BLASTP 7.6.0


Query=fugu4_743798 |jgi|Takru4|743798|fgh5_pg.C_scaffold_644000002
        (314 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002eei |16|NM_182493|Q32MK0|MYLK3_HUMAN|MLCK|NM_182493|N...     32   0.702
hg18||uc002eej |16|BC039103|NA|NA|MLCK|NM_182493|NP_872299|MLCK ...     32   1.198
hg18||uc004dpj |X|NM_203407|Q86X51|Q86X51_HUMAN|LOC340602|NM_203...     31   2.043
hg18||uc001ujl |12|NM_015409|Q96L91-2|Q96L91-2|EP400|NM_015409|N...     30   3.485
hg18||uc001ujm |12|AB040931|NA|NA|EP400|NM_015409|NP_056224|E1A ...     30   3.485
hg18||uc001ujn |12|AY044869|Q96L91-2|Q96L91-2|EP400|NM_015409|NP...     30   3.485
hg18||uc003dlv |3|AF032105|O15265|ATX7_HUMAN|ATXN7|NM_000333|NP_...     30   3.485
hg18||uc003dlw |3|NM_000333|O15265|ATX7_HUMAN|ATXN7|NM_000333|NP...     30   3.485
hg18||uc002miq |19|NM_001080403|NA|NA|FLJ22184|NM_001080403|NP_0...     30   4.551
hg18||uc003yqr |8|NM_058229|Q969P5|FBX32_HUMAN|FBXO32|NM_058229|...     30   4.551
hg18||uc004dpj |X|NM_203407|Q86X51|Q86X51_HUMAN|LOC340602|NM_203...     30   4.551
hg18||uc002obo |19|BC017947|Q8WWC8|Q8WWC8_HUMAN|C19orf55|NM_0010...     29   5.944
hg18||uc002obp |19|AL833894|Q8NDI3|Q8NDI3_HUMAN|C19orf55|NM_0010...     29   5.944
hg18||uc002obq |19|NM_001039887|NA|NA|C19orf55|NM_001039887|NP_0...     29   5.944
hg18||uc003zuy |9|NM_001017363|NA|NA|ARID3C|NM_001017363|NP_0010...     29   5.944
hg18||uc002ypd |21|NM_020706|O95104|SFR15_HUMAN|SFRS15|NM_020706...     29   7.763
hg18||uc002ype |21|AL834304|O95104-2|O95104-2|SFRS15|NM_020706|N...     29   7.763

>hg18||uc002eei |16|NM_182493|Q32MK0|MYLK3_HUMAN|MLCK|NM_182493|NP_872299|MLCK
        protein

          Length = 795

 Score =  32 bits (72), Expect = 0.702
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query:  25 QSWASPGPVLVQSWASLGPVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPGPVLDQS 84
           |   .|| .|.    |||| | .  |   |      |  |.   .||     ||    . 
Sbjct: 316 QEMDTPGEMLMTGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPG---TEPGEQTPEG 372

Query:  85 WSNPGPVLGQSWTSPGAI 102
                |.  |  .||| .
Sbjct: 373 ARELSPL--QESSSPGGV 388

>hg18||uc002eej |16|BC039103|NA|NA|MLCK|NM_182493|NP_872299|MLCK protein

          Length = 305

 Score =  32 bits (70), Expect = 1.198
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 5/74 (6%)

Query:  29 SPGPVLVQSWASLGPVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPGPVLDQSWSNP 88
           .|| .|.    |||| | .  |   |      |  |.   .||     ||    .     
Sbjct:   3 TPGEMLMTGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPG---TEPGEQTPEGAREL 59

Query:  89 GPVLGQSWTSPGAI 102
            |.  |  .||| .
Sbjct:  60 SPL--QESSSPGGV 71

>hg18||uc004dpj
        |X|NM_203407|Q86X51|Q86X51_HUMAN|LOC340602|NM_203407|NP_981952|hypothet
        ical protein LOC340602

          Length = 503

 Score =  31 bits (68), Expect = 2.043
 Identities = 18/60 (30%), Positives = 26/60 (43%)

Query: 166 SSPGPVLVQSWASLGPVLEQSWTSPGPVQGQSWASLGPVLEQSWTSPGPVQGQSWASPGP 225
           | ||||.    |  ||      |   | .    .. ||      . ||| .    ..|||
Sbjct: 229 SGPGPVIRGCTAQPGPAFPHRATHLDPARLSPESAPGPARRGRASVPGPARRGCDSAPGP 288

>hg18||uc001ujl |12|NM_015409|Q96L91-2|Q96L91-2|EP400|NM_015409|NP_056224|E1A
        binding protein p400

          Length = 3122

 Score =  30 bits (66), Expect = 3.485
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query:   43 PVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPGPVLDQ 83
            | | .||||. |. .  | | |   . |     || |.  |
Sbjct: 1630 PYLRAPGPVVMQTVSQAGAVHGALGSKPPAGGPSPAPLTPQ 1670

>hg18||uc001ujm |12|AB040931|NA|NA|EP400|NM_015409|NP_056224|E1A binding protein
        p400

          Length = 1780

 Score =  30 bits (66), Expect = 3.485
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query:   43 PVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPGPVLDQ 83
            | | .||||. |. .  | | |   . |     || |.  |
Sbjct: 1550 PYLRAPGPVVMQTVSQAGAVHGALGSKPPAGGPSPAPLTPQ 1590

>hg18||uc001ujn |12|AY044869|Q96L91-2|Q96L91-2|EP400|NM_015409|NP_056224|E1A
        binding protein p400

          Length = 3123

 Score =  30 bits (66), Expect = 3.485
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query:   43 PVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPGPVLDQ 83
            | | .||||. |. .  | | |   . |     || |.  |
Sbjct: 1631 PYLRAPGPVVMQTVSQAGAVHGALGSKPPAGGPSPAPLTPQ 1671

>hg18||uc003dlv |3|AF032105|O15265|ATX7_HUMAN|ATXN7|NM_000333|NP_000324|ataxin
        7

          Length = 892

 Score =  30 bits (66), Expect = 3.485
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 213 GPVQGQSWASPGPVLGQSRASPGP--VLGQSWTTWSDGSTL 251
           ||    . |.    .|. |  | |  .|||||  | . | |
Sbjct:  64 GPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKL 104

>hg18||uc003dlw |3|NM_000333|O15265|ATX7_HUMAN|ATXN7|NM_000333|NP_000324|ataxin
        7

          Length = 892

 Score =  30 bits (66), Expect = 3.485
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 213 GPVQGQSWASPGPVLGQSRASPGP--VLGQSWTTWSDGSTL 251
           ||    . |.    .|. |  | |  .|||||  | . | |
Sbjct:  64 GPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKL 104

>hg18||uc002miq
        |19|NM_001080403|NA|NA|FLJ22184|NM_001080403|NP_001073872|hypothetical
        protein LOC80164

          Length = 1152

 Score =  30 bits (65), Expect = 4.551
 Identities = 27/100 (27%), Positives = 39/100 (39%), Gaps = 12/100 (12%)

Query:   8 RPWGVQDPQGQIGPVLCQSWASPG-----PVLVQSWASLGPVLASPGPVLGQSWTSPGPV 62
           || |   |   . |   .   . |     |.  ..    |  .    |  | . ||  | 
Sbjct: 251 RPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGGIGGATIPESAPRAGPTRTSRPPA 310

Query:  63 LGQSWTSPGQSWASPGPVLDQSWSNPGPVLGQSWTSPGAI 102
            |.   .|     |||||     |.||   |   | || .
Sbjct: 311 SGRGERAPPAKNTSPGPV-----SSPGRASGT--TRPGPL 343

>hg18||uc003yqr |8|NM_058229|Q969P5|FBX32_HUMAN|FBXO32|NM_058229|NP_478136|F-box
        only protein 32 isoform 1

          Length = 355

 Score =  30 bits (65), Expect = 4.551
 Identities = 10/14 (71%), Positives = 11/14 (78%)

Query: 61 PVLGQSWTSPGQSW 74
          | ||| | ||||.|
Sbjct:  2 PFLGQDWRSPGQNW 15

>hg18||uc004dpj
        |X|NM_203407|Q86X51|Q86X51_HUMAN|LOC340602|NM_203407|NP_981952|hypothet
        ical protein LOC340602

          Length = 503

 Score =  30 bits (65), Expect = 4.551
 Identities = 24/91 (26%), Positives = 31/91 (34%)

Query: 146 SWASPGPVLDQSWPVLGQSWSSPGPVLVQSWASLGPVLEQSWTSPGPVQGQSWASLGPVL 205
           | ||      |  | |    |   |        .   | .  . ||||     |  ||  
Sbjct: 187 SGASTSSQATQPGPALLSHASEARPATRSRITLVASALRRRASGPGPVIRGCTAQPGPAF 246

Query: 206 EQSWTSPGPVQGQSWASPGPVLGQSRASPGP 236
               |   | .    ..|||      . |||
Sbjct: 247 PHRATHLDPARLSPESAPGPARRGRASVPGP 277

>hg18||uc002obo
        |19|BC017947|Q8WWC8|Q8WWC8_HUMAN|C19orf55|NM_001039887|NP_001034976|hyp
        othetical protein LOC148137

          Length = 194

 Score =  29 bits (64), Expect = 5.944
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 158 WPVLGQSWSSPGPVLVQSWASLGPVLEQSWTSPGPVQGQSWASLGPVLEQSWTSPGPVQG 217
           ||   |.|        .|  |  |   ..  . ||   . .    |    . . |   .|
Sbjct:  26 WPSQSQTWCPKTLSPSRSQRSRLPQAPKA-LATGPNSPELFEESWPSSSGTPSLPSTTEG 84

Query: 218 QSWASPGPVL 227
           | |||| | |
Sbjct:  85 QMWASPAPTL 94

>hg18||uc002obp
        |19|AL833894|Q8NDI3|Q8NDI3_HUMAN|C19orf55|NM_001039887|NP_001034976|hyp
        othetical protein LOC148137

          Length = 193

 Score =  29 bits (64), Expect = 5.944
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 158 WPVLGQSWSSPGPVLVQSWASLGPVLEQSWTSPGPVQGQSWASLGPVLEQSWTSPGPVQG 217
           ||   |.|        .|  |  |   ..  . ||   . .    |    . . |   .|
Sbjct:  26 WPSQSQTWCPKTLSPSRSQRSRLPQAPKA-LATGPNSPELFEESWPSSSGTPSLPSTTEG 84

Query: 218 QSWASPGPVL 227
           | |||| | |
Sbjct:  85 QMWASPAPTL 94

>hg18||uc002obq
        |19|NM_001039887|NA|NA|C19orf55|NM_001039887|NP_001034976|hypothetical
        protein LOC148137

          Length = 425

 Score =  29 bits (64), Expect = 5.944
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 158 WPVLGQSWSSPGPVLVQSWASLGPVLEQSWTSPGPVQGQSWASLGPVLEQSWTSPGPVQG 217
           ||   |.|        .|  |  |   ..  . ||   . .    |    . . |   .|
Sbjct:  26 WPSQSQTWCPKTLSPSRSQRSRLPQAPKA-LATGPNSPELFEESWPSSSGTPSLPSTTEG 84

Query: 218 QSWASPGPVL 227
           | |||| | |
Sbjct:  85 QMWASPAPTL 94

>hg18||uc003zuy |9|NM_001017363|NA|NA|ARID3C|NM_001017363|NP_001017363|AT rich
        interactive domain 3C (BRIGHT- like)

          Length = 412

 Score =  29 bits (64), Expect = 5.944
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query:  48 PGPVLGQSWTSPGPVLGQSWTSPGQSWA--SPGPVLDQSWSNPGPVL 92
           |||    . .||||  | .   |  . |  || |.  .    | | |
Sbjct: 252 PGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCL 298

>hg18||uc002ypd
        |21|NM_020706|O95104|SFR15_HUMAN|SFRS15|NM_020706|NP_065757|splicing
        factor, arginine/serine-rich 15

          Length = 1147

 Score =  29 bits (63), Expect = 7.763
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query:  43 PVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPG 78
           | .  |  .||    .||||.|    | |   | ||
Sbjct: 820 PPVTQPVSLLGTQGVAPGPVIGLQAPSTGLLGARPG 855

>hg18||uc002ype
        |21|AL834304|O95104-2|O95104-2|SFRS15|NM_020706|NP_065757|splicing
        factor, arginine/serine-rich 15

          Length = 1125

 Score =  29 bits (63), Expect = 7.763
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query:  43 PVLASPGPVLGQSWTSPGPVLGQSWTSPGQSWASPG 78
           | .  |  .||    .||||.|    | |   | ||
Sbjct: 798 PPVTQPVSLLGTQGVAPGPVIGLQAPSTGLLGARPG 833

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,631,354
Number of Sequences: 45480
Number of Extensions: 191631354
Number of Successful Extensions: 11116211
Number of sequences better than 0.0: 0
BLASTP 7.6.0