BLASTP 7.6.0


Query=fugu4_743886 |jgi|Takru4|743886|fgh5_pg.C_scaffold_670000003
        (224 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001gwm |1|NM_005558|Q96GD8|Q96GD8_HUMAN|LAD1|NM_005558|N...     41   0.001
hg18||uc001uyl |13|NM_178009|Q86XP1|DGKH_HUMAN|DGKH|NM_178009|NP...     39   0.006
hg18||uc001uym |13|NM_152910|Q86XP1-2|Q86XP1-2|DGKH|NM_152910|NP...     39   0.006
hg18||uc002ysb |21|AF380183|P18583-6|P18583-6|SON|NM_032195|NP_1...     38   0.008
hg18||uc002ysc |21|NM_032195|P18583-3|P18583-3|SON|NM_032195|NP_...     38   0.008
hg18||uc002ysd |21|AF380179|NA|NA|KIAA1019|NA|NA|Homo sapiens mR...     38   0.008
hg18||uc002yse |21|NM_138927|P18583|SON_HUMAN|SON|NM_138927|NP_6...     38   0.008
hg18||uc002ysg |21|AF139897|NA|NA|SON|NM_032195|NP_115571|SON DN...     38   0.008
hg18||uc001gwm |1|NM_005558|Q96GD8|Q96GD8_HUMAN|LAD1|NM_005558|N...     37   0.013
hg18||uc002vui |2|NM_152879|Q16760|DGKD_HUMAN|DGKD|NM_152879|NP_...     37   0.017
hg18||uc004fbg |X|NM_004065|Q5JXH6|Q5JXH6_HUMAN|CDR1|NM_004065|N...     34   0.144
hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sort...     33   0.245
hg18||uc002obt |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|N...     33   0.245
hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sort...     33   0.245
hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sort...     32   0.547
hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sort...     32   0.547
hg18||uc002obt |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|N...     32   0.547
hg18||uc002obt |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|N...     32   0.547
hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sort...     32   0.547
hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sort...     32   0.547
hg18||uc001yqk |14|AK124665|NA|NA|BRF1|NM_145685|NP_663718|trans...     30   1.591
hg18||uc001yql |14|NM_145685|Q92994-3|Q92994-3|BRF1|NM_145685|NP...     30   1.591
hg18||uc001yqo |14|AK096471|Q92994-3|Q92994-3|BRF1|NM_145685|NP_...     30   1.591
hg18||uc001yqp |14|NM_001519|Q92994|TF3B_HUMAN|BRF1|NM_001519|NP...     30   1.591
hg18||uc001guh |1|NM_001024594|Q5VUE5|CA053_HUMAN|C1orf53|NM_001...     30   2.078
hg18||uc001qis |12|NM_134424|P43351|RAD52_HUMAN|RAD52|NM_134424|...     30   2.714
hg18||uc001qiu |12|L33262|P43351|RAD52_HUMAN|RAD52|NM_134424|NP_...     30   2.714
hg18||uc001qiw |12|BC114507|NA|NA|RAD52|NM_134424|NP_602296|RAD5...     30   2.714
hg18||uc002cks |16|NM_021098|O95180|CAC1H_HUMAN|CACNA1H|NM_02109...     29   3.545
hg18||uc002ckt |16|NM_001005407|O95180-2|O95180-2|CACNA1H|NM_001...     29   3.545
hg18||uc002qxl |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|N...     29   4.630
hg18||uc002qxm |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|N...     29   4.630
hg18||uc002qxn |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP...     29   4.630
hg18||uc002qxl |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|N...     28   6.047
hg18||uc002qxm |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|N...     28   6.047
hg18||uc002qxn |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP...     28   6.047
hg18||uc002qxl |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|N...     28   7.897
hg18||uc002qxm |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|N...     28   7.897
hg18||uc002qxn |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP...     28   7.897

>hg18||uc001gwm
        |1|NM_005558|Q96GD8|Q96GD8_HUMAN|LAD1|NM_005558|NP_005549|ladinin 1

          Length = 517

 Score =  41 bits (94), Expect = 0.001
 Identities = 36/113 (31%), Positives = 51/113 (45%), Gaps = 3/113 (2%)

Query: 107 SVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPL 166
           |.|| .  ||  ..|| .||||    ||  .||.  .|||             . |||  
Sbjct: 201 SISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAPGMALGSGRRLVSEKA 260

Query: 167 AVSEPLAVSE--PLAVLEPLAVLEPQAWSEPLALLEPQAWSEPLAVSEPLARS 217
           .. |    ||  | |  .| |     |  .|||   | .   |    |   |.
Sbjct: 261 SIFEKALASEKSPTADAKP-APKRATASEQPLAQEPPASGGSPATTKEQRGRA 312

>hg18||uc001uyl
        |13|NM_178009|Q86XP1|DGKH_HUMAN|DGKH|NM_178009|NP_821077|diacylglycerol
        kinase, eta isoform 2

          Length = 1220

 Score =  39 bits (88), Expect = 0.006
 Identities = 18/26 (69%), Positives = 22/26 (84%)

Query: 30 PQKLIRKVSTSGQIRSKINLRNCQFL 55
          |||||||||||||||.| ...  | |
Sbjct: 48 PQKLIRKVSTSGQIRTKTSIKEGQLL 73

>hg18||uc001uym
        |13|NM_152910|Q86XP1-2|Q86XP1-2|DGKH|NM_152910|NP_690874|diacylglycerol
        kinase, eta isoform 1

          Length = 1164

 Score =  39 bits (88), Expect = 0.006
 Identities = 18/26 (69%), Positives = 22/26 (84%)

Query: 30 PQKLIRKVSTSGQIRSKINLRNCQFL 55
          |||||||||||||||.| ...  | |
Sbjct: 48 PQKLIRKVSTSGQIRTKTSIKEGQLL 73

>hg18||uc002ysb |21|AF380183|P18583-6|P18583-6|SON|NM_032195|NP_115571|SON
        DNA-binding protein isoform B

          Length = 2108

 Score =  38 bits (87), Expect = 0.008
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query:  100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEP 159
            |||.  |  |  .|| |  ||.   . .  .  |  . ||.|  |. |    ||  | ||
Sbjct: 1346 PPAM-AAPESSAMAVLESSAVTVLESSTVTVLESSTVTVLEPSVVTVP----EPPVVAEP 1400

Query:  160 QAVSEPLAVSEPLAVSEPLAVLEP-LAVLEP 189
              |. |. |   |  | |  |||| ..||.|
Sbjct: 1401 DYVTIPVPVVSALEPSVP--VLEPAVSVLQP 1429

>hg18||uc002ysc |21|NM_032195|P18583-3|P18583-3|SON|NM_032195|NP_115571|SON
        DNA-binding protein isoform B

          Length = 2303

 Score =  38 bits (87), Expect = 0.008
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query:  100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEP 159
            |||.  |  |  .|| |  ||.   . .  .  |  . ||.|  |. |    ||  | ||
Sbjct: 1346 PPAM-AAPESSAMAVLESSAVTVLESSTVTVLESSTVTVLEPSVVTVP----EPPVVAEP 1400

Query:  160 QAVSEPLAVSEPLAVSEPLAVLEP-LAVLEP 189
              |. |. |   |  | |  |||| ..||.|
Sbjct: 1401 DYVTIPVPVVSALEPSVP--VLEPAVSVLQP 1429

>hg18||uc002ysd |21|AF380179|NA|NA|KIAA1019|NA|NA|Homo sapiens mRNA for KIAA1019
        protein, partial cds

          Length = 1450

 Score =  38 bits (87), Expect = 0.008
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query: 100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEP 159
           |||.  |  |  .|| |  ||.   . .  .  |  . ||.|  |. |    ||  | ||
Sbjct: 337 PPAM-AAPESSAMAVLESSAVTVLESSTVTVLESSTVTVLEPSVVTVP----EPPVVAEP 391

Query: 160 QAVSEPLAVSEPLAVSEPLAVLEP-LAVLEP 189
             |. |. |   |  | |  |||| ..||.|
Sbjct: 392 DYVTIPVPVVSALEPSVP--VLEPAVSVLQP 420

>hg18||uc002yse |21|NM_138927|P18583|SON_HUMAN|SON|NM_138927|NP_620305|SON
        DNA-binding protein isoform F

          Length = 2426

 Score =  38 bits (87), Expect = 0.008
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query:  100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEP 159
            |||.  |  |  .|| |  ||.   . .  .  |  . ||.|  |. |    ||  | ||
Sbjct: 1346 PPAM-AAPESSAMAVLESSAVTVLESSTVTVLESSTVTVLEPSVVTVP----EPPVVAEP 1400

Query:  160 QAVSEPLAVSEPLAVSEPLAVLEP-LAVLEP 189
              |. |. |   |  | |  |||| ..||.|
Sbjct: 1401 DYVTIPVPVVSALEPSVP--VLEPAVSVLQP 1429

>hg18||uc002ysg |21|AF139897|NA|NA|SON|NM_032195|NP_115571|SON DNA-binding
        protein isoform B

          Length = 1273

 Score =  38 bits (87), Expect = 0.008
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query: 100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEP 159
           |||.  |  |  .|| |  ||.   . .  .  |  . ||.|  |. |    ||  | ||
Sbjct: 337 PPAM-AAPESSAMAVLESSAVTVLESSTVTVLESSTVTVLEPSVVTVP----EPPVVAEP 391

Query: 160 QAVSEPLAVSEPLAVSEPLAVLEP-LAVLEP 189
             |. |. |   |  | |  |||| ..||.|
Sbjct: 392 DYVTIPVPVVSALEPSVP--VLEPAVSVLQP 420

>hg18||uc001gwm
        |1|NM_005558|Q96GD8|Q96GD8_HUMAN|LAD1|NM_005558|NP_005549|ladinin 1

          Length = 517

 Score =  37 bits (85), Expect = 0.013
 Identities = 48/175 (27%), Positives = 74/175 (42%), Gaps = 20/175 (11%)

Query:  60 SASPARTWLWPGTKRSDLELLFRDRNTRNN------------GAE----RPNTRQHPPAL 103
           | || .    |   . .||.  | | .|              | |    .    .  | |
Sbjct: 121 SLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVL 180

Query: 104 HGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVS 163
             .|. .  |  . | ||.  ..|| .  ||  .. . .||||    ||  .|||  .||
Sbjct: 181 EKSSMPKKTAPEKSL-VSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVS 239

Query: 164 EPLAVSEPLAVSEPLAVLEPLAVLEPQAWSE--PLALLEPQAWSEPLAVSEPLAR 216
           |          |    | |  .. |    ||  | |  .| |     |  .|||.
Sbjct: 240 EKSLAPGMALGSGRRLVSEKASIFEKALASEKSPTADAKP-APKRATASEQPLAQ 293

>hg18||uc002vui
        |2|NM_152879|Q16760|DGKD_HUMAN|DGKD|NM_152879|NP_690618|diacylglycerol
        kinase, delta 130kDa isoform 2

          Length = 1214

 Score =  37 bits (84), Expect = 0.017
 Identities = 17/19 (89%), Positives = 18/19 (94%)

Query: 28 GTPQKLIRKVSTSGQIRSK 46
          |.||||||||||||||| |
Sbjct: 34 GSPQKLIRKVSTSGQIRQK 52

>hg18||uc004fbg
        |X|NM_004065|Q5JXH6|Q5JXH6_HUMAN|CDR1|NM_004065|NP_004056|cerebellar
        degeneration-related protein 1,

          Length = 262

 Score =  34 bits (76), Expect = 0.144
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 111 PLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSE 170
           ||    ||    ||    ||   |  . |. . . | .|. | . .||     | |  ||
Sbjct:  14 PLLEDIPLLEDVPLLEDVPLL--EDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSE 71

Query: 171 PLAVSEPLAVLEPLAVLEPQAWSEPLALLE 200
            . . |    || .  ||  |  | . |||
Sbjct:  72 AMDLREDKDFLEDMDSLEDMALLEDVDLLE 101

>hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 867

 Score =  33 bits (74), Expect = 0.245
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 122 EPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVL 181
           .|   . | |   | .   |    . ..   | .   | |    | .||||||| | |||
Sbjct: 754 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLAVSVPPAVL 808

Query: 182 EPLAVLEPQAWSEPLALLEP 201
           | |      | . |   | |
Sbjct: 809 ELLGAGGAPASATPTPALSP 828

>hg18||uc002obt
        |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|NP_443180|sorting nexin
        26

          Length = 1123

 Score =  33 bits (74), Expect = 0.245
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 122 EPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVL 181
           .|   . | |   | .   |    . ..   | .   | |    | .||||||| | |||
Sbjct: 618 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLAVSVPPAVL 672

Query: 182 EPLAVLEPQAWSEPLALLEP 201
           | |      | . |   | |
Sbjct: 673 ELLGAGGAPASATPTPALSP 692

>hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 875

 Score =  33 bits (74), Expect = 0.245
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 122 EPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVL 181
           .|   . | |   | .   |    . ..   | .   | |    | .||||||| | |||
Sbjct: 342 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLAVSVPPAVL 396

Query: 182 EPLAVLEPQAWSEPLALLEP 201
           | |      | . |   | |
Sbjct: 397 ELLGAGGAPASATPTPALSP 416

>hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 867

 Score =  32 bits (71), Expect = 0.547
 Identities = 28/94 (29%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query:  90 GAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA 149
           |   |     |||        | .   |    . ..   | . . | |    | .|||||
Sbjct: 753 GDPAPPASPAPPA--------PASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLA 800

Query: 150 VSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVLEP 183
           || | ||||        | . |     |   | |
Sbjct: 801 VSVPPAVLELLGAGGAPASATPTPALSPGRSLRP 834

>hg18||uc002obr |19|BC128586|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 867

 Score =  32 bits (71), Expect = 0.547
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 110 EPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA--VSEPLAVLEPQAVSEPLA 167
           .|   . | |   | .   |    . ..   | . . | |  .||||||  | || | | 
Sbjct: 754 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAVSVPPAVLELLG 812

Query: 168 VSEPLAVSEPLAVLEPLAVLEP 189
                | . |   | |   | |
Sbjct: 813 AGGAPASATPTPALSPGRSLRP 834

>hg18||uc002obt
        |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|NP_443180|sorting nexin
        26

          Length = 1123

 Score =  32 bits (71), Expect = 0.547
 Identities = 28/94 (29%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query:  90 GAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA 149
           |   |     |||        | .   |    . ..   | . . | |    | .|||||
Sbjct: 617 GDPAPPASPAPPA--------PASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLA 664

Query: 150 VSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVLEP 183
           || | ||||        | . |     |   | |
Sbjct: 665 VSVPPAVLELLGAGGAPASATPTPALSPGRSLRP 698

>hg18||uc002obt
        |19|AK127255|O14559|TCGAP_HUMAN|SNX26|NM_052948|NP_443180|sorting nexin
        26

          Length = 1123

 Score =  32 bits (71), Expect = 0.547
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 110 EPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA--VSEPLAVLEPQAVSEPLA 167
           .|   . | |   | .   |    . ..   | . . | |  .||||||  | || | | 
Sbjct: 618 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAVSVPPAVLELLG 676

Query: 168 VSEPLAVSEPLAVLEPLAVLEP 189
                | . |   | |   | |
Sbjct: 677 AGGAPASATPTPALSPGRSLRP 698

>hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 875

 Score =  32 bits (71), Expect = 0.547
 Identities = 28/94 (29%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query:  90 GAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA 149
           |   |     |||        | .   |    . ..   | . . | |    | .|||||
Sbjct: 341 GDPAPPASPAPPA--------PASAFPPRVTPQAISPRGPTSPASPAA----LDISEPLA 388

Query: 150 VSEPLAVLEPQAVSEPLAVSEPLAVSEPLAVLEP 183
           || | ||||        | . |     |   | |
Sbjct: 389 VSVPPAVLELLGAGGAPASATPTPALSPGRSLRP 422

>hg18||uc002obv |19|AL137579|NA|NA|SNX26|NM_052948|NP_443180|sorting nexin 26

          Length = 875

 Score =  32 bits (71), Expect = 0.547
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 110 EPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLA--VSEPLAVLEPQAVSEPLA 167
           .|   . | |   | .   |    . ..   | . . | |  .||||||  | || | | 
Sbjct: 342 DPAPPASP-APPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAVSVPPAVLELLG 400

Query: 168 VSEPLAVSEPLAVLEPLAVLEP 189
                | . |   | |   | |
Sbjct: 401 AGGAPASATPTPALSPGRSLRP 422

>hg18||uc001yqk |14|AK124665|NA|NA|BRF1|NM_145685|NP_663718|transcription
        initiation factor IIIB isoform 3

          Length = 203

 Score =  30 bits (67), Expect = 1.591
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query:  29 TPQKLIRKVSTSGQIRSKINLRNCQFLGPGGSASPARTWLWPGTKRSDLELLFRDRNTRN 88
           | .. | |.    .| ||||    . |   |  || |    |    |  .|  |      
Sbjct:  46 TAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASR 105

Query:  89 NGAERPNT---RQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVL 139
           .||.   .   |  |  |     .. .|  | |  | |   .||   . | |||
Sbjct: 106 SGADPVTSVGKRLRP--LVSTQPAKKVATGEALLPSSPTLGAEP---ARPQAVL 154

>hg18||uc001yql
        |14|NM_145685|Q92994-3|Q92994-3|BRF1|NM_145685|NP_663718|transcription
        initiation factor IIIB isoform 3

          Length = 473

 Score =  30 bits (67), Expect = 1.591
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query:  29 TPQKLIRKVSTSGQIRSKINLRNCQFLGPGGSASPARTWLWPGTKRSDLELLFRDRNTRN 88
           | .. | |.    .| ||||    . |   |  || |    |    |  .|  |      
Sbjct: 316 TAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASR 375

Query:  89 NGAERPNT---RQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVL 139
           .||.   .   |  |  |     .. .|  | |  | |   .||   . | |||
Sbjct: 376 SGADPVTSVGKRLRP--LVSTQPAKKVATGEALLPSSPTLGAEP---ARPQAVL 424

>hg18||uc001yqo
        |14|AK096471|Q92994-3|Q92994-3|BRF1|NM_145685|NP_663718|transcription
        initiation factor IIIB isoform 3

          Length = 439

 Score =  30 bits (67), Expect = 1.591
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query:  29 TPQKLIRKVSTSGQIRSKINLRNCQFLGPGGSASPARTWLWPGTKRSDLELLFRDRNTRN 88
           | .. | |.    .| ||||    . |   |  || |    |    |  .|  |      
Sbjct: 282 TAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASR 341

Query:  89 NGAERPNT---RQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVL 139
           .||.   .   |  |  |     .. .|  | |  | |   .||   . | |||
Sbjct: 342 SGADPVTSVGKRLRP--LVSTQPAKKVATGEALLPSSPTLGAEP---ARPQAVL 390

>hg18||uc001yqp
        |14|NM_001519|Q92994|TF3B_HUMAN|BRF1|NM_001519|NP_001510|transcription
        initiation factor IIIB isoform 1

          Length = 677

 Score =  30 bits (67), Expect = 1.591
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query:  29 TPQKLIRKVSTSGQIRSKINLRNCQFLGPGGSASPARTWLWPGTKRSDLELLFRDRNTRN 88
           | .. | |.    .| ||||    . |   |  || |    |    |  .|  |      
Sbjct: 520 TAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASR 579

Query:  89 NGAERPNT---RQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVL 139
           .||.   .   |  |  |     .. .|  | |  | |   .||   . | |||
Sbjct: 580 SGADPVTSVGKRLRP--LVSTQPAKKVATGEALLPSSPTLGAEP---ARPQAVL 628

>hg18||uc001guh
        |1|NM_001024594|Q5VUE5|CA053_HUMAN|C1orf53|NM_001024594|NP_001019765|hy
        pothetical protein LOC388722

          Length = 145

 Score =  30 bits (66), Expect = 2.078
 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query:  57 PGGSASPARTWLWPGTKRSDLELLFRDRNTRNNGAERPNTRQHPPALHGASVSEPLAVSE 116
           |  .  ||  |.  |  |  | |     |  | |   |.|   |      |||| |  .|
Sbjct:  18 PSAAPPPAPLWVRAGF-RQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSEELTAAE 76

>hg18||uc001qis |12|NM_134424|P43351|RAD52_HUMAN|RAD52|NM_134424|NP_602296|RAD52
        homolog

          Length = 418

 Score =  30 bits (65), Expect = 2.714
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query:  82 RDRNTRNNGAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKP 141
           | .  .    ||   .|   .   |  ||    . |.  | |. |||||   . || .  
Sbjct: 260 RQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQ 319

Query: 142 LAVSEPLAVSEPLAVLEP--QAVSEPLAVSEPLAVSEPLAV 180
             .      ||  ||       | .| . ..|   |. ||.
Sbjct: 320 ELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL 360

>hg18||uc001qiu |12|L33262|P43351|RAD52_HUMAN|RAD52|NM_134424|NP_602296|RAD52
        homolog

          Length = 418

 Score =  30 bits (65), Expect = 2.714
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query:  82 RDRNTRNNGAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKP 141
           | .  .    ||   .|   .   |  ||    . |.  | |. |||||   . || .  
Sbjct: 260 RQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQ 319

Query: 142 LAVSEPLAVSEPLAVLEP--QAVSEPLAVSEPLAVSEPLAV 180
             .      ||  ||       | .| . ..|   |. ||.
Sbjct: 320 ELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL 360

>hg18||uc001qiw |12|BC114507|NA|NA|RAD52|NM_134424|NP_602296|RAD52 homolog

          Length = 187

 Score =  30 bits (65), Expect = 2.714
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query:  82 RDRNTRNNGAERPNTRQHPPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKP 141
           | .  .    ||   .|   .   |  ||    . |.  | |. |||||   . || .  
Sbjct:  49 RQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQ 108

Query: 142 LAVSEPLAVSEPLAVLEP--QAVSEPLAVSEPLAVSEPLAV 180
             .      ||  ||       | .| . ..|   |. ||.
Sbjct: 109 ELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL 149

>hg18||uc002cks
        |16|NM_021098|O95180|CAC1H_HUMAN|CACNA1H|NM_021098|NP_066921|calcium
        channel, voltage-dependent, T type,

          Length = 2353

 Score =  29 bits (64), Expect = 3.545
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 7/76 (9%)

Query:  100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPL-------AVSE 152
            |||   ||.  ||||| |    |||    |   .   .. . |   | .        .  
Sbjct: 1971 PPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS 2030

Query:  153 PLAVLEPQAVSEPLAV 168
            |   |.|    |   |
Sbjct: 2031 PRDTLDPAEPGEKTPV 2046

>hg18||uc002ckt
        |16|NM_001005407|O95180-2|O95180-2|CACNA1H|NM_001005407|NP_001005407|ca
        lcium channel, voltage-dependent, T type,

          Length = 2347

 Score =  29 bits (64), Expect = 3.545
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 7/76 (9%)

Query:  100 PPALHGASVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPL-------AVSE 152
            |||   ||.  ||||| |    |||    |   .   .. . |   | .        .  
Sbjct: 1965 PPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS 2024

Query:  153 PLAVLEPQAVSEPLAV 168
            |   |.|    |   |
Sbjct: 2025 PRDTLDPAEPGEKTPV 2040

>hg18||uc002qxl
        |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 373

 Score =  29 bits (63), Expect = 4.630
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 166 LAVSEPLAVSEPLAVLEPLAVLEPQAWSEPLALLEPQAWSEPLAVSEPLA 215
           ..|| | | |   |   ||||   .   ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQA-AAPPASPEPFA 281

>hg18||uc002qxm
        |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 735

 Score =  29 bits (63), Expect = 4.630
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 166 LAVSEPLAVSEPLAVLEPLAVLEPQAWSEPLALLEPQAWSEPLAVSEPLA 215
           ..|| | | |   |   ||||   .   ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQA-AAPPASPEPFA 281

>hg18||uc002qxn
        |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopept
        ide repeat domain 15

          Length = 735

 Score =  29 bits (63), Expect = 4.630
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 166 LAVSEPLAVSEPLAVLEPLAVLEPQAWSEPLALLEPQAWSEPLAVSEPLA 215
           ..|| | | |   |   ||||   .   ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQA-AAPPASPEPFA 281

>hg18||uc002qxl
        |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 373

 Score =  28 bits (62), Expect = 6.047
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 124 LAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLA 173
           ..|| | | |   |   ||||       ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFA 281

>hg18||uc002qxm
        |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 735

 Score =  28 bits (62), Expect = 6.047
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 124 LAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLA 173
           ..|| | | |   |   ||||       ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFA 281

>hg18||uc002qxn
        |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopept
        ide repeat domain 15

          Length = 735

 Score =  28 bits (62), Expect = 6.047
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 124 LAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPLAVSEPLA 173
           ..|| | | |   |   ||||       ||.|.  ||| . | |  || |
Sbjct: 233 ISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFA 281

>hg18||uc002qxl
        |2|CR610194|Q53S18|Q53S18_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 373

 Score =  28 bits (61), Expect = 7.897
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 107 SVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPL 166
           ||| | | |   |   ||||       ||.|.  | | . | |  || | ..        
Sbjct: 234 SVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFAHIQAVFAGSDD 292

Query: 167 AVSEPLAVSE 176
             .  |..||
Sbjct: 293 PFATALSMSE 302

>hg18||uc002qxm
        |2|NM_016030|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopep
        tide repeat domain 15

          Length = 735

 Score =  28 bits (61), Expect = 7.897
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 107 SVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPL 166
           ||| | | |   |   ||||       ||.|.  | | . | |  || | ..        
Sbjct: 234 SVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFAHIQAVFAGSDD 292

Query: 167 AVSEPLAVSE 176
             .  |..||
Sbjct: 293 PFATALSMSE 302

>hg18||uc002qxn
        |2|AK098327|Q8WVT3|TTC15_HUMAN|TTC15|NM_016030|NP_057114|tetratricopept
        ide repeat domain 15

          Length = 735

 Score =  28 bits (61), Expect = 7.897
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 107 SVSEPLAVSEPLAVSEPLAVSEPLAVSEPLAVLKPLAVSEPLAVSEPLAVLEPQAVSEPL 166
           ||| | | |   |   ||||       ||.|.  | | . | |  || | ..        
Sbjct: 234 SVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPP-ASPEPFAHIQAVFAGSDD 292

Query: 167 AVSEPLAVSE 176
             .  |..||
Sbjct: 293 PFATALSMSE 302

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,108,535
Number of Sequences: 45480
Number of Extensions: 193108535
Number of Successful Extensions: 11085428
Number of sequences better than 0.0: 0
BLASTP 7.6.0