BLASTP 7.6.0


Query=fugu4_744203 |jgi|Takru4|744203|fgh5_pg.C_scaffold_814000002
        (207 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002sna |2|NM_004263|O95754|SEM4F_HUMAN|SEMA4F|NM_004263|...     84   1e-016
hg18||uc002snb |2|AB021292|NA|NA|sema W|NA|NA|Homo sapiens mRNA ...     84   1e-016
hg18||uc002snc |2|AB022317|O95754-2|O95754-2|SEMA4F|NM_004263|NP...     84   1e-016
hg18||uc001fnl |1|AY358531|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|N...     83   2e-016
hg18||uc001fnm |1|NM_022367|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|...     83   2e-016
hg18||uc001fnn |1|AX746794|Q5TCJ6|Q5TCJ6_HUMAN|SEMA4A|NM_022367|...     83   2e-016
hg18||uc001fno |1|AB029394|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|N...     83   2e-016
hg18||uc004aqo |9|NM_006378|Q92854|SEM4D_HUMAN|SEMA4D|NM_006378|...     60   2e-009
hg18||uc004aqp |9|BX648216|Q92854|SEM4D_HUMAN|SEMA4D|NM_006378|N...     60   2e-009
hg18||uc003uhj |7|NM_006379|Q99985|SEM3C_HUMAN|SEMA3C|NM_006379|...     53   3e-007
hg18||uc003cyj |3|NM_004186|Q13275|SEM3F_HUMAN|SEMA3F|NM_004186|...     51   8e-007
hg18||uc003cyk |3|U38276|Q59G50|Q59G50_HUMAN|SEMA3F|NM_004186|NP...     51   1e-006
hg18||uc002onx |19|AF324064|Q71S06|Q71S06_HUMAN|SPTBN4|NM_020971...     32   0.478
hg18||uc002ony |19|AF324063|Q9H254|SPTN4_HUMAN|SPTBN4|NM_020971|...     32   0.478
hg18||uc002onz |19|NM_020971|Q9H254|SPTN4_HUMAN|SPTBN4|NM_020971...     32   0.478
hg18||uc003uva |7|NM_030935|Q9Y3Q8|T22D4_HUMAN|TSC22D4|NM_030935...     28   9.005
hg18||uc003uvc |7|BC031622|Q8IV54|Q8IV54_HUMAN|TSC22D4|NM_030935...     28   9.005

>hg18||uc002sna
        |2|NM_004263|O95754|SEM4F_HUMAN|SEMA4F|NM_004263|NP_004254|semaphorin
        W

          Length = 770

 Score =  84 bits (205), Expect = 1e-016
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 8/204 (3%)

Query:   9 PLLVRKGITYTKL----AVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ 64
           ||||     | ..      . . ..  ||.|||. | |||   .    ..|... |||  
Sbjct: 425 PLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEP 484

Query:  65 EPINNILLHQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVCKETTA 124
           .|. |. |.    ||||   . .|.   ||   ||  |  |.   | |. . . |     
Sbjct: 485 QPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAG 544

Query: 125 EPGS--GDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLSP-RPCSWEHPPD- 180
           |      ||    .      |    | . |. |.    ..|||   |    | |  |   
Sbjct: 545 EHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGV 604

Query: 181 RHTRQHHSSLEMVVSEKSLGKYVC 204
                    ||.||.  ..| | |
Sbjct: 605 TALTPRRDGLEVVVTPGAMGAYAC 628

>hg18||uc002snb |2|AB021292|NA|NA|sema W|NA|NA|Homo sapiens mRNA for semaphorin
        W, splicing variant deleting exons 5 and 6 and causing missense
        frameshift

          Length = 382

 Score =  84 bits (205), Expect = 1e-016
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 8/204 (3%)

Query:   9 PLLVRKGITYTKL----AVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ 64
           ||||     | ..      . . ..  ||.|||. | |||   .    ..|... |||  
Sbjct:  37 PLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEP 96

Query:  65 EPINNILLHQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVCKETTA 124
           .|. |. |.    ||||   . .|.   ||   ||  |  |.   | |. . . |     
Sbjct:  97 QPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAG 156

Query: 125 EPGS--GDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLSP-RPCSWEHPPD- 180
           |      ||    .      |    | . |. |.    ..|||   |    | |  |   
Sbjct: 157 EHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGV 216

Query: 181 RHTRQHHSSLEMVVSEKSLGKYVC 204
                    ||.||.  ..| | |
Sbjct: 217 TALTPRRDGLEVVVTPGAMGAYAC 240

>hg18||uc002snc
        |2|AB022317|O95754-2|O95754-2|SEMA4F|NM_004263|NP_004254|semaphorin W

          Length = 615

 Score =  84 bits (205), Expect = 1e-016
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 8/204 (3%)

Query:   9 PLLVRKGITYTKL----AVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ 64
           ||||     | ..      . . ..  ||.|||. | |||   .    ..|... |||  
Sbjct: 270 PLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEP 329

Query:  65 EPINNILLHQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVCKETTA 124
           .|. |. |.    ||||   . .|.   ||   ||  |  |.   | |. . . |     
Sbjct: 330 QPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAG 389

Query: 125 EPGS--GDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLSP-RPCSWEHPPD- 180
           |      ||    .      |    | . |. |.    ..|||   |    | |  |   
Sbjct: 390 EHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGV 449

Query: 181 RHTRQHHSSLEMVVSEKSLGKYVC 204
                    ||.||.  ..| | |
Sbjct: 450 TALTPRRDGLEVVVTPGAMGAYAC 473

>hg18||uc001fnl
        |1|AY358531|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|NP_071762|semaphorin B

          Length = 761

 Score =  83 bits (204), Expect = 2e-016
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query:   1 MENSVSAAPLLVRKGITYTKLAVTQAE----RKGAVLHLGTDRGELHRVAVV-DQNTTLL 55
           |.  |   ||||. |. ||.|||  |.        |..|||  | ||.  |  | .  |.
Sbjct: 398 MDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLV 457

Query:  56 QEIPLFPSQEPINNILL--HQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWN 113
           .|| |||  ||. |. |   ||   ||    . ||    | .| ||  |  ||   | |.
Sbjct: 458 EEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWD 517

Query: 114 TKEEVC 119
            .   |
Sbjct: 518 PESRTC 523

>hg18||uc001fnm
        |1|NM_022367|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|NP_071762|semaphorin
        B

          Length = 761

 Score =  83 bits (204), Expect = 2e-016
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query:   1 MENSVSAAPLLVRKGITYTKLAVTQAE----RKGAVLHLGTDRGELHRVAVV-DQNTTLL 55
           |.  |   ||||. |. ||.|||  |.        |..|||  | ||.  |  | .  |.
Sbjct: 398 MDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLV 457

Query:  56 QEIPLFPSQEPINNILL--HQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWN 113
           .|| |||  ||. |. |   ||   ||    . ||    | .| ||  |  ||   | |.
Sbjct: 458 EEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWD 517

Query: 114 TKEEVC 119
            .   |
Sbjct: 518 PESRTC 523

>hg18||uc001fnn
        |1|AX746794|Q5TCJ6|Q5TCJ6_HUMAN|SEMA4A|NM_022367|NP_071762|semaphorin
        B

          Length = 629

 Score =  83 bits (204), Expect = 2e-016
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query:   1 MENSVSAAPLLVRKGITYTKLAVTQAE----RKGAVLHLGTDRGELHRVAVV-DQNTTLL 55
           |.  |   ||||. |. ||.|||  |.        |..|||  | ||.  |  | .  |.
Sbjct: 266 MDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLV 325

Query:  56 QEIPLFPSQEPINNILL--HQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWN 113
           .|| |||  ||. |. |   ||   ||    . ||    | .| ||  |  ||   | |.
Sbjct: 326 EEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWD 385

Query: 114 TKEEVC 119
            .   |
Sbjct: 386 PESRTC 391

>hg18||uc001fno
        |1|AB029394|Q9H3S1|SEM4A_HUMAN|SEMA4A|NM_022367|NP_071762|semaphorin B

          Length = 761

 Score =  83 bits (204), Expect = 2e-016
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query:   1 MENSVSAAPLLVRKGITYTKLAVTQAE----RKGAVLHLGTDRGELHRVAVV-DQNTTLL 55
           |.  |   ||||. |. ||.|||  |.        |..|||  | ||.  |  | .  |.
Sbjct: 398 MDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLV 457

Query:  56 QEIPLFPSQEPINNILL--HQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWN 113
           .|| |||  ||. |. |   ||   ||    . ||    | .| ||  |  ||   | |.
Sbjct: 458 EEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWD 517

Query: 114 TKEEVC 119
            .   |
Sbjct: 518 PESRTC 523

>hg18||uc004aqo
        |9|NM_006378|Q92854|SEM4D_HUMAN|SEMA4D|NM_006378|NP_006369|semaphorin
        4D

          Length = 862

 Score =  60 bits (143), Expect = 2e-009
 Identities = 43/171 (25%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query:   9 PLLVRKGITYTKLAVTQAERKGA----VLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ 64
           | |..| . ||.. | . .        |. . |||| ||.   ..    ...|  ||   
Sbjct: 411 PRLIKKDVNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDF 470

Query:  65 EPINNILLHQGR----ALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVC- 119
           ||.  .||   .       ||   . .     || . .|| |  ||   | |.     | 
Sbjct: 471 EPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCV 530

Query: 120 -KETTAEPGSGDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLS 169
               |  |  | .. |      .   .   | |.     |    | | | |
Sbjct: 531 ALHQTESPSRG-LIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKS 580

>hg18||uc004aqp
        |9|BX648216|Q92854|SEM4D_HUMAN|SEMA4D|NM_006378|NP_006369|semaphorin
        4D

          Length = 860

 Score =  60 bits (143), Expect = 2e-009
 Identities = 43/171 (25%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query:   9 PLLVRKGITYTKLAVTQAERKGA----VLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ 64
           | |..| . ||.. | . .        |. . |||| ||.   ..    ...|  ||   
Sbjct: 409 PRLIKKDVNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDF 468

Query:  65 EPINNILLHQGR----ALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVC- 119
           ||.  .||   .       ||   . .     || . .|| |  ||   | |.     | 
Sbjct: 469 EPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCV 528

Query: 120 -KETTAEPGSGDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLS 169
               |  |  | .. |      .   .   | |.     |    | | | |
Sbjct: 529 ALHQTESPSRG-LIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKS 578

>hg18||uc003uhj
        |7|NM_006379|Q99985|SEM3C_HUMAN|SEMA3C|NM_006379|NP_006370|semaphorin
        3C

          Length = 751

 Score =  53 bits (125), Expect = 3e-007
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 13/118 (11%)

Query:   9 PLLVRKG--ITYTKLAVTQ---AERKGAVLHLGTDRGELHRVAVVDQNTT-----LLQEI 58
           ||.|| |    |||.|| .   |. .  || |||||| . .| |.  | .     .|.|.
Sbjct: 418 PLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEEL 477

Query:  59 PLFPSQEPINNILL--HQGRALVGSPLYLARVSAEGCGLY-PSCEVCARARGLGCEWN 113
            .| .  ||  . .   . .  | |   ...||   | .|  .|  |  ||   | |.
Sbjct: 478 EVFKNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWD 535

>hg18||uc003cyj
        |3|NM_004186|Q13275|SEM3F_HUMAN|SEMA3F|NM_004186|NP_004177|semaphorin
        3F

          Length = 785

 Score =  51 bits (121), Expect = 8e-007
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 15/129 (11%)

Query:   9 PLLVRKGITY--TKLAVTQ---AERKGAVLHLGTDRGELHRVAVV-----DQNTTLLQEI 58
           ||.|| |  |  | .|| |   |. .  || |||||| . .| |.     .    .|.|.
Sbjct: 452 PLVVRTGAPYRLTTIAVDQVDAADGRYEVLFLGTDRGTVQKVIVLPKDDQEMEELMLEEV 511

Query:  59 PLFPSQEPINNILLHQGR--ALVGSPLYLARVSAEGCGLY-PSCEVCARARGLGCEWNTK 115
            .|    |.  . .   |    | | . .  .|   |  |  .|  |  ||   | |.  
Sbjct: 512 EVFKDPAPVKTMTISSKRQQLYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWD-- 569

Query: 116 EEVCKETTA 124
            . |   ||
Sbjct: 570 GQACSRYTA 578

>hg18||uc003cyk
        |3|U38276|Q59G50|Q59G50_HUMAN|SEMA3F|NM_004186|NP_004177|semaphorin 3F

          Length = 754

 Score =  51 bits (120), Expect = 1e-006
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query:   9 PLLVRKGITY--TKLAVTQ---AERKGAVLHLGTDRGELHRVAVVDQN-----TTLLQEI 58
           ||.|| |  |  | .|| |   |. .  || |||||| . .| |. ..       .|.|.
Sbjct: 421 PLVVRTGAPYRLTTIAVDQVDAADGRYEVLFLGTDRGTVQKVIVLPKDDQELEELMLEEV 480

Query:  59 PLFPSQEPINNILLHQGR--ALVGSPLYLARVSAEGCGLY-PSCEVCARARGLGCEWNTK 115
            .|    |.  . .   |    | | . .  .|   |  |  .|  |  ||   | |.  
Sbjct: 481 EVFKDPAPVKTMTISSKRQQLYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWD-- 538

Query: 116 EEVCKETTA 124
            . |   ||
Sbjct: 539 GQACSRYTA 547

>hg18||uc002onx
        |19|AF324064|Q71S06|Q71S06_HUMAN|SPTBN4|NM_020971|NP_066022|spectrin,
        beta, non-erythrocytic 4 isoform

          Length = 2002

 Score =  32 bits (71), Expect = 0.478
 Identities = 23/83 (27%), Positives = 33/83 (39%)

Query:   12 VRKGITYTKLAVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQEPINNIL 71
            ||  .   . ||  | | |  |       |    |.  .   ||.|  |   . |     
Sbjct:  999 VRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAAR 1058

Query:   72 LHQGRALVGSPLYLARVSAEGCG 94
            ||||   .|.       .|. ||
Sbjct: 1059 LHQGAEELGAEWGALASAAQACG 1081

>hg18||uc002ony
        |19|AF324063|Q9H254|SPTN4_HUMAN|SPTBN4|NM_020971|NP_066022|spectrin,
        beta, non-erythrocytic 4 isoform

          Length = 2564

 Score =  32 bits (71), Expect = 0.478
 Identities = 23/83 (27%), Positives = 33/83 (39%)

Query:   12 VRKGITYTKLAVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQEPINNIL 71
            ||  .   . ||  | | |  |       |    |.  .   ||.|  |   . |     
Sbjct:  999 VRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAAR 1058

Query:   72 LHQGRALVGSPLYLARVSAEGCG 94
            ||||   .|.       .|. ||
Sbjct: 1059 LHQGAEELGAEWGALASAAQACG 1081

>hg18||uc002onz
        |19|NM_020971|Q9H254|SPTN4_HUMAN|SPTBN4|NM_020971|NP_066022|spectrin,
        beta, non-erythrocytic 4 isoform

          Length = 2564

 Score =  32 bits (71), Expect = 0.478
 Identities = 23/83 (27%), Positives = 33/83 (39%)

Query:   12 VRKGITYTKLAVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQEPINNIL 71
            ||  .   . ||  | | |  |       |    |.  .   ||.|  |   . |     
Sbjct:  999 VRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAAR 1058

Query:   72 LHQGRALVGSPLYLARVSAEGCG 94
            ||||   .|.       .|. ||
Sbjct: 1059 LHQGAEELGAEWGALASAAQACG 1081

>hg18||uc003uva
        |7|NM_030935|Q9Y3Q8|T22D4_HUMAN|TSC22D4|NM_030935|NP_112197|TSC22
        domain family 4

          Length = 395

 Score =  28 bits (60), Expect = 9.005
 Identities = 22/59 (37%), Positives = 24/59 (40%)

Query: 121 ETTAEPGSGDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLSPRPCSWEHPP 179
           |   || |   . | .|    | |  |   |    ||||    |   ||  | ||  ||
Sbjct:  97 ERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPP 155

>hg18||uc003uvc
        |7|BC031622|Q8IV54|Q8IV54_HUMAN|TSC22D4|NM_030935|NP_112197|TSC22
        domain family 4

          Length = 310

 Score =  28 bits (60), Expect = 9.005
 Identities = 22/59 (37%), Positives = 24/59 (40%)

Query: 121 ETTAEPGSGDIVDEALRKCVIGEGRCSPSIREMRVSLGLRLLLPCVQLSPRPCSWEHPP 179
           |   || |   . | .|    | |  |   |    ||||    |   ||  | ||  ||
Sbjct:  97 ERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPP 155

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,424,984
Number of Sequences: 45480
Number of Extensions: 65424984
Number of Successful Extensions: 5071428
Number of sequences better than 0.0: 0
BLASTP 7.6.0