLT 944
                 .   |      | ||      .|     ..|.|      | || .   |  | ||
Sbjct:  886 VAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLT 945

Query:  945 TRLEELK-------EEAARDVESQKAYIEQLRQENQQLLHE-----VQNKERLLEAKE-- 990
              |  |.       |.|. | |     . |  .| |  | |      .. .||   ||  
Sbjct:  946 GELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAA 1005

Query:  991 ---------ELQVELNKTQRE----AEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQ 1037
                     .|| .| . | |     || .|.   || .|  .     |.  |. |   |
Sbjct: 1006 WRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQ---Q 1062

Query: 1038 ELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIH 1097
             |   ||      ||..   ..|  .  |..|  .  . .  |     | .  .  ..  
Sbjct: 1063 ALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDL-- 1120

Query: 1098 LKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKINLEERLVE 1157
                  | |   | ||.| . . .  | | . . .  || | ||    ||.. | |    
Sbjct: 1121 ---RAQREEAAAAHAQEV-RRLQEQARDLGKQRDSC-LREAEEL----RTQLRLLE---- 1167

Query: 1158 LIREKDALWQKNDALEFEQKLRDEETERDV 1187
                .| |  . . || ..|||. .  |.|
Sbjct: 1168 --DARDGL--RRELLEAQRKLRESQEGREV 1193

>hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 1313

 Score =  82 bits (200), Expect = 7e-015
 Identities = 122/520 (23%), Positives = 206/520 (39%), Gaps = 71/520 (13%)

Query:  703 LTVSQRSQAEL---LEKIQEAEAKLCD-----QTFERGLLQARVDELERRSVDMHDEKGA 754
            || ..  . ||   . |..  || | |           | | ..| | |    . .|| |
Sbjct:   13 LTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLD-LNRLVAQLEEEKSA 71

Query:  755 AESNEKMQKPDTERGSPPMESKETPFRLVIAEAQLELNXXXXXXXXXXXXXXXAQLLAGN 814
             .  ..  . .        |  |        | .||                 ||     
Sbjct:   72 LQGRQRQAEQEATVAREEQERLE--------ELRLEQEVARQGLEGSLRVAEQAQ----E 119

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVEDLNRRHVDEILRSREREEALIRERDGEA 874
                ..  |.      .| |  |. ||  . ..| .    |  |  |  |   ||..  |
Sbjct:  120 ALEQQLPTLRHERSQLQEQLAQLSRQLSGREQELEQAR-REAQRQVEALERAAREKEALA 178

Query:  875 QARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENE 934
            .  |||| ..     .   |      | ||      .|     ..|.|      | || .
Sbjct:  179 KEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQ 238

Query:  935 EARLRWEGLTTRLEELK-------EEAARDVESQKAYIEQLRQENQQLLHE-----VQNK 982
               |  | ||  |  |.       |.|. | |     . |  .| |  | |      .. 
Sbjct:  239 ALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDL 298

Query:  983 ERLLEAKE-----------ELQVELNKTQRE----AEAVREKSQGEIQSLNVQLSNESLI 1027
            .||   ||           .|| .| . | |     || .|.   || .|  .     |.
Sbjct:  299 QRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLL 358

Query: 1028 HRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENL 1087
              |. |   | |   ||      ||..   ..|  .  |..|  .  . .  |     | 
Sbjct:  359 AESEKQ---QALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNA 415

Query: 1088 IQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRT 1147
            .  .  ..        | |   | ||.| . . .  | | . . .  || | ||    ||
Sbjct:  416 LTSELRDL-----RAQREEAAAAHAQEV-RRLQEQARDLGKQRDSC-LREAEEL----RT 464

Query: 1148 KINLEERLVELIREKDALWQKNDALEFEQKLRDEETERDV 1187
            .. | |        .| |  . . || ..|||. .  |.|
Sbjct:  465 QLRLLE------DARDGL--RRELLEAQRKLRESQEGREV 496

>hg18||uc002gmp
        |17|NM_017534|Q86T56|Q86T56_HUMAN|MYH2|NM_017534|NP_060004|myosin,
        heavy polypeptide 2, skeletal muscle,

          Length = 1941

 Score =  82 bits (200), Expect = 7e-015
 Identities = 82/338 (24%), Positives = 155/338 (45%), Gaps = 31/338 (9%)

Query:  864 EALIRERDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAE-- 921
            | | |. . | .|.  ||  . . | | . |. .|.      .. . || .||||.|.  
Sbjct: 1319 EELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWR 1378

Query:  922 --LGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEV 979
                      | | |||. .   |  ||.  .|     ||.  |    | .  |.| .||
Sbjct: 1379 TKYETDAIQRTEELEEAKKK---LAQRLQAAEEH----VEAVNAKCASLEKTKQRLQNEV 1431

Query:  980 QNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQEL 1039
            ..    .|        |.| ||  . .  . . . .  . .|       . . ..|  ||
Sbjct: 1432 EDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELE----ASQKEARSLGTEL 1487

Query: 1040 QEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLK 1099
             ....      ...  |.   | .. ||    .|| |   .. | | . .| |.|   |.
Sbjct: 1488 FKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQ 1547

Query: 1100 GNLSRSEGDLAVAQKVCQEMSDNLR---RLTQDKQTIDLRTA---AELDDLYRTKINLEE 1153
              |  .|  |        |    ||    | | |  .| . |    |.| | |  | . |
Sbjct: 1548 AALEEAEASLE------HEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVE 1601

Query: 1154 RLVELIREKDALWQKNDALEFEQKLRDE--ETERDVNH 1189
             .   .  .  .  .|||.  ..|.  .  | |  .||
Sbjct: 1602 SMQSTLDAE--IRSRNDAIRLKKKMEGDLNEMEIQLNH 1637

>hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP_002464|myosin,
        heavy polypeptide 9, non-muscle

          Length = 1960

 Score =  76 bits (185), Expect = 4e-013
 Identities = 68/252 (26%), Positives = 122/252 (48%), Gaps = 25/252 (9%)

Query:  944 TTRLEELKEEAARDVESQKAYIEQLRQENQQLLH---EVQNKERLLEAK-EELQVELNKT 999
            | |..   |.| . .|...    .|  | . ||    . ..| . .||. .||||. |  
Sbjct: 1208 TKRVKANLEKAKQTLENERG---ELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFN-- 1262

Query: 1000 QREAEAVREKSQGEIQSLNVQLSN-ESLIHRS---------QLQTLKQELQEVESRLNTK 1049
              | | || .   ..  | |.| |   |. .|             |. .||. .  |  .
Sbjct: 1263 --EGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE 1320

Query: 1050 QEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDL 1109
              . . |   |||||||     .|.||.       |  |     ..  .|  .  | | |
Sbjct: 1321 NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL 1380

Query: 1110 AVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKINLEERLVELIREKDALWQKN 1169
              |..| ...  .|  |.|  .       |  | | .||  |.. | .|. . |   |  
Sbjct: 1381 ETAEEVKRKLQKDLEGLSQRHE----EKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSA 1436

Query: 1170 DALEFEQKLRDE 1181
              || .||  |.
Sbjct: 1437 CNLEKKQKKFDQ 1448

>hg18||uc003hfp |4|AF112221|Q7L099-2|Q7L099-2|RUFY3|NM_014961|NP_055776|rap2
        interacting protein x isoform 2

          Length = 382

 Score =  75 bits (183), Expect = 6e-013
 Identities = 47/142 (33%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | ||||| | .|         .  | .    |
Sbjct:  27 GRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASV 86

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           | .| ||| .|.|||..| .|. ..|.. . . |||.|     ||. .  .     | | 
Sbjct:  87 KDLPGLKTPVGRGRAWLRLALMQKKLSEYM-KALINKKELLSEFYEPNALMMEEEGAIIA 145

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || |  .   .| |||.
Sbjct: 146 GLLVGLNVIDANFCMKGEDLDS 167

>hg18||uc003hfq |4|NM_014961|Q7L099|RUFY3_HUMAN|RUFY3|NM_014961|NP_055776|rap2
        interacting protein x isoform 2

          Length = 469

 Score =  75 bits (183), Expect = 6e-013
 Identities = 47/142 (33%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | ||||| | .|         .  | .    |
Sbjct:  91 GRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASV 150

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           | .| ||| .|.|||..| .|. ..|.. . . |||.|     ||. .  .     | | 
Sbjct: 151 KDLPGLKTPVGRGRAWLRLALMQKKLSEYM-KALINKKELLSEFYEPNALMMEEEGAIIA 209

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || |  .   .| |||.
Sbjct: 210 GLLVGLNVIDANFCMKGEDLDS 231

>hg18||uc003hfr |4|NM_001037442|NA|NA|RUFY3|NM_001037442|NP_001032519|rap2
        interacting protein x isoform 1

          Length = 620

 Score =  75 bits (183), Expect = 6e-013
 Identities = 47/142 (33%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | ||||| | .|         .  | .    |
Sbjct:  91 GRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASV 150

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           | .| ||| .|.|||..| .|. ..|.. . . |||.|     ||. .  .     | | 
Sbjct: 151 KDLPGLKTPVGRGRAWLRLALMQKKLSEYM-KALINKKELLSEFYEPNALMMEEEGAIIA 209

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || |  .   .| |||.
Sbjct: 210 GLLVGLNVIDANFCMKGEDLDS 231

>hg18||uc002aeg
        |15|NM_032866|Q7Z2L3|Q7Z2L3_HUMAN|CGNL1|NM_032866|NP_116255|cingulin-li
        ke 1

          Length = 1302

 Score =  74 bits (179), Expect = 2e-012
 Identities = 76/332 (22%), Positives = 160/332 (48%), Gaps = 26/332 (7%)

Query:  866 LIRERDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVH 925
            | |.   | . .  .  |    | .  .|. ...    |||  .. |  .  |. .    
Sbjct:  626 LQRQLQLEVKNQQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLEESEGELRKNLEE 685

Query:  926 VCMLTAENEEARLRWEGLTTRLEELKEE---AARDVESQK-AYIEQLRQENQQLLHEVQN 981
            .  .  | |. .     |  .| |. .|   | |  . .| | ||.| |  | |      
Sbjct:  686 LFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDL------ 739

Query:  982 KERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQE 1041
             . || |||| .  | | .||  |..   . |. | . ..      . ..|| |.. ..|
Sbjct:  740 -QDLLIAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEE 798

Query: 1042 -------VESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEE 1094
                   . || || ..     |  .| ...| ..   . ||   ..|. .  |.  . .
Sbjct:  799 ATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEELERRVAQLQRQIEDLKGD 858

Query: 1095 IIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKINLEER 1154
                |  | . ||..    .  .|   . |.  ..|. .  | | | ..|   . || . 
Sbjct:  859 EAKAKETLKKYEGEI----RQLEEALVHARK--EEKEAVSARRALE-NELEAAQGNLSQT 911

Query: 1155 LVELIREKDALWQKNDALEFEQKLRDE-ETER 1185
              |  .  . | ....  |  ..|..| | ||
Sbjct:  912 TQEQKQLSEKLKEESEQKEQLRRLKNEMENER 943

>hg18||uc003upw |7|NR_002147|Q9H6N6|Q9H6N6_HUMAN|MYH16|NA|NA|CDNA: FLJ22037 fis,
        clone HEP08868. (Fragment)

          Length = 741

 Score =  72 bits (175), Expect = 5e-012
 Identities = 78/373 (20%), Positives = 176/373 (47%), Gaps = 32/373 (8%)

Query:  819 KVQALQEVTESSREDLRVLTEQLKAQVEDL--NRRHVDEILRSREREEALIRERDGEAQA 876
            ||. |.| | .  ..   || ||.|. |.|      .  .....   |. | .     . 
Sbjct:   61 KVKELEEKTATLSQEKNDLTIQLQAEQENLMDAEERLTWMMKTKMDLESQISDMRERLEE 120

Query:  877 RAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAE---N 933
              |.|  ..  .    ||.     |  .       | .   |   |   |  || .    
Sbjct:  121 EEGMAASLSAAK---RKLEGELSDLKRDLEGLETTLAKTEKEKQALDHKVRTLTGDLSLR 177

Query:  934 EEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQ 993
            |..  . .     |||| ..   |.....  .  | . | .|  ..   |   | .....
Sbjct:  178 EDSITKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKNNSKLSTQIHELEDNWEQEKKIR 237

Query:  994 VELNKTQREAEAVREKSQGEIQSL-NVQLSNESLIHRSQLQ--TLKQELQEVESRLNTKQ 1050
             |. | .|.||.  . .   .  .   .|  | .. .  |.  ..  . .. .|  .| |
Sbjct:  238 AEVEKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDLEINSVNSKYEDEQSLNSTLQ 297

Query: 1051 EKVVELENNLKQVEDEIQRH---CQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEG 1107
             |. | .. ....|.|..       .||.   . ||   | .. ||  .  .   |    
Sbjct:  298 RKLKEHQDRIEELEEELEAERAMRAKIEQNRKREAELLKLRRELEEAALQSEATASTLRK 357

Query: 1108 DLAVAQKVCQEMSDNLRR----LTQDKQTIDLRTAAELDDL-------YRTKINLEERLV 1156
                .     |  ..|.|    | .||| .     ||.|||        ..|.| |  . 
Sbjct:  358 KHVDSMAELTEHVESLQRVKSKLEKDKQVM----KAEIDDLNASMETIQKSKMNAEAHVR 413

Query: 1157 ELIREKDALWQKN 1169
            .|   .|.| . |
Sbjct:  414 KL---EDSLSEAN 423

>hg18||uc003mka |5|NM_025158|Q96T51|RUFY1_HUMAN|RUFY1|NM_025158|NP_079434|RUN
        and FYVE domain-containing 1 isoform a

          Length = 708

 Score =  72 bits (174), Expect = 7e-012
 Identities = 44/142 (30%), Positives = 78/142 (54%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | .|.|| | ..            |.|    |
Sbjct: 135 GRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSV 194

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           ...|||||..|.|||..  .|. ..||| |.  . |. . || ||.    .       |.
Sbjct: 195 RNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSE-FYEPEALMMEEEGMVIV 253

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || .  ..  .| |||.
Sbjct: 254 GLLVGLNVLDANLCLKGEDLDS 275

>hg18||uc003mkb
        |5|NM_001040452|Q96T51-2|Q96T51-2|RUFY1|NM_001040452|NP_001035542|RUN
        and FYVE domain-containing 1 isoform b

          Length = 600

 Score =  72 bits (174), Expect = 7e-012
 Identities = 44/142 (30%), Positives = 78/142 (54%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | .|.|| | ..            |.|    |
Sbjct:  27 GRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSV 86

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           ...|||||..|.|||..  .|. ..||| |.  . |. . || ||.    .       |.
Sbjct:  87 RNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSE-FYEPEALMMEEEGMVIV 145

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || .  ..  .| |||.
Sbjct: 146 GLLVGLNVLDANLCLKGEDLDS 167

>hg18||uc003mkc
        |5|NM_001040451|Q96T51-2|Q96T51-2|RUFY1|NM_001040451|NP_001035541|RUN
        and FYVE domain-containing 1 isoform b

          Length = 600

 Score =  72 bits (174), Expect = 7e-012
 Identities = 44/142 (30%), Positives = 78/142 (54%), Gaps = 1/142 (0%)

Query:  58 GEPISDDSANLHKFFFKLEYLLQFDQKEKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFV 117
           |  .  | | | .||  .|. |.   | | .|.|| | ..            |.|    |
Sbjct:  27 GRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSV 86

Query: 118 KSIPELKTSLGKGRAFIRYSLVHQRLADTLQQCLINQKVTSEWFYDRSPFLKSHLTADII 177
           ...|||||..|.|||..  .|. ..||| |.  . |. . || ||.    .       |.
Sbjct:  87 RNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSE-FYEPEALMMEEEGMVIV 145

Query: 178 NNLYELNQIHFDVAARGYDLDA 199
             |  || .  ..  .| |||.
Sbjct: 146 GLLVGLNVLDANLCLKGEDLDS 167

>hg18||uc002ysw
        |21|NM_001001132|Q15811-2|Q15811-2|ITSN1|NM_001001132|NP_001001132|inte
        rsectin 1 isoform ITSN-s

          Length = 1220

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002ysx
        |21|DQ679756|Q0PW95|Q0PW95_HUMAN|ITSN1|NM_001001132|NP_001001132|inters
        ectin 1 isoform ITSN-s

          Length = 1178

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  364 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 423

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  424 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 473

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  474 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 533

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  534 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 592

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  593 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 652

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  653 KKDGE----EKGKQEAQDKLGRLFHQHQ 676

>hg18||uc002ysy
        |21|DQ679757|Q0PW94|Q0PW94_HUMAN|ITSN1|NM_001001132|NP_001001132|inters
        ectin 1 isoform ITSN-s

          Length = 1215

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002ysz
        |21|DQ679754|Q1ED40|Q1ED40_HUMAN|ITSN1|NM_001001132|NP_001001132|inters
        ectin 1 isoform ITSN-s

          Length = 1144

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002yta
        |21|NM_003024|Q15811|ITSN1_HUMAN|ITSN1|NM_003024|NP_003015|intersectin
        1 isoform ITSN-l

          Length = 1721

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002ytb
        |21|BC116185|Q14BD4|Q14BD4_HUMAN|ITSN1|NM_003024|NP_003015|intersectin
        1 isoform ITSN-l

          Length = 1716

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002ytc |21|DQ386455|Q20BK3|Q20BK3_HUMAN|ITSN1|NA|NA|Intersectin 1 short
        form transcript variant 8

          Length = 1020

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  401 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 460

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  461 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 510

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  511 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 570

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  571 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 629

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  630 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 689

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  690 KKDGE----EKGKQEAQDKLGRLFHQHQ 713

>hg18||uc002yte
        |21|DQ679755|Q0PW96|Q0PW96_HUMAN|ITSN1|NM_001001132|NP_001001132|inters
        ectin 1 isoform ITSN-s

          Length = 1083

 Score =  69 bits (168), Expect = 4e-011
 Identities = 82/328 (25%), Positives = 140/328 (42%), Gaps = 26/328 (7%)

Query:  815 EERMKVQALQEVTESSREDLRVLTEQLKAQVE--DLNRRHVD---EILRSREREEALIRE 869
            .|| .   |..  |  ||  |   |. . ..|  .  .| ..   ..   | | . |. .
Sbjct:  335 QERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQ 394

Query:  870 RDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCML 929
            |. | .    |  .  |   .   |  .   |  .  | |    |  |.  |       .
Sbjct:  395 RNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIR---CRLTTQRQE-------I 444

Query:  930 TAENEEARLRWEGLT---TRLEELKEEAARDVESQKAYIEQLRQENQQLLH--EVQNKER 984
             . |.   ||   .|    .|.| ..   | .  ..   .||.|  |  ||   .   .|
Sbjct:  445 ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKR 504

Query:  985 LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVES 1044
             |||||  .  |     | |        ||   | ||     ||  | |  ||.  | | 
Sbjct:  505 ALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQ-QLQKQKSMEAER 563

Query: 1045 RLNTKQE-KVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
                .|| |..|||   .. .   |   .|  |   |  | .   .  ||| .  . .. 
Sbjct:  564 LKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVK 623

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            . .|.    .|  ||  | | ||    |
Sbjct:  624 KKDGE----EKGKQEAQDKLGRLFHQHQ 647

>hg18||uc003apg |22|NM_002473|P35579|MYH9_HUMAN|MYH9|NM_002473|NP_002464|myosin,
        heavy polypeptide 9, non-muscle

          Length = 1960

 Score =  69 bits (168), Expect = 4e-011
 Identities = 87/357 (24%), Positives = 152/357 (42%), Gaps = 54/357 (15%)

Query:  859 SREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTE 918
            ||. || . .| .        || |         ...     |  |    .| | .| ||
Sbjct:  841 SRQEEEMMAKEEELVKVREKQLAAE-----NRLTEMETLQSQLMAEKLQLQEQL-QAETE 894

Query:  919 MAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHE 978
                      | || || | |       |||.  .    || ..   . |. | ...   
Sbjct:  895 ----------LCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQN 944

Query:  979 VQNKERLLEAKEEL--QVELNKTQREAEAVR-EKSQGEIQSLNVQLSNESLIHRSQLQTL 1035
            .|  |  || .|    ...| |   ||.  . |. |  ..  | .|. |  .   ..   
Sbjct:  945 IQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEF 1004

Query: 1036 KQELQE---------------------VESRLNTKQEKVVELENNLKQVEDEIQRHCQQI 1074
               | |                     .| ||  ....  |||   ...| .      ||
Sbjct: 1005 TTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQI 1064

Query: 1075 EEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLA---VAQKVCQEMSDNLRRLTQDKQ 1131
             |   |.|| .  . .||||   |.  |.| | . |   .| |  .|.   .  | .| .
Sbjct: 1065 AELQAQIAELKMQLAKKEEE---LQAALARVEEEAAQKNMALKKIRELESQISELQEDLE 1121

Query: 1132 TIDLRTAAELDDLYRTKINLEERLVELIREKDALWQKNDALEFEQKLRDEETERDVN 1188
            .      |  .   . | .| | |  |   |  |    |.   .|.|| .  |..||
Sbjct: 1122 S----ERASRNKAEKQKRDLGEELEAL---KTELEDTLDSTAAQQELRSKR-EQEVN 1170

>hg18||uc002tec |2|NM_181453|Q8IWJ2-2|Q8IWJ2-2|GCC2|NM_181453|NP_852118|GRIP and
        coiled-coil domain-containing 2 isoform

          Length = 1684

 Score =  67 bits (163), Expect = 1e-010
 Identities = 61/234 (26%), Positives = 108/234 (46%), Gaps = 16/234 (6%)

Query:  957 DVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVEL----NKTQREAEAVREKSQG 1012
            ...  |   | |.|| |.    . | | | |  | || ||     |  .| |.....   
Sbjct:  458 EIQGLKEQCENLQQEKQE---AILNYESLREIMEILQTELGESAGKISQEFESMKQQQAS 514

Query: 1013 EIQSLNVQLSNESLIHRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQ 1072
            ..  |  .|        . |.|. . ||    .| ..|| | |||| .| ....   .  
Sbjct:  515 DVHELQQKLRTAFTEKDALLETVNR-LQGENEKLLSQQELVPELENTIKNLQEKNGVYLL 573

Query: 1073 QIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQD-KQ 1131
             . ...  . | |  |    ||       |  |  ..    | |.     .  | .  .|
Sbjct:  574 SLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKKVEQ 633

Query: 1132 TIDLRTAAELDDLYRTKIN-LEERLVELIREKDALWQKNDALEFEQKLRDEETE 1184
            ||   .  |       |.| |   | | ..|||   || . |  . |.  |. |
Sbjct:  634 TIQYNSELE------QKVNELTGGLEETLKEKDQNDQKLEKLMVQMKVLSEDKE 681

>hg18||uc002ted |2|NM_014635|Q8IWJ2|GCC2_HUMAN|GCC2|NM_014635|NP_055450|GRIP and
        coiled-coil domain-containing 2 isoform

          Length = 1583

 Score =  67 bits (163), Expect = 1e-010
 Identities = 61/234 (26%), Positives = 108/234 (46%), Gaps = 16/234 (6%)

Query:  957 DVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVEL----NKTQREAEAVREKSQG 1012
            ...  |   | |.|| |.    . | | | |  | || ||     |  .| |.....   
Sbjct:  357 EIQGLKEQCENLQQEKQE---AILNYESLREIMEILQTELGESAGKISQEFESMKQQQAS 413

Query: 1013 EIQSLNVQLSNESLIHRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQ 1072
            ..  |  .|        . |.|. . ||    .| ..|| | |||| .| ....   .  
Sbjct:  414 DVHELQQKLRTAFTEKDALLETVNR-LQGENEKLLSQQELVPELENTIKNLQEKNGVYLL 472

Query: 1073 QIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQD-KQ 1131
             . ...  . | |  |    ||       |  |  ..    | |.     .  | .  .|
Sbjct:  473 SLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKKVEQ 532

Query: 1132 TIDLRTAAELDDLYRTKIN-LEERLVELIREKDALWQKNDALEFEQKLRDEETE 1184
            ||   .  |       |.| |   | | ..|||   || . |  . |.  |. |
Sbjct:  533 TIQYNSELE------QKVNELTGGLEETLKEKDQNDQKLEKLMVQMKVLSEDKE 580

>hg18||uc003dhr
        |3|NM_015576|O15083|ERC2_HUMAN|ERC2|NM_015576|NP_056391|cytomatrix
        protein p110

          Length = 957

 Score =  67 bits (163), Expect = 1e-010
 Identities = 97/398 (24%), Positives = 172/398 (43%), Gaps = 61/398 (15%)

Query:  823 LQEVTESSREDLRVLTEQLKAQVEDLNRRHVD-------------EILRSRE-REEALIR 868
            |..| .|.  ||.   ..|. .  || |. .|             .   | | ..| ..|
Sbjct:  139 LRQVRDSTMLDLQAQLKELQRE-NDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLR 197

Query:  869 ERDGEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGV-HVC 927
            .   ||   . |  ..    |.   |..   ||  |    |.  |    |    |  |  
Sbjct:  198 KE--EAARMSVLKEQMRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFT 255

Query:  928 MLTAENEEARLRWEGLTTR-----LEELKEEAARDVESQKAYIEQLRQENQQLLHEVQNK 982
            .   |    ||. |          | .  ||    .|.||  .    .  ..||  .|.|
Sbjct:  256 IELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSK 315

Query:  983 ERLLEAKEELQVELNKTQREAEAVREKSQGEI-----QSLNVQLSNESLIHRSQLQTLKQ 1037
                   . |. .  .|.| |||  . |  |.     .  |. |  | |  |||||    
Sbjct:  316 GL---PSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKENIHL-REELHRRSQLQPEPA 371

Query: 1038 ELQEVESRLNTKQEKVVELENNLKQVEDEIQR-------HCQQIEEKNIQMAEFENLIQQ 1090
            . . ... .  |  |.  || |.. .|||||        . .  ||.  |.  ...  . 
Sbjct:  372 KTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIKQIEVYKSHSKF 431

Query: 1091 KEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKIN 1150
             . .|  ||  ||. | .|   |   . .|.         |  | .   |.  |  .   
Sbjct:  432 MKTKIDQLKQELSKKESELLALQTKLETLSN---------QNSDCKQHIEV--LKESLTA 480

Query: 1151 LEERLVELIREKDALWQKNDALEFEQKLRDEETERDVN 1188
             |.|   |  | |||           .|| || |  .|
Sbjct:  481 KEQRAAILQTEVDAL-----------RLRLEEKESFLN 507

>hg18||uc001fec
        |1|NM_152263|Q5VU71|Q5VU71_HUMAN|TPM3|NM_152263|NP_689476|tropomyosin 3
        isoform 1

          Length = 285

 Score =  66 bits (159), Expect = 4e-010
 Identities = 57/250 (22%), Positives = 122/250 (48%), Gaps = 21/250 (8%)

Query:  951 KEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREK- 1009
            || |    |  .|  .|  . ..||  |.   .. |.  |.   ||.|     .  .|| 
Sbjct:   16 KENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTED---ELDKYSEALKDAQEKL 72

Query: 1010 ---------SQGEIQSLN--VQLSNESLIH-RSQLQTLKQELQEVESRLNTKQEKVVELE 1057
                     .. |. |||  .||  | |   . .| |  |.|.| |   .  .  .  .|
Sbjct:   73 ELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIE 132

Query: 1058 NNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQ 1117
            |   . |....    |..|      | .   ..   ... ..|.| |.|    .|.  | 
Sbjct:  133 NRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCS 192

Query: 1118 EMSDNLRRLTQDKQTIDLRTA--AELDDLYRTKIN-LEERLVELIREKDALWQKNDALEF 1174
            |. . |. .| . .... .    .. .| |  .|  | ..| |   |  | . .    . 
Sbjct:  193 ELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKE--AETRAEFAERSVAKL 250

Query: 1175 EQKLRDEETE 1184
            |. . | | |
Sbjct:  251 EKTIDDLEDE 260

>hg18||uc001eyj |1|NM_020770|Q9P2M7|CING_HUMAN|CGN|NM_020770|NP_065821|cingulin

          Length = 1203

 Score =  65 bits (156), Expect = 9e-010
 Identities = 71/328 (21%), Positives = 139/328 (42%), Gaps = 19/328 (5%)

Query:  820 VQALQEVTESSREDLRVLTEQLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAG 879
            |  | .  |   || .   .||.||.||   .   |.  .. . .    | .  .   . 
Sbjct:  851 VDRLNKELEKIGEDSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSR 910

Query:  880 LATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLR 939
            |  |.   |.     .   |   |.     . |     |            .... || .
Sbjct:  911 LQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAEN------KKRSQDDRAR-Q 963

Query:  940 WEGL---TTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVEL 996
             .||    .|||   .|    ||     . . | .  ||  |.  .    .  |  .. |
Sbjct:  964 LKGLEEKVSRLETELDEEKNTVELLTDRVNRGRDQVDQLRTELMQERSARQDLECDKISL 1023

Query:  997 NKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVESRLNTKQEKVVEL 1056
             .  .. .     |.|  |  .  ||       || | |.. ||  |      |    .|
Sbjct: 1024 ERQNKDLKTRLASSEG-FQKPSASLSQ----LESQNQLLQERLQAEEREKTVLQSTNRKL 1078

Query: 1057 ENNLK----QVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVA 1112
            |  .|    |.||| |    | .. ....   .  . . ||||  | |   ... ..   
Sbjct: 1079 ERKVKELSIQIEDERQHVNDQKDQLSLRVKALKRQVDEAEEEIERLDGLRKKAQREVEEQ 1138

Query: 1113 QKVCQEMSDNLRRLTQDKQTIDLRTAAE 1140
             .| ...   .. | .|      |.|||
Sbjct: 1139 HEVNEQLQARIKSLEKDSWRKASRSAAE 1166

>hg18||uc001fea
        |1|NM_153649|P06753-2|P06753-2|TPM3|NM_153649|NP_705935|tropomyosin 3
        isoform 2

          Length = 248

 Score =  62 bits (150), Expect = 4e-009
 Identities = 51/227 (22%), Positives = 115/227 (50%), Gaps = 16/227 (7%)

Query:  976 LHEVQNKERLLEAK-EELQVELNKTQREAEA---VREKSQGEIQSLN--VQLSNESLIH- 1028
            .  |. | ..|. . .. .    . ||| |     ||... |. |||  .||  | |   
Sbjct:    7 IEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRA 66

Query: 1029 RSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLI 1088
            . .| |  |.|.| |   .  .  .  .||   . |....    |..|      | .   
Sbjct:   67 QERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKY 126

Query: 1089 QQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTK 1148
            ..   ... ..|.| |.|    .|.  |.|| . .| . |     .|.  .  .. |  |
Sbjct:  127 EEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQ-----NLKCLSAAEEKYSQK 181

Query: 1149 INLEERLVELIREKDALWQKNDALEFEQK--LRDEETERDVNHCVGC 1193
             .  |  .... .|  | .     || ..   . |.|  |.   . |
Sbjct:  182 EDKYEEEIKILTDK--LKEAETRAEFAERSVAKLEKTIDDLEDKLKC 226

>hg18||uc001fed
        |1|AF474157|Q8TCG3|Q8TCG3_HUMAN|TPM3|NM_153649|NP_705935|tropomyosin 3
        isoform 2

          Length = 247

 Score =  62 bits (150), Expect = 4e-009
 Identities = 51/219 (23%), Positives = 111/219 (50%), Gaps = 12/219 (5%)

Query:  976 LHEVQNKERLLEAK-EELQVELNKTQREAEA---VREKSQGEIQSLN--VQLSNESLIH- 1028
            .  |. | ..|. . .. .    . ||| |     ||... |. |||  .||  | |   
Sbjct:    7 IEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRA 66

Query: 1029 RSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLI 1088
            . .| |  |.|.| |   .  .  .  .||   . |....    |..|      | .   
Sbjct:   67 QERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKY 126

Query: 1089 QQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDL--RTAAELDDLYR 1146
            ..   ... ..|.| |.|    .|.  |.|| . .| . |. . .       .. .| | 
Sbjct:  127 EEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYE 186

Query: 1147 TKIN-LEERLVELIREKDALWQKNDALEFEQKLRDEETE 1184
             .|  | ..| |   |  | . .    . |. . | | |
Sbjct:  187 EEIKILTDKLKE--AETRAEFAERSVAKLEKTIDDLEDE 223

>hg18||uc001feb
        |1|NM_001043352|P06753-3|P06753-3|TPM3|NM_001043352|NP_001036817|tropom
        yosin 3 isoform 3

          Length = 247

 Score =  62 bits (149), Expect = 6e-009
 Identities = 44/194 (22%), Positives = 101/194 (52%), Gaps = 12/194 (6%)

Query:  976 LHEVQNKERLLEAK-EELQVELNKTQREAEA---VREKSQGEIQSLN--VQLSNESLIH- 1028
            .  |. | ..|. . .. .    . ||| |     ||... |. |||  .||  | |   
Sbjct:    7 IEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRA 66

Query: 1029 RSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLI 1088
            . .| |  |.|.| |   .  .  .  .||   . |....    |..|      | .   
Sbjct:   67 QERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKY 126

Query: 1089 QQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTK 1148
            ..   ... ..|.| |.|    .|.  |.|| . .| . |     .|.  .  .. |  |
Sbjct:  127 EEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQ-----NLKCLSAAEEKYSQK 181

Query: 1149 INLEERLVELIREK 1162
             .  |  .... .|
Sbjct:  182 EDKYEEEIKILTDK 195

>hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1000 protein
        (Fragment)

          Length = 1946

 Score =  62 bits (149), Expect = 6e-009
 Identities = 79/319 (24%), Positives = 149/319 (46%), Gaps = 27/319 (8%)

Query:  868 RERDGEAQARAGLA-TEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHV 926
            ...  |.||    .  ||     .  |||  |.    |.   .| | | |  . |   ..
Sbjct: 1469 KQKHEESQALLDASQKEVQALSTELLKLKNTYE----ESIVGQETLRRENKNLQEEISNL 1524

Query:  927 CMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLL 986
                 |  .     | .   .|| | |    .|  .  .|  | |.. |  ...    ||
Sbjct: 1525 TNQVREGTKNLTEMEKVKKLIEEEKTEVQVTLEETEGALE--RNESKILHFQLE----LL 1578

Query:  987 EAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNE--SLIHRSQL-QTLKQELQEVE 1043
            ||| ||. .|..   | |  | | |  | ||   | .|  | |  ..| . ....| |.|
Sbjct: 1579 EAKAELERKLSEKDEEIENFRRKQQCTIDSLQSSLDSEAKSRIEVTRLKKKMEEDLNEME 1638

Query: 1044 SRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLS 1103
             .|.    .| |   .| |..        ||..  .|. .   |    .|..   .   |
Sbjct: 1639 LQLSCANRQVSEATKSLGQLQ-------IQIKDLQMQLDDSTQLNSDLKEQVAVAERRNS 1691

Query: 1104 RSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDLRTAAELDDLYRTKINLEERLVELIREKD 1163
              . .|   . . || ..  |||...    .|  | |  .|. |. |      .   | |
Sbjct: 1692 LLQSELEDLRSL-QEQTERGRRLSEE----ELLEATERINLFYTQ-NTSLLSQKKKLEAD 1745

Query: 1164 ALWQKNDALEFEQKLRDEE 1182
                . .| |  |. .. |
Sbjct: 1746 VARMQKEAEEVVQECQNAE 1764

>hg18||uc002ddv
        |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001040113|NP_001035202|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1945

 Score =  62 bits (148), Expect = 7e-009
 Identities = 82/362 (22%), Positives = 156/362 (43%), Gaps = 38/362 (10%)

Query:  840 QLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYD 899
            |.  | |..  .  ||. ...||..    |     |  . |  |    .|        | 
Sbjct:  853 QVTRQEEEMQAKE-DELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELY- 910

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELK-EEAARDV 958
                |  . |  |     |. |. .|      | || |    |   . |  |  .   |.
Sbjct:  911 ---AEAEEMRVRLAAKKQELEEI-LHEMEARLEEEEDR----GQQLQAERKKMAQQMLDL 962

Query:  959 ESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQV---ELNKTQREAEAVREKSQGEIQ 1015
            | |    |  ||. |  | .|  . .. . ..|. |   . ||  .| . . |.    | 
Sbjct:  963 EEQLEEEEAARQKLQ--LEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEER----IS 1016

Query: 1016 SLNVQLSNESLIHRSQLQTLKQE----LQEVESRLNTKQEKVVELENNLKQVEDEIQRHC 1071
             |   |. |       |  || .    . |.| ||  ...   |||   ...| .     
Sbjct: 1017 DLTTNLAEEE-EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFH 1075

Query: 1072 QQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            .|| .   |.|| .  . .||||   |.  |.| . ..|      ... .    ..  ..
Sbjct: 1076 EQIADLQAQIAELKMQLAKKEEE---LQAALARLDDEIAQKNNALKKIRELEGHISDLQE 1132

Query: 1132 TIDLRTAAEL----------DDLYRTKINLEERLVELIREKDALWQKNDALEFEQKLRDE 1181
             .|   ||            ..|   |  ||. |     ...   ..   .   .|  ||
Sbjct: 1133 DLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDE 1192

Query: 1182 ET 1183
            ||
Sbjct: 1193 ET 1194

>hg18||uc002ddw
        |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844|NP_074035|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1938

 Score =  62 bits (148), Expect = 7e-009
 Identities = 82/362 (22%), Positives = 156/362 (43%), Gaps = 38/362 (10%)

Query:  840 QLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYD 899
            |.  | |..  .  ||. ...||..    |     |  . |  |    .|        | 
Sbjct:  846 QVTRQEEEMQAKE-DELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELY- 903

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELK-EEAARDV 958
                |  . |  |     |. |. .|      | || |    |   . |  |  .   |.
Sbjct:  904 ---AEAEEMRVRLAAKKQELEEI-LHEMEARLEEEEDR----GQQLQAERKKMAQQMLDL 955

Query:  959 ESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQV---ELNKTQREAEAVREKSQGEIQ 1015
            | |    |  ||. |  | .|  . .. . ..|. |   . ||  .| . . |.    | 
Sbjct:  956 EEQLEEEEAARQKLQ--LEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEER----IS 1009

Query: 1016 SLNVQLSNESLIHRSQLQTLKQE----LQEVESRLNTKQEKVVELENNLKQVEDEIQRHC 1071
             |   |. |       |  || .    . |.| ||  ...   |||   ...| .     
Sbjct: 1010 DLTTNLAEEE-EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFH 1068

Query: 1072 QQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            .|| .   |.|| .  . .||||   |.  |.| . ..|      ... .    ..  ..
Sbjct: 1069 EQIADLQAQIAELKMQLAKKEEE---LQAALARLDDEIAQKNNALKKIRELEGHISDLQE 1125

Query: 1132 TIDLRTAAEL----------DDLYRTKINLEERLVELIREKDALWQKNDALEFEQKLRDE 1181
             .|   ||            ..|   |  ||. |     ...   ..   .   .|  ||
Sbjct: 1126 DLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDE 1185

Query: 1182 ET 1183
            ||
Sbjct: 1186 ET 1187

>hg18||uc002ddx
        |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001040114|NP_001035203|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1979

 Score =  62 bits (148), Expect = 7e-009
 Identities = 82/362 (22%), Positives = 156/362 (43%), Gaps = 38/362 (10%)

Query:  840 QLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYD 899
            |.  | |..  .  ||. ...||..    |     |  . |  |    .|        | 
Sbjct:  853 QVTRQEEEMQAKE-DELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELY- 910

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELK-EEAARDV 958
                |  . |  |     |. |. .|      | || |    |   . |  |  .   |.
Sbjct:  911 ---AEAEEMRVRLAAKKQELEEI-LHEMEARLEEEEDR----GQQLQAERKKMAQQMLDL 962

Query:  959 ESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQV---ELNKTQREAEAVREKSQGEIQ 1015
            | |    |  ||. |  | .|  . .. . ..|. |   . ||  .| . . |.    | 
Sbjct:  963 EEQLEEEEAARQKLQ--LEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEER----IS 1016

Query: 1016 SLNVQLSNESLIHRSQLQTLKQE----LQEVESRLNTKQEKVVELENNLKQVEDEIQRHC 1071
             |   |. |       |  || .    . |.| ||  ...   |||   ...| .     
Sbjct: 1017 DLTTNLAEEE-EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFH 1075

Query: 1072 QQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            .|| .   |.|| .  . .||||   |.  |.| . ..|      ... .    ..  ..
Sbjct: 1076 EQIADLQAQIAELKMQLAKKEEE---LQAALARLDDEIAQKNNALKKIRELEGHISDLQE 1132

Query: 1132 TIDLRTAAEL----------DDLYRTKINLEERLVELIREKDALWQKNDALEFEQKLRDE 1181
             .|   ||            ..|   |  ||. |     ...   ..   .   .|  ||
Sbjct: 1133 DLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDE 1192

Query: 1182 ET 1183
            ||
Sbjct: 1193 ET 1194

>hg18||uc002ddy
        |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|NP_002465|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1972

 Score =  62 bits (148), Expect = 7e-009
 Identities = 82/362 (22%), Positives = 156/362 (43%), Gaps = 38/362 (10%)

Query:  840 QLKAQVEDLNRRHVDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLKVRYD 899
            |.  | |..  .  ||. ...||..    |     |  . |  |    .|        | 
Sbjct:  846 QVTRQEEEMQAKE-DELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELY- 903

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELK-EEAARDV 958
                |  . |  |     |. |. .|      | || |    |   . |  |  .   |.
Sbjct:  904 ---AEAEEMRVRLAAKKQELEEI-LHEMEARLEEEEDR----GQQLQAERKKMAQQMLDL 955

Query:  959 ESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQV---ELNKTQREAEAVREKSQGEIQ 1015
            | |    |  ||. |  | .|  . .. . ..|. |   . ||  .| . . |.    | 
Sbjct:  956 EEQLEEEEAARQKLQ--LEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEER----IS 1009

Query: 1016 SLNVQLSNESLIHRSQLQTLKQE----LQEVESRLNTKQEKVVELENNLKQVEDEIQRHC 1071
             |   |. |       |  || .    . |.| ||  ...   |||   ...| .     
Sbjct: 1010 DLTTNLAEEE-EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFH 1068

Query: 1072 QQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQ 1131
            .|| .   |.|| .  . .||||   |.  |.| . ..|      ... .    ..  ..
Sbjct: 1069 EQIADLQAQIAELKMQLAKKEEE---LQAALARLDDEIAQKNNALKKIRELEGHISDLQE 1125

Query: 1132 TIDLRTAAEL----------DDLYRTKINLEERLVELIREKDALWQKNDALEFEQKLRDE 1181
             .|   ||            ..|   |  ||. |     ...   ..   .   .|  ||
Sbjct: 1126 DLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDE 1185

Query: 1182 ET 1183
            ||
Sbjct: 1186 ET 1187

>hg18||uc003cpb |3|NM_024513|Q9BQS8|FYCO1_HUMAN|FYCO1|NM_024513|NP_078789|FYVE
        and coiled-coil domain containing 1

          Length = 1478

 Score =  61 bits (147), Expect = 1e-008
 Identities = 28/37 (75%), Positives = 31/37 (83%)

Query: 1483 VLIPLTRCNAHKETIQGELKVRNSGEYTLIFDNSFSR 1519
            |||| ||||.||| |||.||||  | | |||||.|||
Sbjct: 1418 VLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSR 1454

>hg18||uc001ucg
        |12|BC126305|A0AVD3|A0AVD3_HUMAN|CLIP1|NM_002956|NP_002947|restin
        isoform a

          Length = 1438

 Score =  60 bits (143), Expect = 3e-008
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 28/239 (11%)

Query:  880 LATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLR 939
            |  .. |      .|| ||.  . |     | . . | .   |     .  |  | .   
Sbjct: 1011 LEKKMETSHNQCQELKARYERATSETKTKHEEILQ-NLQKTLLDTEDKLKGAREENS--- 1066

Query:  940 WEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEV-QNKERLLEAKEELQVELNK 998
              ||   ||||...|       ||   |  ..  |.. .. . |   | . |. .    |
Sbjct: 1067 --GLLQELEELRKQA------DKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAK 1118

Query:  999 TQREAEAVREKSQGEIQSLN-----VQLSNESLIH-RSQLQTLKQELQEVESRLNTKQEK 1052
             | | . ..| .   .. ||     . . |. .   | ...||||   .   .|.  ||.
Sbjct: 1119 LQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEE 1178

Query: 1053 VVELENNLKQVEDEIQRHCQQIEEK----NIQMAEFE----NLIQQKEEEIIHLKGNLS 1103
             |.|   | .  ||.  | |..||.    | |. | .      |.  .||   |. ..|
Sbjct: 1179 NVKLAEELGRSRDEVTSH-QKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSIS 1236

>hg18||uc001uch |12|NM_002956|P30622|RSN_HUMAN|CLIP1|NM_002956|NP_002947|restin
        isoform a

          Length = 1427

 Score =  60 bits (143), Expect = 3e-008
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 28/239 (11%)

Query:  880 LATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLR 939
            |  .. |      .|| ||.  . |     | . . | .   |     .  |  | .   
Sbjct: 1000 LEKKMETSHNQCQELKARYERATSETKTKHEEILQ-NLQKTLLDTEDKLKGAREENS--- 1055

Query:  940 WEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEV-QNKERLLEAKEELQVELNK 998
              ||   ||||...|       ||   |  ..  |.. .. . |   | . |. .    |
Sbjct: 1056 --GLLQELEELRKQA------DKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAK 1107

Query:  999 TQREAEAVREKSQGEIQSLN-----VQLSNESLIH-RSQLQTLKQELQEVESRLNTKQEK 1052
             | | . ..| .   .. ||     . . |. .   | ...||||   .   .|.  ||.
Sbjct: 1108 LQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEE 1167

Query: 1053 VVELENNLKQVEDEIQRHCQQIEEK----NIQMAEFE----NLIQQKEEEIIHLKGNLS 1103
             |.|   | .  ||.  | |..||.    | |. | .      |.  .||   |. ..|
Sbjct: 1168 NVKLAEELGRSRDEVTSH-QKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSIS 1225

>hg18||uc001uci |12|NM_198240|P30622-2|P30622-2|CLIP1|NM_198240|NP_937883|restin
        isoform b

          Length = 1392

 Score =  60 bits (143), Expect = 3e-008
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 28/239 (11%)

Query:  880 LATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLR 939
            |  .. |      .|| ||.  . |     | . . | .   |     .  |  | .   
Sbjct:  965 LEKKMETSHNQCQELKARYERATSETKTKHEEILQ-NLQKTLLDTEDKLKGAREENS--- 1020

Query:  940 WEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEV-QNKERLLEAKEELQVELNK 998
              ||   ||||...|       ||   |  ..  |.. .. . |   | . |. .    |
Sbjct: 1021 --GLLQELEELRKQA------DKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAK 1072

Query:  999 TQREAEAVREKSQGEIQSLN-----VQLSNESLIH-RSQLQTLKQELQEVESRLNTKQEK 1052
             | | . ..| .   .. ||     . . |. .   | ...||||   .   .|.  ||.
Sbjct: 1073 LQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEE 1132

Query: 1053 VVELENNLKQVEDEIQRHCQQIEEK----NIQMAEFE----NLIQQKEEEIIHLKGNLS 1103
             |.|   | .  ||.  | |..||.    | |. | .      |.  .||   |. ..|
Sbjct: 1133 NVKLAEELGRSRDEVTSH-QKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSIS 1190

>hg18||uc001ucj
        |12|AB209115|Q59GJ4|Q59GJ4_HUMAN|CLIP1|NM_002956|NP_002947|restin
        isoform a

          Length = 897

 Score =  60 bits (143), Expect = 3e-008
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 28/239 (11%)

Query:  880 LATEVTTCREDFNKLKVRYDALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLR 939
            |  .. |      .|| ||.  . |     | . . | .   |     .  |  | .   
Sbjct:  586 LEKKMETSHNQCQELKARYERATSETKTKHEEILQ-NLQKTLLDTEDKLKGAREENS--- 641

Query:  940 WEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEV-QNKERLLEAKEELQVELNK 998
              ||   ||||...|       ||   |  ..  |.. .. . |   | . |. .    |
Sbjct:  642 --GLLQELEELRKQA------DKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAK 693

Query:  999 TQREAEAVREKSQGEIQSLN-----VQLSNESLIH-RSQLQTLKQELQEVESRLNTKQEK 1052
             | | . ..| .   .. ||     . . |. .   | ...||||   .   .|.  ||.
Sbjct:  694 LQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEE 753

Query: 1053 VVELENNLKQVEDEIQRHCQQIEEK----NIQMAEFE----NLIQQKEEEIIHLKGNLS 1103
             |.|   | .  ||.  | |..||.    | |. | .      |.  .||   |. ..|
Sbjct:  754 NVKLAEELGRSRDEVTSH-QKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSIS 811

>hg18||uc001qiz
        |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP_829881|RAB6-interacti
        ng protein 2 isoform beta

          Length = 992

 Score =  59 bits (140), Expect = 6e-008
 Identities = 59/296 (19%), Positives = 137/296 (46%), Gaps = 26/296 (8%)

Query:  855 EILRSREREEALIRE------RDGEAQARAG---------LATEVTTCREDFNKLKVRYD 899
            ||   ...|| |  |       .   .|||          |  |.|  ... .| .   |
Sbjct:  672 EIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVD 731

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVE 959
             |     .     .  . ..|||     . . . ..   .   |  . .  |...|. .|
Sbjct:  732 RLLEILKEVENEKNDKDKKIAEL---ESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLE 788

Query:  960 SQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNV 1019
              .   . |   .|||   .. |.  .|  ||   |  .   | | |   .| |    | 
Sbjct:  789 EARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMV--LAQEESARTNA 846

Query: 1020 QLSNESLIHRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNI 1079
            .   | |.    .. .||||. ....|.. |. . | | .|  .  | ..| ... |  .
Sbjct:  847 EKQVEELL--MAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLE--M 902

Query: 1080 QMAEFENLIQQKEEEI--IHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTI 1133
            .       | .|.  |  . |  .  ... ..|  ..    .   |.. ||..  .
Sbjct:  903 KQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRMKL 958

>hg18||uc001qjd
        |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP_829882|RAB6-interacti
        ng protein 2 isoform gamma

          Length = 720

 Score =  59 bits (140), Expect = 6e-008
 Identities = 59/296 (19%), Positives = 137/296 (46%), Gaps = 26/296 (8%)

Query:  855 EILRSREREEALIRE------RDGEAQARAG---------LATEVTTCREDFNKLKVRYD 899
            ||   ...|| |  |       .   .|||          |  |.|  ... .| .   |
Sbjct:  400 EIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVD 459

Query:  900 ALSLENSDSREALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVE 959
             |     .     .  . ..|||     . . . ..   .   |  . .  |...|. .|
Sbjct:  460 RLLEILKEVENEKNDKDKKIAEL---ESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLE 516

Query:  960 SQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNV 1019
              .   . |   .|||   .. |.  .|  ||   |  .   | | |   .| |    | 
Sbjct:  517 EARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMV--LAQEESARTNA 574

Query: 1020 QLSNESLIHRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKNI 1079
            .   | |.    .. .||||. ....|.. |. . | | .|  .  | ..| ... |  .
Sbjct:  575 EKQVEELL--MAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLE--M 630

Query: 1080 QMAEFENLIQQKEEEI--IHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTI 1133
            .       | .|.  |  . |  .  ... ..|  ..    .   |.. ||..  .
Sbjct:  631 KQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRMKL 686

>hg18||uc003cgv |3|NM_002078|Q13439|GOGA4_HUMAN|GOLGA4|NM_002078|NP_002069|golgi
        autoantigen, golgin subfamily a, 4

          Length = 2230

 Score =  58 bits (139), Expect = 8e-008
 Identities = 56/266 (21%), Positives = 122/266 (45%), Gaps = 20/266 (7%)

Query:  912 LHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQE 971
            |     |.|||   . .   | ||       .   .  ||||  .   .     |||.|.
Sbjct: 1066 LQEKEQEVAELKQKILLFGCEKEE-------MNKEITWLKEEGVKQDTTLNELQEQLKQK 1118

Query:  972 NQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQ 1031
            .  .    |.. .|    |.|.|.|||. .|   ..|.   |.. |  .   .     |.
Sbjct: 1119 SAHVNSLAQDETKLKAHLEKLEVDLNKSLKENTFLQEQLV-ELKMLAEEDKRKVSELTSK 1177

Query: 1032 LQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRH----CQQIEE-KNIQMAEFEN 1086
            |.|  .| | ..|      . . .     |.. .|.       |.. |     .  |  |
Sbjct: 1178 LKTTDEEFQSLKSSHEKSNKSLEDKSLEFKKLSEELAIQLDICCKKTEALLEAKTNELIN 1237

Query: 1087 LIQQKEEEII----HLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDL---RTAA 1139
            .   |   |.    | .   .. .  | .      |.   ||.||... |...   .   
Sbjct: 1238 ISSSKTNAILSRISHCQHRTTKVKEALLIKTCTVSELEAQLRQLTEEQNTLNISFQQATH 1297

Query: 1140 ELDDLYRTKINLEERLVELIREKDAL 1165
            .|..      ...  .  |. ||.||
Sbjct: 1298 QLEEKENQIKSMKADIESLVTEKEAL 1323

>hg18||uc003cgw |3|AB209693|Q13439-4|Q13439-4|GOLGA4|NM_002078|NP_002069|golgi
        autoantigen, golgin subfamily a, 4

          Length = 2243

 Score =  58 bits (139), Expect = 8e-008
 Identities = 56/266 (21%), Positives = 122/266 (45%), Gaps = 20/266 (7%)

Query:  912 LHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQE 971
            |     |.|||   . .   | ||       .   .  ||||  .   .     |||.|.
Sbjct: 1088 LQEKEQEVAELKQKILLFGCEKEE-------MNKEITWLKEEGVKQDTTLNELQEQLKQK 1140

Query:  972 NQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQ 1031
            .  .    |.. .|    |.|.|.|||. .|   ..|.   |.. |  .   .     |.
Sbjct: 1141 SAHVNSLAQDETKLKAHLEKLEVDLNKSLKENTFLQEQLV-ELKMLAEEDKRKVSELTSK 1199

Query: 1032 LQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRH----CQQIEE-KNIQMAEFEN 1086
            |.|  .| | ..|      . . .     |.. .|.       |.. |     .  |  |
Sbjct: 1200 LKTTDEEFQSLKSSHEKSNKSLEDKSLEFKKLSEELAIQLDICCKKTEALLEAKTNELIN 1259

Query: 1087 LIQQKEEEII----HLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDL---RTAA 1139
            .   |   |.    | .   .. .  | .      |.   ||.||... |...   .   
Sbjct: 1260 ISSSKTNAILSRISHCQHRTTKVKEALLIKTCTVSELEAQLRQLTEEQNTLNISFQQATH 1319

Query: 1140 ELDDLYRTKINLEERLVELIREKDAL 1165
            .|..      ...  .  |. ||.||
Sbjct: 1320 QLEEKENQIKSMKADIESLVTEKEAL 1345

>hg18||uc003cgx |3|U31906|Q13439-4|Q13439-4|GOLGA4|NM_002078|NP_002069|golgi
        autoantigen, golgin subfamily a, 4

          Length = 2109

 Score =  58 bits (139), Expect = 8e-008
 Identities = 56/266 (21%), Positives = 122/266 (45%), Gaps = 20/266 (7%)

Query:  912 LHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQE 971
            |     |.|||   . .   | ||       .   .  ||||  .   .     |||.|.
Sbjct:  947 LQEKEQEVAELKQKILLFGCEKEE-------MNKEITWLKEEGVKQDTTLNELQEQLKQK 999

Query:  972 NQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQLSNESLIHRSQ 1031
            .  .    |.. .|    |.|.|.|||. .|   ..|.   |.. |  .   .     |.
Sbjct: 1000 SAHVNSLAQDETKLKAHLEKLEVDLNKSLKENTFLQEQLV-ELKMLAEEDKRKVSELTSK 1058

Query: 1032 LQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRH----CQQIEE-KNIQMAEFEN 1086
            |.|  .| | ..|      . . .     |.. .|.       |.. |     .  |  |
Sbjct: 1059 LKTTDEEFQSLKSSHEKSNKSLEDKSLEFKKLSEELAIQLDICCKKTEALLEAKTNELIN 1118

Query: 1087 LIQQKEEEII----HLKGNLSRSEGDLAVAQKVCQEMSDNLRRLTQDKQTIDL---RTAA 1139
            .   |   |.    | .   .. .  | .      |.   ||.||... |...   .   
Sbjct: 1119 ISSSKTNAILSRISHCQHRTTKVKEALLIKTCTVSELEAQLRQLTEEQNTLNISFQQATH 1178

Query: 1140 ELDDLYRTKINLEERLVELIREKDAL 1165
            .|..      ...  .  |. ||.||
Sbjct: 1179 QLEEKENQIKSMKADIESLVTEKEAL 1204

>hg18||uc003lzg
        |5|NM_012485|Q2VPE6|Q2VPE6_HUMAN|HMMR|NM_012485|NP_036617|hyaluronan-me
        diated motility receptor isoform b

          Length = 709

 Score =  58 bits (139), Expect = 8e-008
 Identities = 67/340 (19%), Positives = 152/340 (44%), Gaps = 31/340 (9%)

Query:  808 AQLLAGNEERMKVQALQEVTESSR-EDLRVLTEQLKAQVEDLNR-------------RHV 853
            |. .  .| ...|   .   . || .||    |...|..    |             . .
Sbjct:   66 ARKVKSSESKIRVLLQERGAQDSRIQDLETELEKMEARLNAALREKTSLSANNATLEKQL 125

Query:  854 DEILRSREREEALIRERDGEAQARAGLATEVTTCRE----DFNKLKVRYDALSLENSDSR 909
             |. |. |  ..   |   .   |  |. |.   |         .  . . . ..   ..
Sbjct:  126 IELTRTNELLKSKFSENGNQKNLRI-LSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQ 184

Query:  910 EALHRANTEMAELGVHVCMLTAENEEARLRWEGLTTRLEELKEEAARDVESQKAYI---- 965
             .|  .  ..|.|   .  .  |  . .   | |   .||.   |.  ||  |  |    
Sbjct:  185 RSLEESQGKIAQLEGKLVSIEKEKIDEKSETEKLLEYIEEI-SCASDQVEKYKLDIAQLE 243

Query:  966 EQLRQENQQLLHEVQNKER----LLEAKEELQVELNKTQREAEAVREKSQGEIQSLNVQL 1021
            | |...| ..|   |. |     | .  |.| |.    ..| |    ...   ..|| ..
Sbjct:  244 ENLKEKNDEILSLKQSLEENIVILSKQVEDLNVKCQLLEKEKEDHVNRNREHNENLNAEM 303

Query: 1022 SN---ESLIHRSQLQTLKQELQEVESRLNTKQEKVVELENNLKQVEDEIQRHCQQIEEKN 1078
             |   . .. . . . |.|.  ...| |  ..|    |   |   ..|. .     ||. 
Sbjct:  304 QNLKQKFILEQQEREKLQQKELQIDSLLQQEKELSSSLHQKLCSFQEEMVKEKNLFEEEL 363

Query: 1079 IQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQE 1118
             |  .  . .|||||.   |   |       |   |. .|
Sbjct:  364 KQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEE 403

>hg18||uc003okk
        |6|NM_022047|Q9H4E7|Q9H4E7_HUMAN|DEF6|NM_022047|NP_071330|differentiall
        y expressed in FDCP 6 homolog

          Length = 631

 Score =  58 bits (139), Expect = 8e-008
 Identities = 52/214 (24%), Positives = 96/214 (44%), Gaps = 15/214 (7%)

Query:  812 AGNEERMKVQALQEVTESSREDLRVLTEQLKAQVEDLNRRHVDEILRSREREEALIRERD 871
            |  || ...| |||  |   ..| .| |  .     |         . || ..||  .  
Sbjct:  342 AKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLR 401

Query:  872 GEAQARAGLATEVTTCREDFNKLKVRYDALSLENSDSREALH-RANTEMAELGVHVCML- 929
               |||| .  |.    |.  . . |   |       .|||         |  | .    
Sbjct:  402 EAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTR 461

Query:  930 TAENEEARLRWEGLTTRLEELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAK 989
              | || .|.      .| .||||       |. |||. .|| ..|  |.  . | |.  
Sbjct:  462 LLEEEEEKLK------QLMQLKEE-------QERYIERAQQEKEELQQEMAQQSRSLQQA 508

Query:  990 EELQVELNKTQREAEAVREKSQGEIQSLNVQLSN 1023
            ..   |. . .. |.   | .| ...  .  . .
Sbjct:  509 QQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKH 542

>hg18||uc001azt
        |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 2017

 Score =  57 bits (137), Expect = 1e-007
 Identities = 86/441 (19%), Positives = 189/441 (42%), Gaps = 46/441 (10%)

Query:  728 TFERGLLQARVDELERRS-VDMHDEKGAAESNEKMQKPDTERGSPPMESKETPFRLVIAE 786
            . .. |.  .. . || .   . ... | | . .  . . |     .|..    .  .  
Sbjct:  963 SLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQR 1022

Query:  787 AQLELNXXXXXXXXXXXXXXXAQLLAGNEE-RMKVQALQE-------VTESSREDLRVLT 838
             | ||                |.| |  ||   .. |||.       . || ..    | 
Sbjct: 1023 EQEEL---------------LARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLK 1067

Query:  839 EQLKAQVED--LNRRH-VDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLK 895
            |  |  . .  .  || .  |    ||.     .|| ...     .| |     .   |.
Sbjct: 1068 ESEKTALSEKLMGTRHSLATISLEMERQ-----KRDAQSRQEQDRST-VNALTSELRDLR 1121

Query:  896 VRYDALSLENSDSREALHRANTEMAELGVH--VCMLTAENEEARLRW-----EGLTTRLE 948
             . .  .  ..   . . |   .  .||     |.  ||    .||      .||   | 
Sbjct: 1122 AQREEAAAAHA---QEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELL 1178

Query:  949 ELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVRE 1008
            | . .     | ..   ..  .  . |    . .| |  . |||.  . | . |  ... 
Sbjct: 1179 EAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKL 1238

Query: 1009 KSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVE-SRLNTKQEKVVELENNLKQVEDEI 1067
             .. . | | .     . . . .   |.  ||||| |||  ..| . ||   .| .. | 
Sbjct: 1239 ANEDKEQKLALLEEARTAVGK-EAGELRTGLQEVERSRLEARRE-LQELRRQMKMLDSEN 1296

Query: 1068 QRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLT 1127
             |  ... |   ..|  |   ..   | . |.  | . |  | | ..  |     |.   
Sbjct: 1297 TRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQE 1356

Query: 1128 QDKQTIDLRTAAELDDLYRTK 1148
             . .| . |    |..   |.
Sbjct: 1357 GEFRTRERRLLGSLEEARGTE 1377

>hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 1313

 Score =  57 bits (137), Expect = 1e-007
 Identities = 86/441 (19%), Positives = 189/441 (42%), Gaps = 46/441 (10%)

Query:  728 TFERGLLQARVDELERRS-VDMHDEKGAAESNEKMQKPDTERGSPPMESKETPFRLVIAE 786
            . .. |.  .. . || .   . ... | | . .  . . |     .|..    .  .  
Sbjct:  266 SLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQR 325

Query:  787 AQLELNXXXXXXXXXXXXXXXAQLLAGNEE-RMKVQALQE-------VTESSREDLRVLT 838
             | ||                |.| |  ||   .. |||.       . || ..    | 
Sbjct:  326 EQEEL---------------LARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLK 370

Query:  839 EQLKAQVED--LNRRH-VDEILRSREREEALIRERDGEAQARAGLATEVTTCREDFNKLK 895
            |  |  . .  .  || .  |    ||.     .|| ...     .| |     .   |.
Sbjct:  371 ESEKTALSEKLMGTRHSLATISLEMERQ-----KRDAQSRQEQDRST-VNALTSELRDLR 424

Query:  896 VRYDALSLENSDSREALHRANTEMAELGVH--VCMLTAENEEARLRW-----EGLTTRLE 948
             . .  .  ..   . . |   .  .||     |.  ||    .||      .||   | 
Sbjct:  425 AQREEAAAAHA---QEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELL 481

Query:  949 ELKEEAARDVESQKAYIEQLRQENQQLLHEVQNKERLLEAKEELQVELNKTQREAEAVRE 1008
            | . .     | ..   ..  .  . |    . .| |  . |||.  . | . |  ... 
Sbjct:  482 EAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKL 541

Query: 1009 KSQGEIQSLNVQLSNESLIHRSQLQTLKQELQEVE-SRLNTKQEKVVELENNLKQVEDEI 1067
             .. . | | .     . . . .   |.  ||||| |||  ..| . ||   .| .. | 
Sbjct:  542 ANEDKEQKLALLEEARTAVGK-EAGELRTGLQEVERSRLEARRE-LQELRRQMKMLDSEN 599

Query: 1068 QRHCQQIEEKNIQMAEFENLIQQKEEEIIHLKGNLSRSEGDLAVAQKVCQEMSDNLRRLT 1127
             |  ... |   ..|  |   ..   | . |.  | . |  | | ..  |     |.   
Sbjct:  600 TRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQE 659

Query: 1128 QDKQTIDLRTAAELDDLYRTK 1148
             . .| . |    |..   |.
Sbjct:  660 GEFRTRERRLLGSLEEARGTE 680

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,995,008
Number of Sequences: 45480
Number of Extensions: 189995008
Number of Successful Extensions: 11053239
Number of sequences better than 0.0: 0
BLASTP 7.6.0