BLASTP 7.6.0


Query=fugu4_744259 |jgi|Takru4|744259|fgh5_pg.C_scaffold_868000001
        (212 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003lkb |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|...    135   4e-032
hg18||uc003lkd |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088...    135   4e-032
hg18||uc003ljp |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|...    134   7e-032
hg18||uc003ljq |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917...    134   7e-032
hg18||uc003ljz |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|...    134   7e-032
hg18||uc003lka |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920...    134   7e-032
hg18||uc003ljx |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|...    132   4e-031
hg18||uc003ljy |5|NM_018919|Q9Y5G7|PCDG6_HUMAN|PCDHGA6|NM_018919...    132   4e-031
hg18||uc003ljl |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|...    132   5e-031
hg18||uc003ljm |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916...    132   5e-031
hg18||uc003lko |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091...    129   4e-030
hg18||uc003lkq |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_01891...    129   4e-030
hg18||uc003lks |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094...    129   4e-030
hg18||uc003lkt |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_00373...    129   4e-030
hg18||uc003ljh |5|NM_031993|Q9Y5H4-2|Q9Y5H4-2|PCDHGA1|NM_031993|...    127   9e-030
hg18||uc003lji |5|NM_018912|Q9Y5H4|PCDG1_HUMAN|PCDHGA1|NM_018912...    127   9e-030
hg18||uc003ljt |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|...    127   9e-030
hg18||uc003lju |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918...    127   9e-030
hg18||uc003lkk |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090...    127   9e-030
hg18||uc003lkl |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_01891...    127   9e-030
hg18||uc003ljj |5|NM_032009|Q9Y5H1-2|Q9Y5H1-2|PCDHGA2|NM_032009|...    127   1e-029
hg18||uc003ljk |5|NM_018915|Q9Y5H1|PCDG2_HUMAN|PCDHGA2|NM_018915...    127   1e-029
hg18||uc003lkg |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|...    126   3e-029
hg18||uc003lkh |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921...    126   3e-029
hg18||uc003liv |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957...    123   2e-028
hg18||uc003lip |5|NM_018938|Q9Y5E5|PCDB4_HUMAN|PCDHB4|NM_018938|...    120   2e-027
hg18||uc003ljb |5|NM_018934|Q9Y5E9|PCDBE_HUMAN|PCDHB14|NM_018934...    120   2e-027
hg18||uc003liq |5|NM_015669|Q9Y5E4|PCDB5_HUMAN|PCDHB5|NM_015669|...    119   2e-027
hg18||uc003lir |5|NM_018939|Q9Y5E3|PCDB6_HUMAN|PCDHB6|NM_018939|...    119   2e-027
hg18||uc003liz |5|NM_018932|Q9Y5F1|PCDBC_HUMAN|PCDHB12|NM_018932...    119   2e-027
hg18||uc003ljc |5|NR_001281|Q96TA0|Q96TA0_HUMAN|PCDHB18|NA|NA|Pr...    119   2e-027
hg18||uc003lil |5|NM_018936|Q9Y5E7|PCDB2_HUMAN|PCDHB2|NM_018936|...    119   3e-027
hg18||uc003lim |5|BC103505|Q59ER6|Q59ER6_HUMAN|BC103505|NA|NA|Pr...    119   3e-027
hg18||uc003lit |5|NM_018940|Q9Y5E2|PCDB7_HUMAN|PCDHB7|NM_018940|...    119   3e-027
hg18||uc003liy |5|NM_018931|Q9Y5F2|PCDBB_HUMAN|PCDHB11|NM_018931...    119   3e-027
hg18||uc003lku |5|NM_032402|Q9UN70-2|Q9UN70-2|PCDHGC3|NM_032402|...    119   3e-027
hg18||uc003lkv |5|NM_002588|Q9UN70|PCDGK_HUMAN|PCDHGC3|NM_002588...    119   3e-027
hg18||uc003lio |5|NM_018937|Q9Y5E6|PCDB3_HUMAN|PCDHB3|NM_018937|...    119   4e-027
hg18||uc003liw |5|NM_019119|NA|NA|PCDHB9|NM_019119|NP_061992|pro...    119   4e-027
hg18||uc003lik |5|NM_013340|Q2M257|Q2M257_HUMAN|PCDHB1|NM_013340...    117   9e-027
hg18||uc003lje |5|NM_018935|Q9Y5E8|PCDBF_HUMAN|PCDHB15|NM_018935...    117   1e-026
hg18||uc003liu |5|NM_019120|Q9UN66|PCDB8_HUMAN|PCDHB8|NM_019120|...    116   3e-026
hg18||uc003lkc |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736...    115   4e-026
hg18||uc003lkm |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|...    114   1e-025
hg18||uc003lkn |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927...    114   1e-025
hg18||uc003lja |5|NM_018933|Q9Y5F0|PCDBD_HUMAN|PCDHB13|NM_018933...    112   4e-025
hg18||uc003lke |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|...    112   4e-025
hg18||uc003lkf |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925...    112   4e-025
hg18||uc003ljn |5|NM_032095|Q9Y5G3-2|Q9Y5G3-2|PCDHGB1|NM_032095|...    111   8e-025
hg18||uc003ljo |5|NM_018922|Q9Y5G3|PCDGD_HUMAN|PCDHGB1|NM_018922...    111   8e-025
hg18||uc003lki |5|NM_032100|Q9Y5F9-2|Q9Y5F9-2|PCDHGB6|NM_032100|...    111   1e-024
hg18||uc003lkj |5|NM_018926|Q9Y5F9|PCDGI_HUMAN|PCDHGB6|NM_018926...    111   1e-024
hg18||uc003ljr |5|NM_032096|Q9Y5G2-2|Q9Y5G2-2|PCDHGB2|NM_032096|...    110   2e-024
hg18||uc003ljs |5|NM_018923|Q9Y5G2|PCDGE_HUMAN|PCDHGB2|NM_018923...    110   2e-024
hg18||uc003lix |5|NM_018930|Q9UN67|PCDBA_HUMAN|PCDHB10|NM_018930...    109   4e-024
hg18||uc003lii |5|NM_018899|Q9Y5I4|PCDC2_HUMAN|PCDHAC2|NM_018899...    103   2e-022
hg18||uc003lij |5|NM_031883|Q9Y5I4-2|Q9Y5I4-2|PCDHAC2|NM_031883|...    103   2e-022
hg18||uc003lig |5|NM_031882|Q9H158-2|Q9H158-2|PCDHAC1|NM_031882|...    103   2e-022
hg18||uc003lih |5|NM_018898|Q9H158|PCDC1_HUMAN|PCDHAC1|NM_018898...    103   2e-022
hg18||uc003ljv |5|NM_032097|Q9Y5G1-2|Q9Y5G1-2|PCDHGB3|NM_032097|...    103   2e-022
hg18||uc003ljw |5|NM_018924|Q9Y5G1|PCDGF_HUMAN|PCDHGB3|NM_018924...    103   2e-022
hg18||uc003lkz |5|NM_032407|Q9Y5F6-2|Q9Y5F6-2|PCDHGC5|NM_032407|...     82   4e-016
hg18||uc003lla |5|NM_018929|Q9Y5F6|PCDGM_HUMAN|PCDHGC5|NM_018929...     82   4e-016
hg18||uc003lht |5|NM_014005|Q9Y5H5-2|Q9Y5H5-2|PCDHA9|NM_014005|N...     77   2e-014
hg18||uc003lhu |5|NM_031857|Q9Y5H5|PCDA9_HUMAN|PCDHA9|NM_031857|...     77   2e-014
hg18||uc003lhe |5|NM_031497|Q9Y5H8-2|Q9Y5H8-2|PCDHA3|NM_031497|N...     76   2e-014
hg18||uc003lhf |5|NM_018906|Q9Y5H8|PCDA3_HUMAN|PCDHA3|NM_018906|...     76   2e-014
hg18||uc003lhg |5|NM_031500|Q9UN74-2|Q9UN74-2|PCDHA4|NM_031500|N...     75   4e-014
hg18||uc003lhh |5|AB208925|Q59H34|Q59H34_HUMAN|PCDHA4|NM_018907|...     75   4e-014
hg18||uc003lhi |5|NM_018907|Q9UN74|PCDA4_HUMAN|PCDHA4|NM_018907|...     75   4e-014
hg18||uc003lhv |5|NM_031859|Q9Y5I2-3|Q9Y5I2-3|PCDHA10|NM_031859|...     75   4e-014
hg18||uc003lhx |5|NM_018901|Q9Y5I2|PCDAA_HUMAN|PCDHA10|NM_018901...     75   4e-014
hg18||uc003lhz |5|NM_031861|Q9Y5I1-2|Q9Y5I1-2|PCDHA11|NM_031861|...     74   9e-014
hg18||uc003lia |5|NM_018902|Q9Y5I1|PCDAB_HUMAN|PCDHA11|NM_018902...     74   9e-014
hg18||uc003lhc |5|NM_031495|Q9Y5H9-2|Q9Y5H9-2|PCDHA2|NM_031495|N...     74   1e-013
hg18||uc003lhd |5|NM_018905|Q9Y5H9|PCDA2_HUMAN|PCDHA2|NM_018905|...     74   1e-013
hg18||uc003lhp |5|NM_031852|Q9UN72-2|Q9UN72-2|PCDHA7|NM_031852|N...     74   1e-013
hg18||uc003lhq |5|NM_018910|Q9UN72|PCDA7_HUMAN|PCDHA7|NM_018910|...     74   1e-013
hg18||uc003lhr |5|NM_031856|Q9Y5H6-2|Q9Y5H6-2|PCDHA8|NM_031856|N...     74   1e-013
hg18||uc003lhs |5|NM_018911|Q9Y5H6|PCDA8_HUMAN|PCDHA8|NM_018911|...     74   1e-013
hg18||uc003lgz |5|NM_031410|Q9Y5I3-3|Q9Y5I3-3|PCDHA1|NM_031410|N...     72   3e-013
hg18||uc003lhb |5|NM_018900|Q9Y5I3|PCDA1_HUMAN|PCDHA1|NM_018900|...     72   3e-013
hg18||uc003lhj |5|NM_031501|Q9Y5H7-2|Q9Y5H7-2|PCDHA5|NM_031501|N...     72   3e-013
hg18||uc003lhk |5|BC033735|Q9Y5H7-3|Q9Y5H7-3|PCDHA5|NM_018908|NP...     72   3e-013
hg18||uc003lhl |5|NM_018908|Q9Y5H7|PCDA5_HUMAN|PCDHA5|NM_018908|...     72   3e-013
hg18||uc003lhm |5|NM_031848|Q9UN73-3|Q9UN73-3|PCDHA6|NM_031848|N...     72   4e-013
hg18||uc003lho |5|NM_018909|Q9UN73|PCDA6_HUMAN|PCDHA6|NM_018909|...     72   4e-013
hg18||uc003lid |5|NM_031865|Q9Y5I0-2|Q9Y5I0-2|PCDHA13|NM_031865|...     72   6e-013
hg18||uc003lie |5|AB208924|Q59H35|Q59H35_HUMAN|PCDHA13|NM_018904...     72   6e-013
hg18||uc003lif |5|NM_018904|Q9Y5I0|PCDAD_HUMAN|PCDHA13|NM_018904...     72   6e-013
hg18||uc003lib |5|NM_031864|Q9UN75-2|Q9UN75-2|PCDHA12|NM_031864|...     71   1e-012
hg18||uc003lic |5|NM_018903|Q9UN75|PCDAC_HUMAN|PCDHA12|NM_018903...     71   1e-012
hg18||uc003lkp |5|NM_032092|Q9Y5H2-3|Q9Y5H2-3|PCDHGA11|NM_032092...     54   2e-007
hg18||uc003gsj |4|NM_032456|O60245-2|O60245-2|PCDH7|NM_032456|NP...     52   4e-007
hg18||uc003gsk |4|NM_002589|O60245|PCDH7_HUMAN|PCDH7|NM_002589|N...     52   4e-007
hg18||uc003gsl |4|NM_032457|O60245-3|O60245-3|PCDH7|NM_032457|NP...     52   4e-007
hg18||uc001mem |11|NM_003737|Q96JQ0|PCD16_HUMAN|DCHS1|NM_003737|...     48   9e-006
hg18||uc003lkr |5|NR_001297|NA|NA|NR_001297|NA|NA|Homo sapiens P...     48   9e-006
hg18||uc003inw |4|NM_017639|Q6V1P9|Q6V1P9_HUMAN|DCHS2|NM_017639|...     46   3e-005
hg18||uc001jrx |10|NM_022124|Q9H251-2|Q9H251-2|CDH23|NM_022124|N...     46   3e-005

>hg18||uc003lkb
        |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|NP_054723|protocadheri
        n gamma subfamily A, 8 isoform 2

          Length = 820

 Score =  135 bits (339), Expect = 4e-032
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| ||||.|        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
            |.. ... || .||.|  |
Sbjct: 709 AVLLGLRLRRWHKSRLLQDS 728

>hg18||uc003lkd
        |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088|NP_114477|protocadher
        in gamma subfamily A, 8 isoform 1

          Length = 932

 Score =  135 bits (339), Expect = 4e-032
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| ||||.|        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
            |.. ... || .||.|  |
Sbjct: 709 AVLLGLRLRRWHKSRLLQDS 728

>hg18||uc003ljp
        |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|NP_114442|protocadheri
        n gamma subfamily A, 4 isoform 2

          Length = 820

 Score =  134 bits (337), Expect = 7e-032
 Identities = 67/138 (48%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | |...  || |||  ||.|| | . |.||.|||| |.|.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRTARALLDRDALKQRLVVVVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDN-LTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..        . .|. || |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPDVLADLGSLKPSADPDDSGLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILY 137
            |....|. || .||.|.
Sbjct: 709 TVLLALKLRRWHKSRLLH 726

>hg18||uc003ljq
        |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917|NP_061740|protocadher
        in gamma subfamily A, 4 isoform 1

          Length = 931

 Score =  134 bits (337), Expect = 7e-032
 Identities = 67/138 (48%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | |...  || |||  ||.|| | . |.||.|||| |.|.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRTARALLDRDALKQRLVVVVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDN-LTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..        . .|. || |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPDVLADLGSLKPSADPDDSGLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILY 137
            |....|. || .||.|.
Sbjct: 709 TVLLALKLRRWHKSRLLH 726

>hg18||uc003ljz
        |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|NP_114476|protocadheri
        n gamma subfamily A, 7 isoform 2

          Length = 817

 Score =  134 bits (337), Expect = 7e-032
 Identities = 70/140 (50%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| ||||..       |  || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPEVLADLGSLEPSDGPYNYDLTLYLVVAVATVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 LVLLALRLRRWHKSRLLQAS 728

>hg18||uc003lka
        |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920|NP_061743|protocadher
        in gamma subfamily A, 7 isoform 1

          Length = 932

 Score =  134 bits (337), Expect = 7e-032
 Identities = 70/140 (50%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| ||||..       |  || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPEVLADLGSLEPSDGPYNYDLTLYLVVAVATVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 LVLLALRLRRWHKSRLLQAS 728

>hg18||uc003ljx
        |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|NP_114475|protocadheri
        n gamma subfamily A, 6 isoform 2

          Length = 818

 Score =  132 bits (331), Expect = 4e-031
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 IVLLALRLQRWHKSRLLQAS 728

>hg18||uc003ljy
        |5|NM_018919|Q9Y5G7|PCDG6_HUMAN|PCDHGA6|NM_018919|NP_061742|protocadher
        in gamma subfamily A, 6 isoform 1

          Length = 932

 Score =  132 bits (331), Expect = 4e-031
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 IVLLALRLQRWHKSRLLQAS 728

>hg18||uc003ljl
        |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|NP_114400|protocadheri
        n gamma subfamily A, 3 isoform 2

          Length = 829

 Score =  132 bits (330), Expect = 5e-031
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 IVLLALRLRRWHKSRLLQAS 728

>hg18||uc003ljm
        |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916|NP_061739|protocadher
        in gamma subfamily A, 3 isoform 1

          Length = 932

 Score =  132 bits (330), Expect = 5e-031
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|...... || .||.|  |
Sbjct: 709 IVLLALRLRRWHKSRLLQAS 728

>hg18||uc003lko
        |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091|NP_114480|protocadher
        in gamma subfamily A, 11 isoform 2

          Length = 837

 Score =  129 bits (322), Expect = 4e-030
 Identities = 67/141 (47%), Positives = 97/141 (68%), Gaps = 3/141 (2%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || ||   ||.|| | . |.||.|| | | |.|
Sbjct: 590 TKVVAVDKDSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQD 649

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEF--TDFAHDKEYNDNLTFYXXXXXXXXSFLFITC 118
           .|||  |||| . |||||| ||||..    .   . | .| |. |        | .|.  
Sbjct: 650 HGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSD-LSLYLVVAVAAVSCIFLVF 708

Query: 119 LVVIISVKIYRWRQSRILYHS 139
           ..|.......|| .||.|  |
Sbjct: 709 VIVLLALRLWRWHKSRLLQAS 729

>hg18||uc003lkq
        |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_018914|NP_061737|protocadhe
        rin gamma subfamily A, 11 isoform 1

          Length = 935

 Score =  129 bits (322), Expect = 4e-030
 Identities = 67/141 (47%), Positives = 97/141 (68%), Gaps = 3/141 (2%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || ||   ||.|| | . |.||.|| | | |.|
Sbjct: 590 TKVVAVDKDSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQD 649

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEF--TDFAHDKEYNDNLTFYXXXXXXXXSFLFITC 118
           .|||  |||| . |||||| ||||..    .   . | .| |. |        | .|.  
Sbjct: 650 HGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSD-LSLYLVVAVAAVSCIFLVF 708

Query: 119 LVVIISVKIYRWRQSRILYHS 139
           ..|.......|| .||.|  |
Sbjct: 709 VIVLLALRLWRWHKSRLLQAS 729

>hg18||uc003lks
        |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094|NP_115265|protocadher
        in gamma subfamily A, 12 isoform 2

          Length = 820

 Score =  129 bits (322), Expect = 4e-030
 Identities = 65/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..     .       .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPQVLADLGSLESPANSETSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           ........ || .||.|  |
Sbjct: 709 ILLLALRLRRWHKSRLLQAS 728

>hg18||uc003lkt
        |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_003735|NP_003726|protocadhe
        rin gamma subfamily A, 12 isoform 1

          Length = 932

 Score =  129 bits (322), Expect = 4e-030
 Identities = 65/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..     .       .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADSIPQVLADLGSLESPANSETSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           ........ || .||.|  |
Sbjct: 709 ILLLALRLRRWHKSRLLQAS 728

>hg18||uc003ljh
        |5|NM_031993|Q9Y5H4-2|Q9Y5H4-2|PCDHGA1|NM_031993|NP_114382|protocadheri
        n gamma subfamily A, 1 isoform 2

          Length = 823

 Score =  127 bits (319), Expect = 9e-030
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||   ..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRISDILADLGSLEPSAKPNDSDLTLYLVVAAAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 709 IVLLAHRLRRWHKSRLLQAS 728

>hg18||uc003lji
        |5|NM_018912|Q9Y5H4|PCDG1_HUMAN|PCDHGA1|NM_018912|NP_061735|protocadher
        in gamma subfamily A, 1 isoform 1

          Length = 931

 Score =  127 bits (319), Expect = 9e-030
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||   ..|..        . || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRISDILADLGSLEPSAKPNDSDLTLYLVVAAAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 709 IVLLAHRLRRWHKSRLLQAS 728

>hg18||uc003ljt
        |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|NP_114443|protocadheri
        n gamma subfamily A, 5 isoform 2

          Length = 813

 Score =  127 bits (319), Expect = 9e-030
 Identities = 65/137 (47%), Positives = 91/137 (66%), Gaps = 1/137 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |||
Sbjct: 589 TKVVAVDKDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVED 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||  | |||||  |..|..        .  | .|| |        | .|.  .
Sbjct: 649 HGQPPLSATFTVTVAVADRIPDILADLGSIKTPIDPEDLDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRIL 136
           .|.. ... || .||.|
Sbjct: 709 IVLLVLRLRRWHKSRLL 725

>hg18||uc003lju
        |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918|NP_061741|protocadher
        in gamma subfamily A, 5 isoform 1

          Length = 931

 Score =  127 bits (319), Expect = 9e-030
 Identities = 65/137 (47%), Positives = 91/137 (66%), Gaps = 1/137 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |||
Sbjct: 589 TKVVAVDKDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVED 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||  | |||||  |..|..        .  | .|| |        | .|.  .
Sbjct: 649 HGQPPLSATFTVTVAVADRIPDILADLGSIKTPIDPEDLDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRIL 136
           .|.. ... || .||.|
Sbjct: 709 IVLLVLRLRRWHKSRLL 725

>hg18||uc003lkk
        |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090|NP_114479|protocadher
        in gamma subfamily A, 10 isoform 2

          Length = 850

 Score =  127 bits (319), Expect = 9e-030
 Identities = 66/140 (47%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || ||   ||.|| | . |.||.|| | | |.|
Sbjct: 593 TKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQD 652

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..   | .       .|| |        | .|.  .
Sbjct: 653 HGQPPLSATVTLTVAVADSIPQVLADLGSFESPANSETSDLTLYLVVAVAAVSCVFLAFV 712

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 713 IVLLAHRLRRWHKSRLLQAS 732

>hg18||uc003lkl
        |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_018913|NP_061736|protocadhe
        rin gamma subfamily A, 10 isoform 1

          Length = 936

 Score =  127 bits (319), Expect = 9e-030
 Identities = 66/140 (47%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || ||   ||.|| | . |.||.|| | | |.|
Sbjct: 593 TKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQD 652

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDF-AHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||| |.||..   | .       .|| |        | .|.  .
Sbjct: 653 HGQPPLSATVTLTVAVADSIPQVLADLGSFESPANSETSDLTLYLVVAVAAVSCVFLAFV 712

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 713 IVLLAHRLRRWHKSRLLQAS 732

>hg18||uc003ljj
        |5|NM_032009|Q9Y5H1-2|Q9Y5H1-2|PCDHGA2|NM_032009|NP_114398|protocadheri
        n gamma subfamily A, 2 isoform 2

          Length = 823

 Score =  127 bits (318), Expect = 1e-029
 Identities = 65/140 (46%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | ||..  || |||  ||.|| | . |.||.|| | | ..|
Sbjct: 589 TKVVAVDRDSGQNAWLSYHLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAIQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..          || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAIPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 709 IVLLAHRLRRWHKSRLLQAS 728

>hg18||uc003ljk
        |5|NM_018915|Q9Y5H1|PCDG2_HUMAN|PCDHGA2|NM_018915|NP_061738|protocadher
        in gamma subfamily A, 2 isoform 1

          Length = 932

 Score =  127 bits (318), Expect = 1e-029
 Identities = 65/140 (46%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||||||| | ||..  || |||  ||.|| | . |.||.|| | | ..|
Sbjct: 589 TKVVAVDRDSGQNAWLSYHLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAIQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYND-NLTFYXXXXXXXXSFLFITCL 119
           .|||  |||| . |||||  |..|..          || .|| |        | .|.  .
Sbjct: 649 HGQPPLSATVTLTVAVADRIPDILADLGSLEPSAIPNDSDLTLYLVVAVAAVSCVFLAFV 708

Query: 120 VVIISVKIYRWRQSRILYHS 139
           .|... .. || .||.|  |
Sbjct: 709 IVLLAHRLRRWHKSRLLQAS 728

>hg18||uc003lkg
        |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|NP_114478|protocadheri
        n gamma subfamily A, 9 isoform 2

          Length = 828

 Score =  126 bits (314), Expect = 3e-029
 Identities = 65/142 (45%), Positives = 94/142 (66%), Gaps = 3/142 (2%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLFKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEF--TDFAHDKEYNDNLTFYXXXXXXXXSFLFITC 118
           .|||  |||| . ||.||| |..|..        | | .| || |        | .|.| 
Sbjct: 649 HGQPPLSATVTLTVAIADSIPDILADLGSLQIPADLEASD-LTLYLVVAVAVVSCVFLTF 707

Query: 119 LVVIISVKIYRWRQSRILYHSS 140
           .. ......  |  | .|  .|
Sbjct: 708 VITLLALRLRHWHSSHLLRATS 729

>hg18||uc003lkh
        |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921|NP_061744|protocadher
        in gamma subfamily A, 9 isoform 1

          Length = 932

 Score =  126 bits (314), Expect = 3e-029
 Identities = 65/142 (45%), Positives = 94/142 (66%), Gaps = 3/142 (2%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| ||..  || |||  ||.|| | . |.||.|| | | |.|
Sbjct: 589 TKVVAVDRDSGQNAWLSYRLFKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEF--TDFAHDKEYNDNLTFYXXXXXXXXSFLFITC 118
           .|||  |||| . ||.||| |..|..        | | .| || |        | .|.| 
Sbjct: 649 HGQPPLSATVTLTVAIADSIPDILADLGSLQIPADLEASD-LTLYLVVAVAVVSCVFLTF 707

Query: 119 LVVIISVKIYRWRQSRILYHSS 140
           .. ......  |  | .|  .|
Sbjct: 708 VITLLALRLRHWHSSHLLRATS 729

>hg18||uc003liv
        |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957|NP_066008|protocadher
        in beta 16 precursor

          Length = 776

 Score =  123 bits (307), Expect = 2e-028
 Identities = 66/158 (41%), Positives = 98/158 (62%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| |||| |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   ..|| |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPFLPLPEAAPGQTQANSLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .| |  |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGRCSMPEGP-FPGRLVDVSGTG 743

>hg18||uc003lip
        |5|NM_018938|Q9Y5E5|PCDB4_HUMAN|PCDHB4|NM_018938|NP_061761|protocadheri
        n beta 4 precursor

          Length = 795

 Score =  120 bits (299), Expect = 2e-027
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 586 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 645

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 646 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 705

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 706 LFVAVRLCRRSRAASVGRCSVPEGP-FPGHLVDVSGTG 742

>hg18||uc003ljb
        |5|NM_018934|Q9Y5E9|PCDBE_HUMAN|PCDHB14|NM_018934|NP_061757|protocadher
        in beta 14 precursor

          Length = 798

 Score =  120 bits (299), Expect = 2e-027
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGRCSVPEGP-FPGHLVDVSGTG 743

>hg18||uc003liq
        |5|NM_015669|Q9Y5E4|PCDB5_HUMAN|PCDHB5|NM_015669|NP_056484|protocadheri
        n beta 5 precursor

          Length = 795

 Score =  119 bits (298), Expect = 2e-027
 Identities = 64/158 (40%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || .   |||.|| | ....|| | || |.|.|
Sbjct: 586 TKVVAVDGDSGQNAWLSYQLLKATEPGLFSMWAHNGEVRTARLLSERDAAKHRLVVLVKD 645

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 646 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 705

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 706 LFVAVRLCRRSRAASVGRCSVPEGP-FPGHLVDVSGTG 742

>hg18||uc003lir
        |5|NM_018939|Q9Y5E3|PCDB6_HUMAN|PCDHB6|NM_018939|NP_061762|protocadheri
        n beta 6 precursor

          Length = 794

 Score =  119 bits (298), Expect = 2e-027
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 585 TKVVAVDGDSGQNAWLSYQLLKATELGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 644

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 645 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 704

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 705 LFVAVRLCRRSRAASVGRYSVPEGP-FPGHLVDVSGTG 741

>hg18||uc003liz
        |5|NM_018932|Q9Y5F1|PCDBC_HUMAN|PCDHB12|NM_018932|NP_061755|protocadher
        in beta 12 precursor

          Length = 795

 Score =  119 bits (298), Expect = 2e-027
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 707 LFVAVRLCRRSRAAPVGRCSVPEGP-FPGHLVDVSGTG 743

>hg18||uc003ljc
        |5|NR_001281|Q96TA0|Q96TA0_HUMAN|PCDHB18|NA|NA|Protocadherin-psi2

          Length = 734

 Score =  119 bits (298), Expect = 2e-027
 Identities = 65/158 (41%), Positives = 95/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   ||| || | ....|| | || |.|.|
Sbjct: 534 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEGRTARLLSERDAAKHRLVVLVKD 593

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . . | .     |. |  .   |.|| |        | ||.  . 
Sbjct: 594 NGEPPRSATATLHVLLVEGFSQPYLPLTEAAPSQAQADSLTVYLVVALASVSSLFLFSVF 653

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 654 LFVAVRLCRRSRAASMGRCSVPECP-FPGHLVDVSGTG 690

>hg18||uc003lil
        |5|NM_018936|Q9Y5E7|PCDB2_HUMAN|PCDHB2|NM_018936|NP_061759|protocadheri
        n beta 2 precursor

          Length = 798

 Score =  119 bits (297), Expect = 3e-027
 Identities = 66/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | . ..|| |||| |.|.|
Sbjct: 589 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLRERDAAKQRLVVLVKD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   | || |        | ||.  ..
Sbjct: 649 NGEPPRSATATLHVLLVDGFSQPYLLLPEAAPAQAQADLLTVYLVVALASVSSLFLFSVL 708

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .| .  |  |||
Sbjct: 709 LFVAVRLCRRSRAASVGRCSVPEGP-FPGQMVDVSGTG 745

>hg18||uc003lim |5|BC103505|Q59ER6|Q59ER6_HUMAN|BC103505|NA|NA|Protocadherin
        beta 2 variant (Fragment)

          Length = 459

 Score =  119 bits (297), Expect = 3e-027
 Identities = 66/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | . ..|| |||| |.|.|
Sbjct: 250 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLRERDAAKQRLVVLVKD 309

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   | || |        | ||.  ..
Sbjct: 310 NGEPPRSATATLHVLLVDGFSQPYLLLPEAAPAQAQADLLTVYLVVALASVSSLFLFSVL 369

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .| .  |  |||
Sbjct: 370 LFVAVRLCRRSRAASVGRCSVPEGP-FPGQMVDVSGTG 406

>hg18||uc003lit
        |5|NM_018940|Q9Y5E2|PCDB7_HUMAN|PCDHB7|NM_018940|NP_061763|protocadheri
        n beta 7 precursor

          Length = 793

 Score =  119 bits (297), Expect = 3e-027
 Identities = 66/158 (41%), Positives = 98/158 (62%), Gaps = 3/158 (1%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| |||| |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . | |.   ..|| |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLRLPEAAPDQA--NSLTVYLVVALASVSSLFLLSVL 704

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 705 LFVAVRLCRRSRAAPVGRCSVPEGP-FPRHLVDLSGTG 741

>hg18||uc003liy
        |5|NM_018931|Q9Y5F2|PCDBB_HUMAN|PCDHB11|NM_018931|NP_061754|protocadher
        in beta 11 precursor

          Length = 797

 Score =  119 bits (297), Expect = 3e-027
 Identities = 65/158 (41%), Positives = 95/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  . | . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 647 NGEPPRSATATLQVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGSCSVPKGP-FPGHLVDVSGTG 743

>hg18||uc003lku
        |5|NM_032402|Q9UN70-2|Q9UN70-2|PCDHGC3|NM_032402|NP_115778|protocadheri
        n gamma subfamily C, 3 isoform 2

          Length = 863

 Score =  119 bits (297), Expect = 3e-027
 Identities = 63/163 (38%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           ..||  | |.| |||||| |  . ...|| .||  |.| | | | | |. .| |.|...|
Sbjct: 591 SRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQISTARPVQDTDSPRQTLTVLIKD 650

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.|| | |  . |.| .  ||  .||   .  .|   |||||        |  |.  . 
Sbjct: 651 NGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVF 710

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYY----PPRYSDTLGTGL 159
            .|  |.|.|.||| || .  ||   |    |  ..| .  ||
Sbjct: 711 GVIIFKVYKWKQSRDLYRA--PVSSLYRTPGPSLHADAVRGGL 751

>hg18||uc003lkv
        |5|NM_002588|Q9UN70|PCDGK_HUMAN|PCDHGC3|NM_002588|NP_002579|protocadher
        in gamma subfamily C, 3 isoform 1

          Length = 934

 Score =  119 bits (297), Expect = 3e-027
 Identities = 63/163 (38%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           ..||  | |.| |||||| |  . ...|| .||  |.| | | | | |. .| |.|...|
Sbjct: 591 SRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQISTARPVQDTDSPRQTLTVLIKD 650

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.|| | |  . |.| .  ||  .||   .  .|   |||||        |  |.  . 
Sbjct: 651 NGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVF 710

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYY----PPRYSDTLGTGL 159
            .|  |.|.|.||| || .  ||   |    |  ..| .  ||
Sbjct: 711 GVIIFKVYKWKQSRDLYRA--PVSSLYRTPGPSLHADAVRGGL 751

>hg18||uc003lio
        |5|NM_018937|Q9Y5E6|PCDB3_HUMAN|PCDHB3|NM_018937|NP_061760|protocadheri
        n beta 3 precursor

          Length = 796

 Score =  119 bits (296), Expect = 4e-027
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   | || |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADLLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .| .  |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGRCSVPEGP-FPGQMVDVSGTG 743

>hg18||uc003liw |5|NM_019119|NA|NA|PCDHB9|NM_019119|NP_061992|protocadherin beta
        9 precursor

          Length = 797

 Score =  119 bits (296), Expect = 4e-027
 Identities = 65/158 (41%), Positives = 95/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   | || |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADLLTVYLVVALASVSSLFLLSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGRCSVPEGP-FPGHLVDVSGTG 743

>hg18||uc003lik
        |5|NM_013340|Q2M257|Q2M257_HUMAN|PCDHB1|NM_013340|NP_037472|protocadher
        in beta 1 precursor

          Length = 818

 Score =  117 bits (293), Expect = 9e-027
 Identities = 66/171 (38%), Positives = 100/171 (58%), Gaps = 8/171 (4%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| |||||.|||| | ||||  || |  ||||| |.||....| . |.| ..|.|
Sbjct: 588 TKVVAVDGDSGQNSWLSYHLLKATDLGLFSVQRQNGEIHTLRQISERDPMMQKLIILVQD 647

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTD-FAHDKEYNDNLTFYXXXXXXXXSFLFITCL 119
           .|||. | || .|. . | | |   .| |   | .. | . | |        ||||.  .
Sbjct: 648 HGQPALSTTVSLNILLVDGFSEPYLQFQDPTKHSRKVNPS-TKYLVISLVILSFLFLLSV 706

Query: 120 VVIISVKIYRWRQSRILYHSSLPVIPYY--PPRYSDTLGTGLSNTCTTTRC 168
           .||  . .|.    .| |     .  ..     .|. |  |  |   .  |
Sbjct: 707 IVIFIIHVYQ----KIKYREKFTIQEHFYDDCNFSNNLVQGQGNGSLSRPC 753

>hg18||uc003lje
        |5|NM_018935|Q9Y5E8|PCDBF_HUMAN|PCDHB15|NM_018935|NP_061758|protocadher
        in beta 15 precursor

          Length = 787

 Score =  117 bits (292), Expect = 1e-026
 Identities = 64/158 (40%), Positives = 93/158 (58%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|  | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  . | . | | .      . |  .   |.|| |        | ||.  . 
Sbjct: 647 NGEPPRSATATLQVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVF 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..|.. |  ..  .   |.|  | .|    |  |||
Sbjct: 707 LFVAVRLCRRSRAASVGRCSVPEGP-FPGHLVDVSGTG 743

>hg18||uc003liu
        |5|NM_019120|Q9UN66|PCDB8_HUMAN|PCDHB8|NM_019120|NP_061993|protocadheri
        n beta 8 precursor

          Length = 801

 Score =  116 bits (288), Expect = 3e-026
 Identities = 64/158 (40%), Positives = 95/158 (60%), Gaps = 1/158 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| |||| |.|.|
Sbjct: 588 TKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRLVVLVKD 647

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.|  |||  ... . | | .      . |  .   |.|| |        | ||.  ..
Sbjct: 648 NGEPPCSATATLHLLLVDGFSQPYLPLPEAAPAQGQADSLTVYLVVALASVSSLFLFSVL 707

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTG 158
           . ..| . |  ..  .   |.|  | .|    |  |||
Sbjct: 708 LFVAVLLCRRSRAASVGRCSVPEGP-FPGHLVDVRGTG 744

>hg18||uc003lkc
        |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736|NP_003727|protocadher
        in gamma subfamily B, 4 isoform 1

          Length = 923

 Score =  115 bits (287), Expect = 4e-026
 Identities = 57/129 (44%), Positives = 81/129 (62%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.|| | . |.|||.||| | | |
Sbjct: 587 TKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAVRQRLLVAVRD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| . ||     .    | ||        | ||.  ..
Sbjct: 647 GGQPPLSATATLHLVFADSLQEVLPDITDRPDPSDLQAELQFYLVVALALISVLFLVAMI 706

Query: 121 VIISVKIYR 129
           . |.... |
Sbjct: 707 LAIALRLRR 715

>hg18||uc003lkm
        |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|NP_115272|protocadheri
        n gamma subfamily B, 7 isoform 2

          Length = 808

 Score =  114 bits (283), Expect = 1e-025
 Identities = 65/163 (39%), Positives = 94/163 (57%), Gaps = 16/163 (9%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.| .| . |||.|.||| | | |
Sbjct: 589 TKVVAVDADSGHNAWLSYHVVQASEPGLFSLGLRTGEVRMVRALGDKDSVRQRLLVAVRD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| .|.|     .    . ||        | ||.  ..
Sbjct: 649 GGQPPLSATATLHLVFADSLQEVLPDFSDHPTPSDSQAEMQFYLVVALALISVLFLLAVI 708

Query: 121 VIISVKIYRWRQS----------RILYHSSLPVIPYYPPRYSD 153
           . |....   |||           .|   | ||    || ||.
Sbjct: 709 LAIALRL---RQSFSPTAGDCFESVLCSKSGPV---GPPNYSE 745

>hg18||uc003lkn
        |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927|NP_061750|protocadher
        in gamma subfamily B, 7 isoform 1

          Length = 929

 Score =  114 bits (283), Expect = 1e-025
 Identities = 65/163 (39%), Positives = 94/163 (57%), Gaps = 16/163 (9%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.| .| . |||.|.||| | | |
Sbjct: 589 TKVVAVDADSGHNAWLSYHVVQASEPGLFSLGLRTGEVRMVRALGDKDSVRQRLLVAVRD 648

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| .|.|     .    . ||        | ||.  ..
Sbjct: 649 GGQPPLSATATLHLVFADSLQEVLPDFSDHPTPSDSQAEMQFYLVVALALISVLFLLAVI 708

Query: 121 VIISVKIYRWRQS----------RILYHSSLPVIPYYPPRYSD 153
           . |....   |||           .|   | ||    || ||.
Sbjct: 709 LAIALRL---RQSFSPTAGDCFESVLCSKSGPV---GPPNYSE 745

>hg18||uc003lja
        |5|NM_018933|Q9Y5F0|PCDBD_HUMAN|PCDHB13|NM_018933|NP_061756|protocadher
        in beta 13 precursor

          Length = 798

 Score =  112 bits (279), Expect = 4e-025
 Identities = 63/157 (40%), Positives = 92/157 (58%), Gaps = 1/157 (0%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||||||||||.| |||.  || |   |||.|| | ....|| | || |.|.|
Sbjct: 587 TKVVAVDGDSGQNAWLSYQLLKATELGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKD 646

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
           ||.| ||||  ..| . | | .      . |  .   | || |        | ||.  ..
Sbjct: 647 NGEPPRSATATLHVLLVDGFSQPYLPLPEAAPTQAQADLLTVYLVVALASVSSLFLFSVL 706

Query: 121 VIISVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGT 157
           . ..|.. |  ..  .    .|  |  |    |  ||
Sbjct: 707 LFVAVRLCRRSRAASVGRCLVPEGP-LPGHLVDMSGT 742

>hg18||uc003lke
        |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|NP_115270|protocadheri
        n gamma subfamily B, 5 isoform 2

          Length = 818

 Score =  112 bits (279), Expect = 4e-025
 Identities = 62/157 (39%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.|| | . |.|| .||| | | |
Sbjct: 585 TKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRD 644

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| . ||     .    | ||        | ||.  ..
Sbjct: 645 GGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFYLVVALALISVLFLLAVI 704

Query: 121 VIISVKIYRWRQSRILYHSSLPVI-----PYYPPRYS 152
           . ..... |   |   .    | .     |  || ||
Sbjct: 705 LAVALRLRR-SSSPAAWSCFQPGLCVKSGPVVPPNYS 740

>hg18||uc003lkf
        |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925|NP_061748|protocadher
        in gamma subfamily B, 5 isoform 1

          Length = 923

 Score =  112 bits (279), Expect = 4e-025
 Identities = 62/157 (39%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.|| | . |.|| .||| | | |
Sbjct: 585 TKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRD 644

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| . ||     .    | ||        | ||.  ..
Sbjct: 645 GGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFYLVVALALISVLFLLAVI 704

Query: 121 VIISVKIYRWRQSRILYHSSLPVI-----PYYPPRYS 152
           . ..... |   |   .    | .     |  || ||
Sbjct: 705 LAVALRLRR-SSSPAAWSCFQPGLCVKSGPVVPPNYS 740

>hg18||uc003ljn
        |5|NM_032095|Q9Y5G3-2|Q9Y5G3-2|PCDHGB1|NM_032095|NP_115266|protocadheri
        n gamma subfamily B, 1 isoform 2

          Length = 810

 Score =  111 bits (276), Expect = 8e-025
 Identities = 55/129 (42%), Positives = 80/129 (62%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.|| | . |.|| .||| | | |
Sbjct: 585 TKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRD 644

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| . .|     .    | ||        | ||.  ..
Sbjct: 645 GGQPPLSATATLHLIFADSLQEVLPDLSDRPEPSDPQTELQFYLVVALALISVLFLLAVI 704

Query: 121 VIISVKIYR 129
           . |.... |
Sbjct: 705 LAIALRLRR 713

>hg18||uc003ljo
        |5|NM_018922|Q9Y5G3|PCDGD_HUMAN|PCDHGB1|NM_018922|NP_061745|protocadher
        in gamma subfamily B, 1 isoform 1

          Length = 927

 Score =  111 bits (276), Expect = 8e-025
 Identities = 55/129 (42%), Positives = 80/129 (62%)

Query:   1 TKVVAIDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTIRQVTDKDAVKQRLSVIVED 60
           |||||.| ||| |||||| . .|..  || .||. ||.|| | . |.|| .||| | | |
Sbjct: 585 TKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRD 644

Query:  61 NGQPSRSATVIVNVAVADSFPEVLSEFTDFAHDKEYNDNLTFYXXXXXXXXSFLFITCLV 120
            |||  |||  ...  |||  ||| . .|     .    | ||        | ||.  ..
Sbjct: 645 GGQPPLSATATLHLIFADSLQEVLPDLSDRPEPSDPQTELQFYLVVALALISVLFLLAVI 704

Query: 121 VIISVKIYR 129
           . |.... |
Sbjct: 705 LAIALRLRR 713

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,504,799
Number of Sequences: 45480
Number of Extensions: 192504799
Number of Successful Extensions: 11219916
Number of sequences better than 0.0: 0
BLASTP 7.6.0