BLASTP 7.6.0


Query=fugu4_744212 |jgi|Takru4|744212|fgh5_pg.C_scaffold_829000001
        (454 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    553   2e-157
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    483   2e-136
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    299   5e-081
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    272   9e-073
hg18||uc001cvk |1|NM_033300|Q14114-4|Q14114-4|LRP8|NM_033300|NP_...    256   6e-068
hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|N...    239   6e-063
hg18||uc001cvj |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_00101...    239   6e-063
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    235   9e-062
hg18||uc001cvl |1|NM_017522|Q5SW66|Q5SW66_HUMAN|LRP8|NM_017522|N...    226   7e-059
hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP...    219   9e-057
hg18||uc002mqk |19|NM_000527|P01130|LDLR_HUMAN|LDLR|NM_000527|NP...    219   9e-057
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    216   7e-056
hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP...    210   5e-054
hg18||uc001cvm |1|AK122887|NA|NA|LRP8|NM_033300|NP_150643|low de...    207   3e-053
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    207   3e-053
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    207   3e-053
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    203   5e-052
hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP...    201   2e-051
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    195   1e-049
hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP...    189   1e-047
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    181   2e-045
hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|N...    181   3e-045
hg18||uc003zhl |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_0010...    181   3e-045
hg18||uc003zhn |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_00101805...    181   3e-045
hg18||uc001cvh |1|AK096482|Q14114-4|Q14114-4|LRP8|NM_001018054|N...    175   1e-043
hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP...    173   4e-043
hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP...    168   2e-041
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    164   2e-040
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    164   2e-040
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    149   6e-036
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    149   1e-035
hg18||uc001hxo |1|NM_002508|P14543|NID1_HUMAN|NID1|NM_002508|NP_...    148   1e-035
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    146   5e-035
hg18||uc001wzo |14|NM_007361|Q14112|NID2_HUMAN|NID2|NM_007361|NP...    145   1e-034
hg18||uc003hzy |4|NM_001963|P01133|EGF_HUMAN|EGF|NM_001963|NP_00...    143   5e-034
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    141   2e-033
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    141   3e-033
hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|N...    140   5e-033
hg18||uc003zhl |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_0010...    140   5e-033
hg18||uc003zhn |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_00101805...    140   5e-033
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    137   3e-032
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    135   2e-031
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    134   4e-031
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    129   7e-030
hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|N...    127   3e-029
hg18||uc001cvj |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_00101...    127   3e-029
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    126   1e-028
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    125   1e-028
hg18||uc003abs |22|NM_182492|NA|NA|LRP5L|NM_182492|NP_872298|low...    119   1e-026
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...    116   6e-026
hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|N...    116   6e-026
hg18||uc003zhl |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_0010...    116   6e-026
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    115   1e-025
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    114   2e-025
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...    114   2e-025
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    114   4e-025
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...    111   3e-024
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...    110   6e-024
hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|N...    105   2e-022
hg18||uc001cvj |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_00101...    105   2e-022
hg18||uc001pxx |11|NM_003105|Q92673|SORL_HUMAN|SORL1|NM_003105|N...    102   2e-021
hg18||uc001snc |12|BC021204|Q6PJ72|Q6PJ72_HUMAN|LRP1|NA|NA|LRP1 ...     96   8e-020
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     96   1e-019
hg18||uc001cvk |1|NM_033300|Q14114-4|Q14114-4|LRP8|NM_033300|NP_...     94   2e-019
hg18||uc001cvl |1|NM_017522|Q5SW66|Q5SW66_HUMAN|LRP8|NM_017522|N...     94   2e-019
hg18||uc003zhn |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_00101805...     93   5e-019
hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP...     93   7e-019
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     88   2e-017
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...     85   1e-016
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     84   3e-016
hg18||uc001cvl |1|NM_017522|Q5SW66|Q5SW66_HUMAN|LRP8|NM_017522|N...     82   1e-015
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     80   6e-015
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...     79   1e-014
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     76   7e-014
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     74   5e-013
hg18||uc003zhn |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_00101805...     73   6e-013
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...     72   1e-012
hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|N...     70   7e-012
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...     69   1e-011
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...     69   1e-011
hg18||uc001pxx |11|NM_003105|Q92673|SORL_HUMAN|SORL1|NM_003105|N...     67   4e-011
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...     67   6e-011
hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|N...     66   9e-011
hg18||uc001bfj |1|NM_005529|Q5VU27|Q5VU27_HUMAN|HSPG2|NM_005529|...     64   5e-010
hg18||uc003gxm |4|NM_006587|Q2TBD2|Q2TBD2_HUMAN|CORIN|NM_006587|...     60   4e-009
hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP...     60   5e-009
hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|N...     57   4e-008
hg18||uc003zhl |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_0010...     57   4e-008
hg18||uc003zhn |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_00101805...     57   4e-008
hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|N...     57   6e-008
hg18||uc001cvj |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_00101...     57   6e-008
hg18||uc003yma |8|NM_013437|Q9Y561|LRP12_HUMAN|LRP12|NM_013437|N...     56   7e-008
hg18||uc003ymb |8|AF064841|NA|NA|LRP12|NM_013437|NP_038465|suppr...     56   7e-008
hg18||uc001pxx |11|NM_003105|Q92673|SORL_HUMAN|SORL1|NM_003105|N...     56   1e-007
hg18||uc001pxx |11|NM_003105|Q92673|SORL_HUMAN|SORL1|NM_003105|N...     52   1e-006
hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|...     52   2e-006

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  553 bits (1424), Expect = 2e-157
 Identities = 286/435 (65%), Positives = 319/435 (73%), Gaps = 16/435 (3%)

Query:   14 EFACKNS-RCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNR--CIPLRWLX 70
            .| ||.| ||| . | ||||||| |||||  | |    |      | ||   |.|   | 
Sbjct: 1109 KFGCKDSARCISKAWVCDGDNDCEDNSDE--ENCESLACRPPSHPCANNTSVCLPPDKLC 1166

Query:   71 XXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIP----ISWTCXXXXXXXXXXXEPAS 126
                                 |  |   |.    .     |  .|               
Sbjct: 1167 DGNDDCGDGSDEGEL---CDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQI 1223

Query:  127 CAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNPTDPFKPFIIFSNRHEI 186
             .|          |.  .    . .|   .      |  .|    |||||||||||||||
Sbjct: 1224 QSYCAKHLKCSQKCDQNK---FSVKCSCYEGWVLEPDGESC-RSLDPFKPFIIFSNRHEI 1279

Query:  187 RRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVI 246
            |||||.||..|||||||||||||||||.||||||||||||||||||| .|||||||.|||
Sbjct: 1280 RRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVI 1339

Query:  247 QYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDG 306
            |||||||||||||||||||||||||||||||||||||.|||||||..|||||||||||||
Sbjct: 1340 QYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDG 1399

Query:  307 ILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIY 366
            ||||||||||.|||||||||| ||.|.|.|||.|||||||||||||.|||||||||||||
Sbjct: 1400 ILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRILWIDARSDAIY 1459

Query:  367 SAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTN 426
            ||.||||| .|||||||.||||||||.||||||||||||||||||||||| |||||||||
Sbjct: 1460 SARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTN 1519

Query:  427 TQPFDLQVYHPSRQP 441
            |||||||||||||||
Sbjct: 1520 TQPFDLQVYHPSRQP 1534

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  483 bits (1243), Expect = 2e-136
 Identities = 247/449 (55%), Positives = 307/449 (68%), Gaps = 21/449 (4%)

Query:   14 EFAC-KNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWLXXX 72
            .|.|    ||| . | |||| || | |||  . |    |   .  | |.  . |.     
Sbjct: 1100 KFSCWSTGRCINKAWVCDGDIDCEDQSDE--DDCDSFLCGPPKHPCANDTSVCLQ-PEKL 1156

Query:   73 XXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXXXEPASCAYP 130
                      |.       |  |   | |  |  .|                .  .|   
Sbjct: 1157 CNGKKDCPDGSDEGYLCDECSLNNGGC-SNHCSVVPGRGIVCSCPEGLQLNKDNKTC--- 1212

Query:  131 TCFPLTQFTCNNGRCINI------NWRCDNEKDCGDGSDELNCPNPTDPFKPFIIFSNRH 184
                .  .  |. .|  .        .|   .      |  .| .  |||. ||||| ||
Sbjct: 1213 ---EIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTS-VDPFEAFIIFSIRH 1268

Query:  185 EIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDV 244
            |||||||.| ..|.|||||||||||||| ||| |||||||||.||||||||.| ... .|
Sbjct: 1269 EIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAIEV 1328

Query:  245 VIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPR 304
            |...|||||||| ||||||||||..|||||||||||||..||||.|| .|||||||||||
Sbjct: 1329 VVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPR 1388

Query:  305 DGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDA 364
             ||||||||||. ||||.||||| |||||.|.   | ||||||||. |.||.| ||||||
Sbjct: 1389 YGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDARSDA 1448

Query:  365 IYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQR 424
            |||| |||. .||..||||||||||||..|| ||||||||||||.||||||| ||.|.|.
Sbjct: 1449 IYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQK 1508

Query:  425 TNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
            |. ||||||.||||||||  |     |||
Sbjct: 1509 TSAQPFDLQIYHPSRQPQA-PNPCAANDG 1536

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  299 bits (765), Expect = 5e-081
 Identities = 128/167 (76%), Positives = 133/167 (79%)

Query:    1 NPSYIPPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKN 60
            ||||.|||||| ||||| ||||||||||||||||||||||||| ||||||||.|||||.|
Sbjct:  845 NPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCEN 904

Query:   61 NRCIPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXX 120
            ||||| |||             || |||||||||||.||||||||||||||         
Sbjct:  905 NRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDR 964

Query:  121 XXEPASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNC 167
              | ||||||||||||||||||||||||||||||. |||| |||  |
Sbjct:  965 SDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGC 1011

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  272 bits (694), Expect = 9e-073
 Identities = 166/448 (37%), Positives = 236/448 (52%), Gaps = 30/448 (6%)

Query:    8 PQCQAGEFACKNSRCIQER-WKCDGDNDCLDNSDEAPELCH----QHTC-PTDRFKCKNN 61
            | |   || | | ||.  | |.|||.||| | |||||.  |    .| |  . .| | . 
Sbjct: 2856 PTCGPSEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSG 2915

Query:   62 RCIPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXX 119
            ||.    |                 |    |   . |  |  |  . | . |        
Sbjct: 2916 RCVAEALL--CNGQDDCGDSSDERGCHINECLSRKLSGCSQDCEDLKIGFKCRCRPGFRL 2973

Query:  120 XXXEPASCAYPTCFPLTQFTCNNGRCINI--NWRC-DNEKDCGDGSDELNCPNPTDPFKP 176
                        |   | | |.  ||||   ...|   |     | |  .|   ||  .|
Sbjct: 2974 KDDGRTCADVDEC--STTFPCSQ-RCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDE-EP 3029

Query:  177 FIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSEN 236
            |.||.||. .|...|.   ...|  || | .||||   .  .|||||        ..  |
Sbjct: 3030 FLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLN 3089

Query:  237 GALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHP 296
            |  ..  |. . ||. |.||||||. ||.|| .   | |||.||.|  || |..  .  |
Sbjct: 3090 G--SNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREP 3147

Query:  297 RAIALDPRDGILFWTDW-DASMPRIEAASMSGEGRKTI--HKETGNGGWPNGLTVDYLER 353
            ||. .| ..| |.|||| | |.  |    | |  |  |   | |    ||||||.||.  
Sbjct: 3148 RALVVDVQNGYLYWTDWGDHSL--IGRIGMDGSSRSVIVDTKIT----WPNGLTLDYVTE 3201

Query:  354 RILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANK 413
            || | ||| | |  |  |||    ||   . . | ||.|..   |||||| | .. .|.|
Sbjct: 3202 RIYWADAREDYIEFASLDGSNRHVVL--SQDIPHIFALTLFEDYVYWTDWETKSINRAHK 3259

Query:  414 WTGSNVTVVQRTNTQPFDLQVYHPSRQP 441
             ||.| |..  |  .| || |.|  |||
Sbjct: 3260 TTGTNKTLLISTLHRPMDLHVFHALRQP 3287

>hg18||uc001cvk |1|NM_033300|Q14114-4|Q14114-4|LRP8|NM_033300|NP_150643|low
        density lipoprotein receptor-related protein

          Length = 793

 Score =  256 bits (652), Expect = 6e-068
 Identities = 138/449 (30%), Positives = 224/449 (49%), Gaps = 27/449 (6%)

Query:   6 PPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKC--KNNRC 63
           |   |   .| | |  || |||||||. .| | |||.   | .  || ..  |   ...|
Sbjct:  82 PKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKC 141

Query:  64 IPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXX 121
           .|  |              .        |  |   | |  |  . | . |          
Sbjct: 142 VPASWRCDGEKDCEGGADEAGCATWLNECLHNNGGC-SHICTDLKIGFECTCPAGFQLLD 200

Query: 122 XEPASCAYPTCFPLTQF----TCNNGRCININWRCDNEKDCGDGSD----ELNCPNPTDP 173
            .       ||  . .      |.    | .|..   . .|  | .      ||      
Sbjct: 201 QK-------TCGDIDECKDPDACSQ---ICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK 250

Query: 174 FKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKL 233
             | .||.||||.||||| |  .| |.| |.| .|||  .  . .|| |.   |||   .
Sbjct: 251 -SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYM 309

Query: 234 SENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEV 293
            .       .|.|   | .||||||||.  .||| .|    | || .||  | || .  .
Sbjct: 310 DKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNL 369

Query: 294 EHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER 353
             |||||.||  | ..|.||     .|| . ..|  |.|.  .  |  ||||.|.| | .
Sbjct: 370 SEPRAIAVDPLRGFMYWSDW-GDQAKIEKSGLNGVDRQTLVSD--NIEWPNGITLDLLSQ 426

Query: 354 RILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANK 413
           |. |.|..   . |  . |     ..   ..||||| . ..  .|.|||     .  ||.
Sbjct: 427 RLYWVDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANR 486

Query: 414 WTGSNVTVVQRTNTQPFDLQVYHPSRQPQ 442
             |  ....      | |. ..|  .||.
Sbjct: 487 LNGLEISILAENLNNPHDIVIFHELKQPR 515

>hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|NP_004622|low
        density lipoprotein receptor-related protein

          Length = 963

 Score =  239 bits (609), Expect = 6e-063
 Identities = 137/447 (30%), Positives = 220/447 (49%), Gaps = 27/447 (6%)

Query:   6 PPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIP 65
           |     | .|||..  |.   |.|||| || | ||||   |   ||  | |.| .  |. 
Sbjct: 256 PAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEAD--CPLGTCRGDEFQCGDGTCVL 313

Query:  66 LRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXXXE 123
                            .        |  |   | |  |  . | . |           .
Sbjct: 314 AIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGC-SHICTDLKIGFECTCPAGFQLLDQK 372

Query: 124 PASCAYPTCFPLTQF----TCNNGRCININWRCDNEKDCGDGSD----ELNCPNPTDPFK 175
                  ||  . .      |.    | .|..   . .|  | .      ||        
Sbjct: 373 -------TCGDIDECKDPDACSQ---ICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK-S 421

Query: 176 PFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSE 235
           | .||.||||.||||| |  .| |.| |.| .|||  .  . .|| |.   |||   . .
Sbjct: 422 PSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDK 481

Query: 236 NGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEH 295
                  .|.|   | .||||||||.  .||| .|    | || .||  | || .  .  
Sbjct: 482 ASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSE 541

Query: 296 PRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRI 355
           |||||.||  | ..|.||     .|| . ..|  |.|.  .  |  ||||.|.| | .|.
Sbjct: 542 PRAIAVDPLRGFMYWSDW-GDQAKIEKSGLNGVDRQTLVSD--NIEWPNGITLDLLSQRL 598

Query: 356 LWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWT 415
            |.|..   . |  . |     ..   ..||||| . ..  .|.|||     .  ||.  
Sbjct: 599 YWVDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLN 658

Query: 416 GSNVTVVQRTNTQPFDLQVYHPSRQPQ 442
           |  ....      | |. ..|  .||.
Sbjct: 659 GLEISILAENLNNPHDIVIFHELKQPR 685

>hg18||uc001cvj
        |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_001018054|NP_001018064|low
        density lipoprotein receptor-related protein

          Length = 904

 Score =  239 bits (609), Expect = 6e-063
 Identities = 137/447 (30%), Positives = 220/447 (49%), Gaps = 27/447 (6%)

Query:   6 PPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIP 65
           |     | .|||..  |.   |.|||| || | ||||   |   ||  | |.| .  |. 
Sbjct: 256 PAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEAD--CPLGTCRGDEFQCGDGTCVL 313

Query:  66 LRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXXXE 123
                            .        |  |   | |  |  . | . |           .
Sbjct: 314 AIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGC-SHICTDLKIGFECTCPAGFQLLDQK 372

Query: 124 PASCAYPTCFPLTQF----TCNNGRCININWRCDNEKDCGDGSD----ELNCPNPTDPFK 175
                  ||  . .      |.    | .|..   . .|  | .      ||        
Sbjct: 373 -------TCGDIDECKDPDACSQ---ICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK-S 421

Query: 176 PFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSE 235
           | .||.||||.||||| |  .| |.| |.| .|||  .  . .|| |.   |||   . .
Sbjct: 422 PSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDK 481

Query: 236 NGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEH 295
                  .|.|   | .||||||||.  .||| .|    | || .||  | || .  .  
Sbjct: 482 ASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSE 541

Query: 296 PRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRI 355
           |||||.||  | ..|.||     .|| . ..|  |.|.  .  |  ||||.|.| | .|.
Sbjct: 542 PRAIAVDPLRGFMYWSDW-GDQAKIEKSGLNGVDRQTLVSD--NIEWPNGITLDLLSQRL 598

Query: 356 LWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWT 415
            |.|..   . |  . |     ..   ..||||| . ..  .|.|||     .  ||.  
Sbjct: 599 YWVDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLN 658

Query: 416 GSNVTVVQRTNTQPFDLQVYHPSRQPQ 442
           |  ....      | |. ..|  .||.
Sbjct: 659 GLEISILAENLNNPHDIVIFHELKQPR 685

>hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|NP_002325|low
        density lipoprotein receptor-related protein

          Length = 1905

 Score =  235 bits (599), Expect = 9e-062
 Identities = 120/279 (43%), Positives = 174/279 (62%), Gaps = 10/279 (3%)

Query: 175 KPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .| ..|.|| .||..  .. |...|.  | | ||||||  .  ..|.||  |.| |  | 
Sbjct: 439 EPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANL- 497

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
            ||  .. . |.  || .| ||||||.   .|| .|   .|||| |||  |  ||   .|
Sbjct: 498 -NG--SNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLE 554

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            |||||| | .| ..||||  . |||||.|| | ||. |     .  ||||||.||  ||
Sbjct: 555 KPRAIALHPMEGTIYWTDW-GNTPRIEASSMDGSGRRII--ADTHLFWPNGLTIDYAGRR 611

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           . |.||.   |  |  |||    |.   . | ||||.|..   .||||| | ..  |||.
Sbjct: 612 MYWVDAKHHVIERANLDGSHRKAVI--SQGLPHPFAITVFEDSLYWTDWHTKSINSANKF 669

Query: 415 TGSNVTVVQRTNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
           || |  ...     | |.   || ||| |.     ||.|
Sbjct: 670 TGKNQEIIRNKLHFPMDIHTLHPQRQPAGK-NRCGDNNG 707

>hg18||uc001cvl |1|NM_017522|Q5SW66|Q5SW66_HUMAN|LRP8|NM_017522|NP_059992|low
        density lipoprotein receptor-related protein

          Length = 700

 Score =  226 bits (574), Expect = 7e-059
 Identities = 131/445 (29%), Positives = 217/445 (48%), Gaps = 27/445 (6%)

Query:  10 CQAGEFAC--KNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLR 67
           | | . .|   . .|.   |.|||. ||   .|||       ||  | |.| .  |.   
Sbjct: 127 CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDGTCVLAI 186

Query:  68 WLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXXXEPA 125
                          .        |  |   | |  |  . | . |           .  
Sbjct: 187 KHCNQEQDCPDGSDEAGCLQGLNECLHNNGGC-SHICTDLKIGFECTCPAGFQLLDQK-- 243

Query: 126 SCAYPTCFPLTQF----TCNNGRCININWRCDNEKDCGDGSD----ELNCPNPTDPFKPF 177
                ||  . .      |.    | .|..   . .|  | .      ||        | 
Sbjct: 244 -----TCGDIDECKDPDACSQ---ICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK-SPS 294

Query: 178 IIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENG 237
           .||.||||.||||| |  .| |.| |.| .|||  .  . .|| |.   |||   . .  
Sbjct: 295 LIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKAS 354

Query: 238 ALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPR 297
                .|.|   | .||||||||.  .||| .|    | || .||  | || .  .  ||
Sbjct: 355 DPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPR 414

Query: 298 AIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILW 357
           |||.||  | ..|.||     .|| . ..|  |.|.  .  |  ||||.|.| | .|. |
Sbjct: 415 AIAVDPLRGFMYWSDW-GDQAKIEKSGLNGVDRQTLVSD--NIEWPNGITLDLLSQRLYW 471

Query: 358 IDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGS 417
           .|..   . |  . |     ..   ..||||| . ..  .|.|||     .  ||.  | 
Sbjct: 472 VDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGL 531

Query: 418 NVTVVQRTNTQPFDLQVYHPSRQPQ 442
            ....      | |. ..|  .||.
Sbjct: 532 EISILAENLNNPHDIVIFHELKQPR 556

>hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP_002326|low
        density lipoprotein receptor-related protein

          Length = 1615

 Score =  219 bits (556), Expect = 9e-057
 Identities = 119/289 (41%), Positives = 170/289 (58%), Gaps = 10/289 (3%)

Query: 167 CPNPTDPFKPFIIFSNRHEIRRIDLN--KGEFSVLVPGLRNTIALDFHLNQSALYWTDVV 224
           || |     | ..|.|| ..| .|    | | ...| || .  |.||  .. |.||||| 
Sbjct:  25 CPAPA-AASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVS 83

Query: 225 EDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTM 284
           |. | .  |.. ||    .|||  || .|.||| ||.   .|| .|  ..|||| |.|| 
Sbjct:  84 EEAIKQTYLNQTGAAVQ-NVVIS-GLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTS 141

Query: 285 RTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPN 344
           |  |   ... ||||||||  | ..||||    |||| | | |  || |     .  |||
Sbjct: 142 RKVLFWQDLDQPRAIALDPAHGYMYWTDW-GETPRIERAGMDGSTRKII--VDSDIYWPN 198

Query: 345 GLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWR 404
           |||.|  |... | ||.   |. |  |||   .|. |   |.||||.|. |  .|||||.
Sbjct: 199 GLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGS--LTHPFALTLSGDTLYWTDWQ 256

Query: 405 TNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
           | ..   || ||     .      | |.||    |||    .   || |
Sbjct: 257 TRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGG 305

>hg18||uc002mqk |19|NM_000527|P01130|LDLR_HUMAN|LDLR|NM_000527|NP_000518|low
        density lipoprotein receptor precursor

          Length = 860

 Score =  219 bits (556), Expect = 9e-057
 Identities = 133/443 (30%), Positives = 212/443 (47%), Gaps = 24/443 (5%)

Query:  10 CQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWL 69
           |.  || | .  ||    .|| . || | |||   .        ..||| .  || |  .
Sbjct: 236 CRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKV 295

Query:  70 XXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTC----XXXXXXXXXXXE 123
                            |    |  |   | |  |  . | . |               .
Sbjct: 296 CNMARDCRDWSDEPIKECGTNECLDNNGGC-SHVCNDLKIGYECLCPDGFQLVAQRRCED 354

Query: 124 PASCAYP-TCFPLTQFTCNNGRCINI--NWRCDNEKDCGDGSDELNCPNPTDPFKPFIIF 180
              |  | ||  |         |.|.   ..|  |.  |   |             .. |
Sbjct: 355 IDECQDPDTCSQL---------CVNLEGGYKCQCEE--GFQLDPHTKACKAVGSIAYLFF 403

Query: 181 SNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALT 240
           .||||.|.. |.. |.. |.| ||| .|||  .  . .||.|. .  |   .|     ..
Sbjct: 404 TNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVS 463

Query: 241 SFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIA 300
           |.| ||   .  |.|||||||  |||| .| |  . ||   |  | ||       |||| 
Sbjct: 464 SYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIV 523

Query: 301 LDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDA 360
           .||  | ..||||  .  .|.   ..|    ..   | |  ||||.|.| |  |. |.|.
Sbjct: 524 VDPVHGFMYWTDW-GTPAKIKKGGLNGVDIYSL--VTENIQWPNGITLDLLSGRLYWVDS 580

Query: 361 RSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVT 420
           .  .| |   .|     .|   . |.|||.. ..  .|.|||     .  ||. |||.| 
Sbjct: 581 KLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVN 640

Query: 421 VVQRTNTQPFDLQVYHPSRQPQG 443
           ..      | |. ..|   ||.|
Sbjct: 641 LLAENLLSPEDMVLFHNLTQPRG 663

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  216 bits (548), Expect = 7e-056
 Identities = 92/167 (55%), Positives = 108/167 (64%)

Query:    1 NPSYIPPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKN 60
            ||    |  |.|||| |||  ||| |||||||.|||| |||    |  |.|| |.|||.|
Sbjct:  836 NPGEALPHICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQN 895

Query:   61 NRCIPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXX 120
            ||||| |||             || ||.||||  .|.|| .||||| .| |         
Sbjct:  896 NRCIPKRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQ 955

Query:  121 XXEPASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNC 167
              | ||| .||| ||||| | .||||.  | ||.. ||||||||. |
Sbjct:  956 TDEMASCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDEVGC 1002

>hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP_002327|low
        density lipoprotein receptor-related protein

          Length = 1613

 Score =  210 bits (532), Expect = 5e-054
 Identities = 102/280 (36%), Positives = 166/280 (59%), Gaps = 10/280 (3%)

Query: 176 PFIIFSNRHEIRRIDLNKGE--FSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKL 233
           | ....|| ..| .|   |.   ...| || .  |.||  .   .||.|| |. | | . 
Sbjct:  21 PLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEF 80

Query: 234 SENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEV 293
           ..  .. .   |.  || .|.||| ||.   .|| .|  ..|||. |||..|  |   |.
Sbjct:  81 NKTESVQN---VVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQEL 137

Query: 294 EHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER 353
           . ||||||||  | ..||||   .|.|| | | |  |  |        ||||||.|| |.
Sbjct: 138 DQPRAIALDPSSGFMYWTDW-GEVPKIERAGMDGSSRFII--INSEIYWPNGLTLDYEEQ 194

Query: 354 RILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANK 413
           .. | ||. . |. .  ||.    |..|   | ||||.|..   .||||| |...   ||
Sbjct: 195 KLYWADAKLNFIHKSNLDGTNRQAVVKGS--LPHPFALTLFEDILYWTDWSTHSILACNK 252

Query: 414 WTGSNVTVVQRTNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
           .||  .  .      | |.  .   |||       .|| |
Sbjct: 253 YTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGG 292

>hg18||uc001cvm |1|AK122887|NA|NA|LRP8|NM_033300|NP_150643|low density
        lipoprotein receptor-related protein

          Length = 477

 Score =  207 bits (526), Expect = 3e-053
 Identities = 96/267 (35%), Positives = 158/267 (59%), Gaps = 3/267 (1%)

Query: 176 PFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSE 235
           | .||.||||.||||| |  .| |.| |.| .|||  .  . .|| |.   |||   . .
Sbjct:   7 PSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDK 66

Query: 236 NGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEH 295
                  .|.|   | .||||||||.  .||| .|    | || .||  | || .  .  
Sbjct:  67 ASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSE 126

Query: 296 PRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRI 355
           |||||.||  | ..|.||     .|| . ..|  |.|.  .  |  ||||.|.| | .|.
Sbjct: 127 PRAIAVDPLRGFMYWSDW-GDQAKIEKSGLNGVDRQTLVSD--NIEWPNGITLDLLSQRL 183

Query: 356 LWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWT 415
            |.|..   . |  . |     ..   ..||||| . ..  .|.|||     .  ||.  
Sbjct: 184 YWVDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLN 243

Query: 416 GSNVTVVQRTNTQPFDLQVYHPSRQPQ 442
           |  ....      | |. ..|  .||.
Sbjct: 244 GLEISILAENLNNPHDIVIFHELKQPR 270

>hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|NP_002325|low
        density lipoprotein receptor-related protein

          Length = 1905

 Score =  207 bits (525), Expect = 3e-053
 Identities = 114/314 (36%), Positives = 170/314 (54%), Gaps = 22/314 (7%)

Query:  141 NNGRCINI------NWRCDNEKDCGDGSDELNCPNPTDPFKPFIIFSNRHEIRRIDLNKG 194
            ||| | ..      |. |     |  |  ...          |..|. | .||||  .  
Sbjct:  705 NNGGCTHLCLPSGQNYTC----ACPTGFRKISSHACAQSLDKFLLFARRMDIRRISFDTE 760

Query:  195 EFS---VLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLA 251
            . |   . .  .|. .|||.      .|||||  | | | |    |     .||.   | 
Sbjct:  761 DLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTGQ----EVVVDTSLE 816

Query:  252 TPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWT 311
            .| |||.||.   .|| ..  |.||||  ||.||| |.   .. || | ..|  | ..||
Sbjct:  817 SPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWT 876

Query:  312 DWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYD 371
            || || |.|| | |   ||. |   . |  ||||| .||  .|. | ||    |  |  |
Sbjct:  877 DWGAS-PKIERAGMDASGRQVI--ISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLD 933

Query:  372 GSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFD 431
            ||   .|| | . | ||| .|.||  .|||||.| ..  |.. || .   .|       |
Sbjct:  934 GSKR-KVLIGSQ-LPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMD 991

Query:  432 LQVYHPSRQPQGEP 445
            . |.|  | |   |
Sbjct:  992 IHVFHRRRPPVSTP 1005

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  207 bits (525), Expect = 3e-053
 Identities = 143/467 (30%), Positives = 218/467 (46%), Gaps = 50/467 (10%)

Query:    9 QCQAGEFACKNSRC-IQERWKCDGDNDCLDNSDEAP--ELCH--QHTCPTDRFKCKNNRC 63
            ||   ||.| . || .  .|.|||| || |.|||||    |   . .| .  | ||| ||
Sbjct: 2844 QCGTEEFSCADGRCLLNTQWQCDGDFDCPDHSDEAPLNPKCKSAEQSCNSSFFMCKNGRC 2903

Query:   64 IPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRC--IPISWTCXXXXXXXXXX 121
            ||   |              |  |    |   . |  |  |  .|.|. |          
Sbjct: 2904 IPSGGLCDNKDDCGDGSDERN--CHINECLSKKVSGCSQDCQDLPVSYKCKCWPGFQLKD 2961

Query:  122 XEPASCAYPTC---FPLTQFTCNNGRCINI--NWRC----------DNEKDCGDGSDELN 166
                      |   || .|      .|||    ..|          ||   |   |||  
Sbjct: 2962 DGKTCVDIDECSSGFPCSQ------QCINTYGTYKCLCTDGYEIQPDNPNGCKSLSDE-- 3013

Query:  167 CPNPTDPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVED 226
                    .||.| .. ||||.|  .   ...|  || | ||.||   .  .|| |    
Sbjct: 3014 --------EPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSSRP 3065

Query:  227 KIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRT 286
                |       |   |. . .  | |  ||||||  |.|| ..    |||.||.|   |
Sbjct: 3066 ---NGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPT 3122

Query:  287 TLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGL 346
             |..  .. || ..|||. | |.| |     | |    | |  .  . .   .   |  |
Sbjct: 3123 ILVSKRLKFPRDLSLDPQAGYLYWIDC-CEYPHIGRVGMDGTNQSVVIETKISR--PMAL 3179

Query:  347 TVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTN 406
            |.||. ||. | |   . |  .  |||   .|   .. .    |.|..   .|||| .| 
Sbjct: 3180 TIDYVNRRLYWAD--ENHIEFSNMDGSHRHKV--PNQDIPGVIALTLFEDYIYWTDGKTK 3235

Query:  407 TLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
            .|..|.| .|..   .  .     |.||||  |||       . |.|
Sbjct: 3236 SLSRAHKTSGADRLSLIYSWHAITDIQVYHSYRQPDVSKHLCMINNG 3282

>hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|NP_002325|low
        density lipoprotein receptor-related protein

          Length = 1905

 Score =  203 bits (515), Expect = 5e-052
 Identities = 120/286 (41%), Positives = 170/286 (59%), Gaps = 21/286 (7%)

Query:  159 GDGSDELNC-PNPTDPFKPFIIFSNRHEIRRIDLNKGEFS---VLVPGLRNTIALDFHLN 214
            |||     | |.|    . ...||.|  |||| |.  . .   | || | | |.||.   
Sbjct: 1343 GDGK---TCDPSP----ETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSV 1395

Query:  215 QSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQ 274
               .|.|||  | | |  |  ||  .. . ||  || | .||||||.| |.|| ..  . 
Sbjct: 1396 DGKVYYTDVFLDVIRRADL--NG--SNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNT 1451

Query:  275 IEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIH 334
            || ..|||. |  |.   .. |||||. || | ||||||   . .|| |.. |  || . 
Sbjct: 1452 IEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDW-GHIAKIERANLDGSERKVLI 1510

Query:  335 KETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMY 394
                . |||||||.||  ||| |.||  | | ||  .|  | .|| ||  .|||||.|  
Sbjct: 1511 NT--DLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGK-LRQVLVGH--VSHPFALTQQ 1565

Query:  395 GGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQ 440
               .|||||.| .. . .|..| |   |        |. |  | ||
Sbjct: 1566 DRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQ 1611

>hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP_002327|low
        density lipoprotein receptor-related protein

          Length = 1613

 Score =  201 bits (509), Expect = 2e-051
 Identities = 109/281 (38%), Positives = 167/281 (59%), Gaps = 17/281 (6%)

Query: 162 SDELNCPNPTDPFKPFIIFSNRHEIRRIDLNKGEFSVLVP--GLRNTIALDFHLNQSALY 219
           ||   |  |    . |..|| | .|||| |     .| .|  |..   |||| .  . .|
Sbjct: 622 SDMKTCIVP----EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIY 677

Query: 220 WTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAK 279
           |||.    | |  .  ||  .. . |...||  |||.||||.  |.|| ..  ..|||.|
Sbjct: 678 WTDISLKTISRAFM--NG--SALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK 733

Query: 280 LDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGN 339
           |||  |  |.  ... |||.|||| .| ..||.|    |.|. |.| |  | |.     |
Sbjct: 734 LDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEW-GGKPKIDRAAMDGSERTTL---VPN 789

Query: 340 GGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVY 399
            |  ||||.|| .||. | |  .. | |.   |    ||.   . | ||| .| |   .|
Sbjct: 790 VGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNR-EVIA--DDLPHPFGLTQYQDYIY 846

Query: 400 WTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQ 440
           ||||   .. .||| .| | |..|       |. |.| |||
Sbjct: 847 WTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ 887

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  195 bits (494), Expect = 1e-049
 Identities = 102/280 (36%), Positives = 163/280 (58%), Gaps = 11/280 (3%)

Query: 178 IIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALD--FHLNQSALYWTDVVEDKIYRGKLSE 235
           |||||  ..   |..   | .||      .|.   || .   ..||| |..|..   .  
Sbjct: 396 IIFSNGRDLLIGDIHGRSFRILVESQNRGVAVGVAFHYHLQRVFWTDTVQNKVF--SVDI 453

Query: 236 NGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEH 295
           ||   .   |.   . ||| |||||.   || ||. ...|..  |||. | ||.   . |
Sbjct: 454 NG--LNIQEVLNVSVETPENLAVDWVNNKIYLVETKVNRIDMVNLDGSYRVTLITENLGH 511

Query: 296 PRAIALDPRDGILFWTDWD--ASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER 353
           || ||.||  | ||..||.  .  |..| | | |  || . |     ||| |.|.| . .
Sbjct: 512 PRGIAVDPTVGYLFFSDWESLSGEPKLERAFMDGSNRKDLVKT--KLGWPAGVTLDMISK 569

Query: 354 RILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANK 413
           |. |.|.| | | .  |||     |. |   . ||| |... |.|..|||    . ||||
Sbjct: 570 RVYWVDSRFDYIETVTYDGIQRKTVVHGGSLIPHPFGVSLFEGQVFFTDWTKMAVLKANK 629

Query: 414 WTGSNVTVVQRTNTQPFDLQVYHPSRQPQGEPQELVDNDG 453
           .| .|  |  . . .|. . |||  |||        ||.|
Sbjct: 630 FTETNPQVYYQASLRPYGVTVYHSLRQPYA-TNPCKDNNG 668

>hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP_002326|low
        density lipoprotein receptor-related protein

          Length = 1615

 Score =  189 bits (478), Expect = 1e-047
 Identities = 107/307 (34%), Positives = 171/307 (55%), Gaps = 23/307 (7%)

Query: 142 NGRCININWRCDNEKDCGDG------SDELNCPNPTDPFKPFIIFSNRHEIRRIDLNKGE 195
           || | .. .   .   ||        ||   |  |    . |..|..|  | || |    
Sbjct: 609 NGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVP----EAFLVFTSRAAIHRISLETNN 664

Query: 196 FSVLVP--GLRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATP 253
             | .|  |..   |||| .. . .|||||    | |  .  ||  .| . |...||  |
Sbjct: 665 NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM--NG--SSVEHVVEFGLDYP 720

Query: 254 EGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDW 313
           ||.||||.  |.|| ..  ..||||.|||  |  |.  ....||..||||  | ..||.|
Sbjct: 721 EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW 780

Query: 314 DASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGS 373
               |||  | | |    |.  . |     | ||.|| ..|. | |  .. | |.   | 
Sbjct: 781 -GGKPRIVRAFMDGTNCMTLVDKVGRA---NDLTIDYADQRLYWTDLDTNMIESSNMLGQ 836

Query: 374 GLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQ 433
             . .    . | ||| .| |   .|||||  ... .|.| .| | |..|       |. 
Sbjct: 837 ERVVIA---DDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDIL 893

Query: 434 VYHPSRQ 440
           |.| |||
Sbjct: 894 VFHSSRQ 900

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  181 bits (458), Expect = 2e-045
 Identities = 99/275 (36%), Positives = 148/275 (53%), Gaps = 17/275 (6%)

Query:  175 KPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
            .|..|||||. .| . ..   .|... || | .||||   .  ||| |     | |  |.
Sbjct: 3198 EPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKRLYWIDTQRQVIERMFLN 3257

Query:  235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEV- 293
            .    |. . .| . |   | |||||..  .||... || . |. |.|  |  |    | 
Sbjct: 3258 K----TNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLNGGHRRMLAQHCVD 3313

Query:  294 -------EHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGL 346
                   ..|| .|| |. | |.| ||      |    | |  .  |        ||||.
Sbjct: 3314 ANNTFCFDNPRGLALHPQYGYLYWADW-GHRAYIGRVGMDGTNKSVIISTKLE--WPNGI 3370

Query:  347 TVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTN 406
            |.||    . | ||    |  .  .|     |  |   | ||||.|..   .||||| | 
Sbjct: 3371 TIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDG--ALPHPFAITIFEDTIYWTDWNTR 3428

Query:  407 TLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQP 441
            |. | ||. |||   .  |  .|||. |||| |||
Sbjct: 3429 TVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQP 3463

>hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|NP_003374|very
        low density lipoprotein receptor isoform a

          Length = 873

 Score =  181 bits (457), Expect = 3e-045
 Identities = 96/281 (34%), Positives = 154/281 (54%), Gaps = 8/281 (2%)

Query: 175 KPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .| .||.|| .||.| | . |.  ||  ||||.|||  .    |.| |. .  |.   . 
Sbjct: 440 EPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 499

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
           .        | .   .  |  .||||.   ||| ..    | || |||| |  |   .. 
Sbjct: 500 DK---VGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLR 556

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            | .||.||  | ..|.||     .|| | |.|  |. .   | .  ||||.|.| .. |
Sbjct: 557 EPASIAVDPLSGFVYWSDW-GEPAKIEKAGMNGFDRRPL--VTADIQWPNGITLDLIKSR 613

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           . |.|..   . |   .|     ||.  |.|.|| |.|..   ||| |     .  |||.
Sbjct: 614 LYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKF 673

Query: 415 TGSNVTVVQRTNTQPFDLQVYHPSRQPQGEP--QELVDNDG 453
           ||| .  .        |. |||   || |.   .| ..| |
Sbjct: 674 TGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGG 714

>hg18||uc003zhl
        |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_001018056|NP_001018066|ver
        y low density lipoprotein receptor isoform b

          Length = 845

 Score =  181 bits (457), Expect = 3e-045
 Identities = 96/281 (34%), Positives = 154/281 (54%), Gaps = 8/281 (2%)

Query: 175 KPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .| .||.|| .||.| | . |.  ||  ||||.|||  .    |.| |. .  |.   . 
Sbjct: 440 EPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 499

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
           .        | .   .  |  .||||.   ||| ..    | || |||| |  |   .. 
Sbjct: 500 DK---VGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLR 556

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            | .||.||  | ..|.||     .|| | |.|  |. .   | .  ||||.|.| .. |
Sbjct: 557 EPASIAVDPLSGFVYWSDW-GEPAKIEKAGMNGFDRRPL--VTADIQWPNGITLDLIKSR 613

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           . |.|..   . |   .|     ||.  |.|.|| |.|..   ||| |     .  |||.
Sbjct: 614 LYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKF 673

Query: 415 TGSNVTVVQRTNTQPFDLQVYHPSRQPQGEP--QELVDNDG 453
           ||| .  .        |. |||   || |.   .| ..| |
Sbjct: 674 TGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGG 714

>hg18||uc003zhn
        |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_001018056|NP_001018066|very
        low density lipoprotein receptor isoform b

          Length = 804

 Score =  181 bits (457), Expect = 3e-045
 Identities = 96/281 (34%), Positives = 154/281 (54%), Gaps = 8/281 (2%)

Query: 175 KPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .| .||.|| .||.| | . |.  ||  ||||.|||  .    |.| |. .  |.   . 
Sbjct: 399 EPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 458

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
           .        | .   .  |  .||||.   ||| ..    | || |||| |  |   .. 
Sbjct: 459 DK---VGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLR 515

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            | .||.||  | ..|.||     .|| | |.|  |. .   | .  ||||.|.| .. |
Sbjct: 516 EPASIAVDPLSGFVYWSDW-GEPAKIEKAGMNGFDRRPL--VTADIQWPNGITLDLIKSR 572

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           . |.|..   . |   .|     ||.  |.|.|| |.|..   ||| |     .  |||.
Sbjct: 573 LYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKF 632

Query: 415 TGSNVTVVQRTNTQPFDLQVYHPSRQPQGEP--QELVDNDG 453
           ||| .  .        |. |||   || |.   .| ..| |
Sbjct: 633 TGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGG 673

>hg18||uc001cvh |1|AK096482|Q14114-4|Q14114-4|LRP8|NM_001018054|NP_001018064|low
        density lipoprotein receptor-related protein

          Length = 457

 Score =  175 bits (442), Expect = 1e-043
 Identities = 80/240 (33%), Positives = 137/240 (57%), Gaps = 3/240 (1%)

Query: 203 LRNTIALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIA 262
           |.| .|||  .  . .|| |.   |||   . .       .|.|   | .||||||||. 
Sbjct:   2 LKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLHSPEGLAVDWVH 61

Query: 263 GNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEA 322
            .||| .|    | || .||  | || .  .  |||||.||  | ..|.||     .|| 
Sbjct:  62 KHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDW-GDQAKIEK 120

Query: 323 ASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGH 382
           . ..|  |.|.  .  |  ||||.|.| | .|. |.|..   . |  . |     ..   
Sbjct: 121 SGLNGVDRQTLVSD--NIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRKTLISST 178

Query: 383 EYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQ 442
           ..||||| . ..  .|.|||     .  ||.  |  ....      | |. ..|  .||.
Sbjct: 179 DFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPR 238

>hg18||uc001rah |12|NM_002336|O75581|LRP6_HUMAN|LRP6|NM_002336|NP_002327|low
        density lipoprotein receptor-related protein

          Length = 1613

 Score =  173 bits (438), Expect = 4e-043
 Identities = 88/250 (35%), Positives = 148/250 (59%), Gaps = 12/250 (4%)

Query: 178 IIFSNRHEIRRIDLNKGEFSVLV---PGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .. . | ..||| |.  .|. .|     .|. ||.|.   .  .||||     | |  . 
Sbjct: 331 LLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFID 390

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
            .|.      |.   .| |.|.||||.| |.|| ..  |.||| .|.||||  |.. ..|
Sbjct: 391 GSGS----QFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLE 446

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            |||| |||  | ..||||   .|.|| |.. |  |  .     . |||||| .|| | .
Sbjct: 447 EPRAIVLDPMVGYMYWTDW-GEIPKIERAALDGSDRVVL--VNTSLGWPNGLALDYDEGK 503

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           | | ||..| |     ||.|   ..   . . | |  |. |  ||||||.  .. . .| 
Sbjct: 504 IYWGDAKTDKIEVMNTDGTGRRVLV--EDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKR 561

Query: 415 TGSNVTVVQR 424
           .     .. .
Sbjct: 562 SAEREVIIDQ 571

>hg18||uc001ont |11|NM_002335|O75197|LRP5_HUMAN|LRP5|NM_002335|NP_002326|low
        density lipoprotein receptor-related protein

          Length = 1615

 Score =  168 bits (424), Expect = 2e-041
 Identities = 86/250 (34%), Positives = 148/250 (59%), Gaps = 12/250 (4%)

Query: 178 IIFSNRHEIRRIDLNKGEFS---VLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKLS 234
           .. . | ..||| |.  .|.   . |  .|. ||.|.   .  .||||     | |  | 
Sbjct: 344 LLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLD 403

Query: 235 ENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVE 294
            .|| |    ..   .  |.|.||||.| |.|| ..  |.||| .|.|| |  |.. ...
Sbjct: 404 GSGAQT----LVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLD 459

Query: 295 HPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERR 354
            |||||| |  |...||||  . |.|| |.. |. |. .     . |||||| .|  | .
Sbjct: 460 EPRAIALHPVMGLMYWTDWGEN-PKIECANLDGQERRVL--VNASLGWPNGLALDLQEGK 516

Query: 355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
           . | ||..| |     ||.    .|   . | | |  |. |  .|||||.  .. . .| 
Sbjct: 517 LYWGDAKTDKIEVINVDGTKRRTLL--EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKV 574

Query: 415 TGSNVTVVQR 424
             |   .. .
Sbjct: 575 KASRDVIIDQ 584

>hg18||uc001ndn |11|NM_002334|Q5KTZ5|Q5KTZ5_HUMAN|LRP4|NM_002334|NP_002325|low
        density lipoprotein receptor-related protein

          Length = 1905

 Score =  164 bits (415), Expect = 2e-040
 Identities = 95/271 (35%), Positives = 152/271 (56%), Gaps = 15/271 (5%)

Query:  177 FIIFSNRHEIRRIDLNKGEFS-VLVP---GLRNTIALDFHLNQSALYWTDVVEDKIYRGK 232
            |.||. | .|| . |.   |. |.||    ..||||.     .  .||.|    .| |  
Sbjct: 1050 FLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAVGVDPQEGKVYWSDSTLHRISRAN 1109

Query:  233 LSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGE 292
            |      .  . .|  || | .||||| |   .|| ..  ..|||  |||.||  |.   
Sbjct: 1110 LDG----SQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQN 1165

Query:  293 VEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLE 352
            .. |||| |    | ..||||  .  ..| . | |  |  .     | |||||||||   
Sbjct: 1166 LDSPRAIVLYHEMGFMYWTDWGEN-AKLERSGMDGSDRAVL--INNNLGWPNGLTVDKAS 1222

Query:  353 RRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKAN 412
             ..|| || .. | .|  .|.    ..     . ||. .|.    .|||||.| .. .|.
Sbjct: 1223 SQLLWADAHTERIEAADLNGANRHTLV---SPVQHPYGLTLLDSYIYWTDWQTRSIHRAD 1279

Query:  413 KWTGSNVTVVQRTNTQPFDLQVYHPSRQPQG 443
            | ||||| .|.       |.|    . || |
Sbjct: 1280 KGTGSNVILVRSNLPGLMDMQAVDRA-QPLG 1309

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  164 bits (415), Expect = 2e-040
 Identities = 87/237 (36%), Positives = 134/237 (56%), Gaps = 9/237 (3%)

Query:  207 IALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIY 266
            .|.||      ..|.|  . | .     .||  |   ||    .   | .|.||.  |.|
Sbjct: 1469 VAVDFDSISGRIFWSDATQGKTW--SAFQNG--TDRRVVFDSSIILTETIAIDWVGRNLY 1524

Query:  267 WVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPR--DGILFWTDWDASMPRIEAAS 324
            | .  |. |||.|.||. || |..  . .|| .|||||  . .|||.||    |||| ||
Sbjct: 1525 WTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALDPRMNEHLLFWSDW-GHHPRIERAS 1583

Query:  325 MSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEY 384
            | |  |  | ..     || |||.||  | . ..|.  | .    |.|    .|.     
Sbjct: 1584 MDGSMRTVIVQD--KIFWPCGLTIDYPNRLLYFMDSYLDYMDFCDYNGHHRRQVIASDLI 1641

Query:  385 LSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQP 441
            . ||.|.|..   |||||  |  . .|||| | | .||      |  .   |||.||
Sbjct: 1642 IRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVMYNIQWPLGIVAVHPSKQP 1698

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  149 bits (376), Expect = 6e-036
 Identities = 86/230 (37%), Positives = 128/230 (55%), Gaps = 13/230 (5%)

Query:  177 FIIFSNRHEIRRIDLNKGE-FSVLVP--GLRNTIALDFHLNQSALYWTDVVEDKIYRGKL 233
            |...|    || | |   .    |.|  |    . .|||     .||||.  .|| | | 
Sbjct: 1880 FLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAENDTIYWTDMGFNKISRAKR 1939

Query:  234 SENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEV 293
             .    |  . .|  ||   ||.||||||||||| .   . ||||.|.|. |  ...  .
Sbjct: 1940 DQ----TWKEDIITNGLGRVEGIAVDWIAGNIYWTDHGFNLIEVARLNGSFRYVIISQGL 1995

Query:  294 EHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER 353
            . ||.||. |  |.||||.|   || |  | . |   | .    |   ||||...|| | 
Sbjct: 1996 DQPRSIAVHPEKGLLFWTEW-GQMPCIGKARLDG-SEKVVLVSMGI-AWPNGISIDYEEN 2052

Query:  354 RILWIDARSDAIYSAKYDGSGLIE-VLRGHEYLSHPFAVTMYGGEVYWTD 402
            .. | |||.| |     .  |  | || |       |.| ..|  .||.|
Sbjct: 2053 KLYWCDARTDKIERIDLETGGNREMVLSGSNV--DMFSVAVFGAYIYWSD 2100

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  149 bits (374), Expect = 1e-035
 Identities = 92/271 (33%), Positives = 144/271 (53%), Gaps = 16/271 (5%)

Query:  177 FIIFSNRHEIRRIDL---NKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRGKL 233
            |...|    || | |   .| .  | | |    . .|||     .|| |.    | | | 
Sbjct: 1892 FLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKR 1951

Query:  234 SENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEV 293
             .    |  . |.  |.   ||.||||||||||| .   | ||||.|.|. |  ...  .
Sbjct: 1952 DQ----TWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGL 2007

Query:  294 EHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER 353
            . |||| . |  | ||||.|    |||| . . |  |  .   . .  ||||..||| . 
Sbjct: 2008 DKPRAITVHPEKGYLFWTEW-GQYPRIERSRLDGTERVVLVNVSIS--WPNGISVDYQDG 2064

Query:  354 RILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANK 413
            .. | |||.| |     .     ||.     .   |.|...   .||.| ||.      .
Sbjct: 2065 KLYWCDARTDKIERIDLETGENREVVLSSNNMD-MFSVSVFEDFIYWSD-RTHANGSIKR 2122

Query:  414 WTGSNVT--VVQRT--NTQPFDLQVYHPSRQ 440
             .  | |  |  ||    |  |..|..  ||
Sbjct: 2123 GSKDNATDSVPLRTGIGVQLKDIKVFNRDRQ 2153

>hg18||uc001hxo |1|NM_002508|P14543|NID1_HUMAN|NID1|NM_002508|NP_002499|nidogen
        1 precursor

          Length = 1247

 Score =  148 bits (373), Expect = 1e-035
 Identities = 79/202 (39%), Positives = 113/202 (55%), Gaps = 9/202 (4%)

Query:  207 IALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIY 266
            | | |      .||||. |  | |  |      |    .|.  | .|||.||| .  ||.
Sbjct:  981 IGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTT----IIRQDLGSPEGIAVDHLGRNIF 1036

Query:  267 WVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMS 326
            | .||||.||||||||| |  |   .. .|| |  |   | |.||||.   |.|| . | 
Sbjct: 1037 WTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRDNPKIETSYMD 1096

Query:  327 GEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLS 386
            |  |. . ..  . | ||||| |    .. |.|| ..             . | |   | 
Sbjct: 1097 GTNRRILVQD--DLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQPSRRKALEG---LQ 1151

Query:  387 HPFAVTMYGGEVYWTDWRTNTL 408
            .||||| ||  .|.|||. |..
Sbjct: 1152 YPFAVTSYGKNLYFTDWKMNSV 1173

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  146 bits (368), Expect = 5e-035
 Identities = 71/194 (36%), Positives = 114/194 (58%), Gaps = 3/194 (1%)

Query:  249 GLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGIL 308
            ||  | |.|.||.|||.|| .|  | ||||.. |  | ||..| .. | || .||  | .
Sbjct: 3956 GLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTM 4015

Query:  309 FWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSA 368
            .|.||  . |.|| |.| |  |.|. ..  |  || || |||   |. | ||.   | | 
Sbjct: 4016 YWSDW-GNHPKIETAAMDGTLRETLVQD--NIQWPTGLAVDYHNERLYWADAKLSVIGSI 4072

Query:  369 KYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQ 428
            . .|.  |        |||||.. ..   .|   .  | . | .|.  | .  .    . 
Sbjct: 4073 RLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSH 4132

Query:  429 PFDLQVYHPSRQPQ 442
              |. .||  .||.
Sbjct: 4133 ASDVVLYHQHKQPE 4146

>hg18||uc001wzo |14|NM_007361|Q14112|NID2_HUMAN|NID2|NM_007361|NP_031387|nidogen
        2

          Length = 1375

 Score =  145 bits (365), Expect = 1e-034
 Identities = 80/210 (38%), Positives = 120/210 (57%), Gaps = 8/210 (3%)

Query:  207 IALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIY 266
            . .|.   .  .|||||    | |  | | ||    . ..  || .|||||.| |   .|
Sbjct: 1145 VGIDYDCRERMVYWTDVAGRTISRAGL-ELGA--EPETIVNSGLISPEGLAIDHIRRTMY 1201

Query:  267 WVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMS 326
            | .| ||.|| | |||. |  |   .. .|||||.||  | |.||||.   |.|| .|. 
Sbjct: 1202 WTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSLD 1261

Query:  327 GEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLS 386
            || |. .     . | ||||| |   . . | || .  .     ||.|   |.. .  | 
Sbjct: 1262 GENRRILINT--DIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGR-RVIQNN--LK 1316

Query:  387 HPFAVTMYGGEVYWTDWRTNTLAKANKWTG 416
            .||..  |    | |||| . .   || .|
Sbjct: 1317 YPFSIVSYADHFYHTDWRRDGVVSVNKHSG 1346

>hg18||uc003hzy |4|NM_001963|P01133|EGF_HUMAN|EGF|NM_001963|NP_001954|epidermal
        growth factor (beta-urogastrone)

          Length = 1207

 Score =  143 bits (360), Expect = 5e-034
 Identities = 89/299 (29%), Positives = 150/299 (50%), Gaps = 12/299 (4%)

Query: 148 INWRCDNEKDCGDGSDELNCPNPTDPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTI 207
           ..| ||         || .|   . | .||..|.|  .|| .  .  ..  |.      .
Sbjct: 457 VSWECDCFPGYDLQLDEKSCA-ASGP-QPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMV 514

Query: 208 -ALDFHLNQSALYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIY 266
            |||    .. .|.       | |  .      .  . .|. |.  |||||||||    |
Sbjct: 515 YALDHDPVENKIYFAHTALKWIERANMDG----SQRERLIEEGVDVPEGLAVDWIGRRFY 570

Query: 267 WVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMS 326
           | .     |  . |.|     .    .  || ||. |    |||||   . ||||..|. 
Sbjct: 571 WTDRGKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGIN-PRIESSSLQ 629

Query: 327 GEGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLS 386
           | ||  |   . .  ||.|.|.|.|  .. | ||.   |  |  |||    . .    . 
Sbjct: 630 GLGRLVI--ASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQND--VG 685

Query: 387 HPFAVTMYGGEVYWTDWRTNTLAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQGEP 445
           ||||| ..   |...||   .. . || || .   .| .  .|  | | ||  .|  .|
Sbjct: 686 HPFAVAVFEDYVWFSDWAMPSVIRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADP 744

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  141 bits (355), Expect = 2e-033
 Identities = 69/159 (43%), Positives = 86/159 (54%), Gaps = 6/159 (3%)

Query:   10 CQAGEFACKNS-RCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRW 68
            |   || ||.| |||  ||||||..|| | |||  | | . ||   .|.||||||.| ||
Sbjct: 3494 CGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRW 3553

Query:   69 LXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXXXXEPASCA 128
                             .|. | |  ...|||.||||   | |           |   | 
Sbjct: 3554 --QCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDE-KDCT 3610

Query:  129 YPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNC 167
             | |  . || | .| || . |||| . || |||||  |
Sbjct: 3611 -PRC-DMDQFQCKSGHCIPLRWRCDADADCMDGSDEEAC 3647

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  141 bits (353), Expect = 3e-033
 Identities = 69/163 (42%), Positives = 91/163 (55%), Gaps = 7/163 (4%)

Query:   10 CQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWL 69
            | .  | |.|.|||  || ||||||| .. ||.   |   ||| ..| | . ||||. | 
Sbjct:  895 CPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWT 954

Query:   70 XXXXXXXXXXXXXSNTTCSARTC-PPNQYSCASGRCIPISWTCXXXXXXXXXXXEPASCA 128
                         |  .|.  || |  |..| .|||| |.| |           | | |.
Sbjct:  955 CDLDDDCGDRSDES-ASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDE-AGCS 1012

Query:  129 YPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDE--LNCPN 169
            . .|   ||| ||.||||  .| || . |||| |||   || |
Sbjct: 1013 H-SC-SSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTN 1053

>hg18||uc003zhk |9|NM_003383|P98155|VLDLR_HUMAN|VLDLR|NM_003383|NP_003374|very
        low density lipoprotein receptor isoform a

          Length = 873

 Score =  140 bits (351), Expect = 5e-033
 Identities = 68/165 (41%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query:   9 QCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRW 68
           .|.  .| | | |||   |||||| ||.| |||  . | . ||    | | | .|.| ||
Sbjct:  32 KCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDE--KNCVKKTCAESDFVCNNGQCVPSRW 89

Query:  69 LXXXXXXXXXXXXXSNTTCSARTCPPNQYSCA--SGRCIPISWTCXXXXXXXXXXXEPAS 126
                         |   |  |||  .. ||   | .|||.|| |           |  .
Sbjct:  90 KCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDE-EN 148

Query: 127 CAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNPT 171
           |   || |  .|||..||||. |. |. . || ||||||.|  ||
Sbjct: 149 CGNITCSP-DEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPT 192

>hg18||uc003zhl
        |9|NM_001018056|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_001018056|NP_001018066|ver
        y low density lipoprotein receptor isoform b

          Length = 845

 Score =  140 bits (351), Expect = 5e-033
 Identities = 68/165 (41%), Positives = 89/165 (53%), Gaps = 6/165 (3%)

Query:   9 QCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRW 68
           .|.  .| | | |||   |||||| ||.| |||  . | . ||    | | | .|.| ||
Sbjct:  32 KCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDE--KNCVKKTCAESDFVCNNGQCVPSRW 89

Query:  69 LXXXXXXXXXXXXXSNTTCSARTCPPNQYSCA--SGRCIPISWTCXXXXXXXXXXXEPAS 126
                         |   |  |||  .. ||   | .|||.|| |           |  .
Sbjct:  90 KCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDE-EN 148

Query: 127 CAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNPT 171
           |   || |  .|||..||||. |. |. . || ||||||.|  ||
Sbjct: 149 CGNITCSP-DEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPT 192

>hg18||uc003zhn
        |9|CR620590|Q5VVF5|Q5VVF5_HUMAN|VLDLR|NM_001018056|NP_001018066|very
        low density lipoprotein receptor isoform b

          Length = 804

 Score =  140 bits (351), Expect = 5e-033
 Identities = 63/167 (37%), Positives = 83/167 (49%), Gaps = 7/167 (4%)

Query:  10 CQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWL 69
           |   .| | | .|.  ||||||| || | |||.|| |   ||  | | | . |||   ..
Sbjct:  72 CAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCRNITCSPDEFTCSSGRCISRNFV 131

Query:  70 XXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXXXXEP-ASC- 127
                            |.  ||  ... |..  |||||| |           |    | 
Sbjct: 132 --CNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCG 189

Query: 128 ---AYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNPT 171
                 |  | ..  | .| ||.  |||| . || |||||.|||. |
Sbjct: 190 RQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT 236

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  137 bits (344), Expect = 3e-032
 Identities = 85/273 (31%), Positives = 139/273 (50%), Gaps = 18/273 (6%)

Query:  174 FKPFIIFSNRHEIRRIDLNKGEF----SVLVPGLRNTIALDFHLNQSALYWTDVVEDKIY 229
            || |.... . ||| .||.   .    |  || . |   ||.   .  .||.||    | 
Sbjct: 1581 FKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIK 1640

Query:  230 RGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWV--ESNLDQIEVAKLDGTMRTT 287
            |  .  ||  |  . |.   |    ||||||.. |..|   ..|  || ||.|||. .  
Sbjct: 1641 RAFI--NG--TGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNA 1696

Query:  288 LLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLT 347
            .. | .| |  . . |  | |.||| |     |  |.| |  |  .   .|  | | || 
Sbjct: 1697 VVQG-LEQPHGLVVHPLRGKLYWTDGD----NISMANMDGSNRTLLF--SGQKG-PVGLA 1748

Query:  348 VDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNT 407
            .|. | .. || . .  |     |||||  .      |    |. . | ...| |  .  
Sbjct: 1749 IDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLWWADQVSEK 1808

Query:  408 LAKANKWTGSNVTVVQRTNTQPFDLQVYHPSRQ 440
            .   .|  ||   |.. . |    ..||  | |
Sbjct: 1809 MGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQ 1841

>hg18||uc001snd |12|NM_002332|Q07954|LRP1_HUMAN|LRP1|NM_002332|NP_002323|low
        density lipoprotein-related protein 1

          Length = 4544

 Score =  135 bits (338), Expect = 2e-031
 Identities = 67/164 (40%), Positives = 81/164 (49%), Gaps = 5/164 (3%)

Query:    6 PPPQCQAGEFACK-NSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNN-RC 63
            |   |   .| |    |||   | || ||||.| ||| |  | | ||  | |.||.. ||
Sbjct: 3449 PEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDE-PANCTQMTCGVDEFRCKDSGRC 3507

Query:   64 IPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXXXXE 123
            || ||                  |  ||| | |. | . ||.|  | |           |
Sbjct: 3508 IPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDE 3567

Query:  124 PASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNC 167
              ||    |   ..|.| |||||   |.|| . || ||||| .|
Sbjct: 3568 -ESCTPRPCSE-SEFSCANGRCIAGRWKCDGDHDCADGSDEKDC 3609

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  134 bits (335), Expect = 4e-031
 Identities = 67/161 (41%), Positives = 83/161 (51%), Gaps = 7/161 (4%)

Query:   10 CQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWL 69
            |   .| |.|.||| .|| ||| |||  | ||. . |   ||  |.| | | ||||  ||
Sbjct:  886 CPDDQFKCQNNRCIPKRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWL 945

Query:   70 XXXXXXXXXXXXXSNTTCSARTCPP-NQYSCASGRCIPISWTCXXXXXXXXXXXEPASCA 128
                            .|   || |  |. | |||||   | |           |   | 
Sbjct:  946 -CDREDDCGDQTDEMASCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDE-VGCV 1003

Query:  129 YPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDE--LNC 167
            . .||   || |..||||  .| || . |||| |||  .||
Sbjct: 1004 H-SCFD-NQFRCSSGRCIPGHWACDGDNDCGDFSDEAQINC 1042

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  129 bits (324), Expect = 7e-030
 Identities = 70/211 (33%), Positives = 118/211 (55%), Gaps = 8/211 (3%)

Query:  236 NGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEH 295
            |  .   |. ..| .  |.|.||||.  .||| .    .||||||||  |  |.. ... 
Sbjct: 4128 NNLVQEVDLKLKY-VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQ 4186

Query:  296 PRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYLER-R 354
            | |||..|. |..|||||    |.||.| |.|| |  .  |  . ||| ||..|||   |
Sbjct: 4187 PAAIAVNPKLGLMFWTDW-GKEPKIESAWMNGEDRNILVFE--DLGWPTGLSIDYLNNDR 4243

Query:  355 ILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKW 414
            | | | . | | . ||||.    . .      .|... ..  ..||       . | ||.
Sbjct: 4244 IYWSDFKEDVIETIKYDGTDRRVIAK---EAMNPYSLDIFEDQLYWISKEKGEVWKQNKF 4300

Query:  415 TGSNVTVVQRTNTQPFDLQVYHPSRQPQGEP 445
                       |     ....|  |  .  |
Sbjct: 4301 GQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP 4331

>hg18||uc001cvi |1|NM_004631|Q5SW67|Q5SW67_HUMAN|LRP8|NM_004631|NP_004622|low
        density lipoprotein receptor-related protein

          Length = 963

 Score =  127 bits (318), Expect = 3e-029
 Identities = 64/167 (38%), Positives = 82/167 (49%), Gaps = 7/167 (4%)

Query:   6 PPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIP 65
           |   |.  .| |.| |||   |.|| |.||||.|||  . | . ||    | | |  || 
Sbjct:  43 PAKDCEKDQFQCRNERCIPSVWRCDEDDDCLDHSDE--DDCPKKTCADSDFTCDNGHCIH 100

Query:  66 LRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSC--ASGRCIPISWTCXXXXXXXXXXXE 123
            ||              |  ||. . ||  . ||   | .|.| || |           |
Sbjct: 101 ERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADE 160

Query: 124 PASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNP 170
            | ||   | |  .| | |  |.   . || . ||||||||  | .|
Sbjct: 161 -AGCA-TLCAP-HEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADP 204

>hg18||uc001cvj
        |1|NM_001018054|Q5SW65|Q5SW65_HUMAN|LRP8|NM_001018054|NP_001018064|low
        density lipoprotein receptor-related protein

          Length = 904

 Score =  127 bits (318), Expect = 3e-029
 Identities = 64/167 (38%), Positives = 82/167 (49%), Gaps = 7/167 (4%)

Query:   6 PPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIP 65
           |   |.  .| |.| |||   |.|| |.||||.|||  . | . ||    | | |  || 
Sbjct:  43 PAKDCEKDQFQCRNERCIPSVWRCDEDDDCLDHSDE--DDCPKKTCADSDFTCDNGHCIH 100

Query:  66 LRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSC--ASGRCIPISWTCXXXXXXXXXXXE 123
            ||              |  ||. . ||  . ||   | .|.| || |           |
Sbjct: 101 ERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADE 160

Query: 124 PASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNP 170
            | ||   | |  .| | |  |.   . || . ||||||||  | .|
Sbjct: 161 -AGCA-TLCAP-HEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADP 204

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  126 bits (314), Expect = 1e-028
 Identities = 65/158 (41%), Positives = 74/158 (46%), Gaps = 13/158 (8%)

Query:   13 GEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWLXXX 72
            |.| |||  ||  ||.||| ||| |||||  | |    |    |.| | .||| ||.   
Sbjct: 3723 GDFRCKNHHCIPLRWQCDGQNDCGDNSDE--ENCAPRECTESEFRCVNQQCIPSRWI--C 3778

Query:   73 XXXXXXXXXXSNTTCSARTCPPNQYSCASGRCIPISWTCXXXXXXXXXXXEPASCAYPTC 132
                          |  ||| |  . | || |.     |           | | |  || 
Sbjct: 3779 DHYNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDE-ADC--PTR 3835

Query:  133 FP------LTQFTCNNGRCININWRCDNEKDCGDGSDE 164
            ||       | | | |  ||   |.|| . ||||||||
Sbjct: 3836 FPDGAYCQATMFECKNHVCIPPYWKCDGDDDCGDGSDE 3873

>hg18||uc002ues |2|NM_004525|Q7Z5C0|Q7Z5C0_HUMAN|LRP2|NM_004525|NP_004516|low
        density lipoprotein-related protein 2

          Length = 4655

 Score =  125 bits (313), Expect = 1e-028
 Identities = 62/162 (38%), Positives = 75/162 (46%), Gaps = 5/162 (3%)

Query:   10 CQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWL 69
            | . |. | | ||| | |.||  ||| |||||    |   ||   .|.| | ||||  | 
Sbjct: 3594 CDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWK 3653

Query:   70 XXXXXXXXXXXXXSNTTC--SARTCPP-NQYSCASG-RCIPISWTCXXXXXXXXXXXEPA 125
                             |  ||  |    ..|| .  ||||  |             .  
Sbjct: 3654 CDVDNDCGDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIP-KWAVCNGVDDCRDNSDEQ 3712

Query:  126 SCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNC 167
             |   || |.  | | |  || . |.|| . |||| ||| ||
Sbjct: 3713 GCEERTCHPVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENC 3754

>hg18||uc003abs |22|NM_182492|NA|NA|LRP5L|NM_182492|NP_872298|low density
        lipoprotein receptor-related protein

          Length = 252

 Score =  119 bits (296), Expect = 1e-026
 Identities = 63/207 (30%), Positives = 113/207 (54%), Gaps = 9/207 (4%)

Query: 218 LYWTDVVEDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEV 277
           .||||     | |  |  .|| |    .|   .  |. .||.|.| ..||  .  . |||
Sbjct:   5 VYWTDDEVWAIRRAYLDGSGAQT----LINTKINDPDDIAVNWVARSLYWTHTGTEHIEV 60

Query: 278 AKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKET 337
             |. |    |.. ... |||||| |  |. .| ||  . | |. |..  .  . .    
Sbjct:  61 TCLNSTSHKILVSEDMDEPRAIALHPEMGLTYWIDWGEN-PEIKRANLDRQELRVL--VN 117

Query: 338 GNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGE 397
            . |||||| .|  | .. | ||..| | .   | .    .|.  . | | |  |. |  
Sbjct: 118 ASLGWPNGLALDLQEGKLYWGDAKTDKIEAISVDETKRQTLLK--DKLPHIFRFTLLGDF 175

Query: 398 VYWTDWRTNTLAKANKWTGSNVTVVQR 424
           .||| |. ... . .|   .   .. .
Sbjct: 176 IYWTAWQHHSIKRVHKVKANRDVIIDQ 202

>hg18||uc002tvj |2|NM_018557|Q9NZR2|LRP1B_HUMAN|LRP1B|NM_018557|NP_061027|low
        density lipoprotein-related protein 1B

          Length = 4599

 Score =  116 bits (290), Expect = 6e-026
 Identities = 64/179 (35%), Positives = 82/179 (45%), Gaps = 8/179 (4%)

Query:    2 PSYIPPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKC-KN 60
            |   |  .|| | | |    |    . |||.||| |||||    |  | | . .||| ||
Sbjct: 3349 PDDCPEFRCQPGRFQCGTGLCALPAFICDGENDCGDNSDELN--CDTHVCLSGQFKCTKN 3406

Query:   61 NRCIPLRWLXXXXXXXXXXXXXSNTTCSARTCPPNQYSCASGR-CIPISWTCXXXXXXXX 119
             .|||.                    |   .| |. . | . . ||   | |        
Sbjct: 3407 QKCIPVN--LRCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCAD 3464

Query:  120 XXXEPASCAYPTCFPLTQFTCNNGRCININWRCDNEKDCGDGSDELNCPNPTDPFKPFI 178
               | |.|   || |  .| | |  ||  .||||.. || | ||| ||   |   | |.
Sbjct: 3465 ASDE-ANCDKKTCGP-HEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFL 3521

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,183,133
Number of Sequences: 45480
Number of Extensions: 191183133
Number of Successful Extensions: 11127707
Number of sequences better than 0.0: 0
BLASTP 7.6.0