BLASTP 7.6.0


Query=fugu4_742979 |jgi|Takru4|742979|fgh5_pg.C_scaffold_493000003
        (239 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003ggv |4|NM_002926|O14924-4|O14924-4|RGS12|NM_002926|NP...     32   0.793
hg18||uc003ggw |4|NM_198229|O14924|RGS12_HUMAN|RGS12|NM_198229|N...     32   0.793
hg18||uc003ggy |4|BC118594|Q8WX95|Q8WX95_HUMAN|RGS12|NA|NA|RGS12...     32   0.793
hg18||uc003ggz |4|NM_198227|O14924-3|O14924-3|RGS12|NM_198227|NP...     32   0.793
hg18||uc003gha |4|AF030110|O14924-2|O14924-2|RGS12|NM_198227|NP_...     32   0.793
hg18||uc003ghb |4|AK123325|NA|NA|RGS12|NA|NA|Homo sapiens regula...     32   0.793
hg18||uc001cjr |1|NM_002840|P10586|PTPRF_HUMAN|PTPRF|NM_002840|N...     30   1.766
hg18||uc001cjs |1|NM_130440|Q86WS0|Q86WS0_HUMAN|PTPRF|NM_130440|...     30   1.766
hg18||uc001cju |1|AB177856|Q5W9G3|Q5W9G3_HUMAN|PTPRF|NM_002840|N...     30   1.766
hg18||uc001cjv |1|AK125325|Q59FI2|Q59FI2_HUMAN|PTPRF|NM_130440|N...     30   1.766
hg18||uc001cjw |1|BX537361|Q7Z3X4|Q7Z3X4_HUMAN|PTPRF|NM_130440|N...     30   1.766
hg18||uc002poq |19|AK024444|Q9H7N4|Q9H7N4_HUMAN|SR-A1|NM_021228|...     30   1.766
hg18||uc002por |19|NM_021228|Q9NR59|Q9NR59_HUMAN|SR-A1|NM_021228...     30   1.766
hg18||uc002ydo |20|AJ271337|Q9UL49-2|Q9UL49-2|TCFL5|NM_006602|NP...     29   3.935
hg18||uc002ydp |20|NM_006602|Q9UL49|TCFL5_HUMAN|TCFL5|NM_006602|...     29   3.935
hg18||uc001bzz |1|NM_018067|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067...     28   6.713
hg18||uc001caa |1|AK096341|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067|...     28   6.713
hg18||uc001cab |1|BC057293|Q9ULN3|Q9ULN3_HUMAN|MAP7D1|NM_018067|...     28   6.713
hg18||uc001cac |1|BC067256|Q6NX58|Q6NX58_HUMAN|MAP7D1|NM_018067|...     28   6.713
hg18||uc001cad |1|AK095939|Q8N905|Q8N905_HUMAN|MAP7D1|NM_018067|...     28   6.713
hg18||uc001wip |14|BX247975|Q9UKV3-3|Q9UKV3-3|ACIN1|NM_014977|NP...     28   6.713
hg18||uc001wiq |14|AF124727|Q9UKV3-3|Q9UKV3-3|ACIN1|NM_014977|NP...     28   6.713
hg18||uc001wir |14|AF124728|Q9UKV3-2|Q9UKV3-2|ACIN1|NM_014977|NP...     28   6.713
hg18||uc001wis |14|BC032770|Q9UKV3|ACINU_HUMAN|ACIN1|NM_014977|N...     28   6.713
hg18||uc001wit |14|NM_014977|Q9UKV3|ACINU_HUMAN|ACIN1|NM_014977|...     28   6.713
hg18||uc003uxx |7|NM_003378|Q9UDW8|Q9UDW8_HUMAN|VGF|NM_003378|NP...     28   6.713

>hg18||uc003ggv
        |4|NM_002926|O14924-4|O14924-4|RGS12|NM_002926|NP_002917|regulator of
        G-protein signalling 12 isoform 2

          Length = 1376

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 903 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 942

>hg18||uc003ggw
        |4|NM_198229|O14924|RGS12_HUMAN|RGS12|NM_198229|NP_937872|regulator of
        G-protein signalling 12 isoform 1

          Length = 1447

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 903 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 942

>hg18||uc003ggy |4|BC118594|Q8WX95|Q8WX95_HUMAN|RGS12|NA|NA|RGS12TS-S isoform

          Length = 555

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 301 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 340

>hg18||uc003ggz
        |4|NM_198227|O14924-3|O14924-3|RGS12|NM_198227|NP_937870|regulator of
        G-protein signalling 12 isoform 3

          Length = 799

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 255 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 294

>hg18||uc003gha
        |4|AF030110|O14924-2|O14924-2|RGS12|NM_198227|NP_937870|regulator of
        G-protein signalling 12 isoform 3

          Length = 789

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 245 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 284

>hg18||uc003ghb |4|AK123325|NA|NA|RGS12|NA|NA|Homo sapiens regulator of G
        protein signaling 12 (RGS12) mRNA, complete cds

          Length = 393

 Score =  32 bits (70), Expect = 0.793
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query:  57 TGNTGRSDRERRTGDEADDAAEQTGDEQQR-SRGQAERSG 95
           | .|||| ..|  || ||||    |   .| |.|    .|
Sbjct: 102 TRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAG 141

>hg18||uc001cjr
        |1|NM_002840|P10586|PTPRF_HUMAN|PTPRF|NM_002840|NP_002831|protein
        tyrosine phosphatase, receptor type, F

          Length = 1907

 Score =  30 bits (67), Expect = 1.766
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query:   71 DEADDAAEQTGDEQQRSRGQAERSGP 96
            ||  .| || |.||.| | ||||  |
Sbjct: 1160 DELLEAIEQGGEEQRRRRRQAERLKP 1185

>hg18||uc001cjs
        |1|NM_130440|Q86WS0|Q86WS0_HUMAN|PTPRF|NM_130440|NP_569707|protein
        tyrosine phosphatase, receptor type, F

          Length = 1898

 Score =  30 bits (67), Expect = 1.766
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query:   71 DEADDAAEQTGDEQQRSRGQAERSGP 96
            ||  .| || |.||.| | ||||  |
Sbjct: 1151 DELLEAIEQGGEEQRRRRRQAERLKP 1176

>hg18||uc001cju
        |1|AB177856|Q5W9G3|Q5W9G3_HUMAN|PTPRF|NM_002840|NP_002831|protein
        tyrosine phosphatase, receptor type, F

          Length = 1296

 Score =  30 bits (67), Expect = 1.766
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query:  71 DEADDAAEQTGDEQQRSRGQAERSGP 96
           ||  .| || |.||.| | ||||  |
Sbjct: 538 DELLEAIEQGGEEQRRRRRQAERLKP 563

>hg18||uc001cjv
        |1|AK125325|Q59FI2|Q59FI2_HUMAN|PTPRF|NM_130440|NP_569707|protein
        tyrosine phosphatase, receptor type, F

          Length = 1378

 Score =  30 bits (67), Expect = 1.766
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query:  71 DEADDAAEQTGDEQQRSRGQAERSGP 96
           ||  .| || |.||.| | ||||  |
Sbjct: 620 DELLEAIEQGGEEQRRRRRQAERLKP 645

>hg18||uc001cjw
        |1|BX537361|Q7Z3X4|Q7Z3X4_HUMAN|PTPRF|NM_130440|NP_569707|protein
        tyrosine phosphatase, receptor type, F

          Length = 1133

 Score =  30 bits (67), Expect = 1.766
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query:  71 DEADDAAEQTGDEQQRSRGQAERSGP 96
           ||  .| || |.||.| | ||||  |
Sbjct: 386 DELLEAIEQGGEEQRRRRRQAERLKP 411

>hg18||uc002poq
        |19|AK024444|Q9H7N4|Q9H7N4_HUMAN|SR-A1|NM_021228|NP_067051|serine
        arginine-rich pre-mRNA splicing factor

          Length = 1312

 Score =  30 bits (67), Expect = 1.766
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query:  46 RANRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQ 99
           |  |..     | ..  | |||  |   |    .   .. ||||. .||| | .
Sbjct: 608 RRRRSASPPPATSSSSSSRRERHRGKHRDGGGSKKKKKRSRSRGE-KRSGDGSE 660

>hg18||uc002por
        |19|NM_021228|Q9NR59|Q9NR59_HUMAN|SR-A1|NM_021228|NP_067051|serine
        arginine-rich pre-mRNA splicing factor

          Length = 1312

 Score =  30 bits (67), Expect = 1.766
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query:  46 RANRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQ 99
           |  |..     | ..  | |||  |   |    .   .. ||||. .||| | .
Sbjct: 608 RRRRSASPPPATSSSSSSRRERHRGKHRDGGGSKKKKKRSRSRGE-KRSGDGSE 660

>hg18||uc002ydo
        |20|AJ271337|Q9UL49-2|Q9UL49-2|TCFL5|NM_006602|NP_006593|transcription
        factor-like 5 protein

          Length = 273

 Score =  29 bits (64), Expect = 3.935
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query:  34 KLGPLVMTFISTRANRNSGRQGNTGNTGRSDRERRT---GDEADDAAEQTGDEQQRSRGQ 90
           |.|   .   . . ||.  || .|    |.  | .    |  |   | |. .  | . |.
Sbjct: 102 KVGEAALCKQALKRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGE 161

Query:  91 AERSGPGEQTGTRNAEAEAVVRDRR 115
             .|||      |      . ||||
Sbjct: 162 QAQSGPQGGRSQRRERHNRMERDRR 186

>hg18||uc002ydp
        |20|NM_006602|Q9UL49|TCFL5_HUMAN|TCFL5|NM_006602|NP_006593|transcriptio
        n factor-like 5 protein

          Length = 500

 Score =  29 bits (64), Expect = 3.935
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query:  34 KLGPLVMTFISTRANRNSGRQGNTGNTGRSDRERRT---GDEADDAAEQTGDEQQRSRGQ 90
           |.|   .   . . ||.  || .|    |.  | .    |  |   | |. .  | . |.
Sbjct: 329 KVGEAALCKQALKRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGE 388

Query:  91 AERSGPGEQTGTRNAEAEAVVRDRR 115
             .|||      |      . ||||
Sbjct: 389 QAQSGPQGGRSQRRERHNRMERDRR 413

>hg18||uc001bzz
        |1|NM_018067|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067|NP_060537|arginine/pr
        oline rich coiled-coil 1

          Length = 841

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query:  58 GNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAER-SGPGEQTGTRNAEAEA 109
           | | | .  |   ..   | ||   |.|  | ||||     |.   | ||| |
Sbjct: 592 GTTDREEATRLLAEKRRQAREQREREEQERRLQAERDKRMREEQLAREAEARA 644

>hg18||uc001caa
        |1|AK096341|Q3KQU3|Q3KQU3_HUMAN|MAP7D1|NM_018067|NP_060537|arginine/pro
        line rich coiled-coil 1

          Length = 808

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query:  58 GNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAER-SGPGEQTGTRNAEAEA 109
           | | | .  |   ..   | ||   |.|  | ||||     |.   | ||| |
Sbjct: 560 GTTDREEATRLLAEKRRQAREQREREEQERRLQAERDKRMREEQLAREAEARA 612

>hg18||uc001cab
        |1|BC057293|Q9ULN3|Q9ULN3_HUMAN|MAP7D1|NM_018067|NP_060537|arginine/pro
        line rich coiled-coil 1

          Length = 803

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query:  58 GNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAER-SGPGEQTGTRNAEAEA 109
           | | | .  |   ..   | ||   |.|  | ||||     |.   | ||| |
Sbjct: 555 GTTDREEATRLLAEKRRQAREQREREEQERRLQAERDKRMREEQLAREAEARA 607

>hg18||uc001cac
        |1|BC067256|Q6NX58|Q6NX58_HUMAN|MAP7D1|NM_018067|NP_060537|arginine/pro
        line rich coiled-coil 1

          Length = 540

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query:  58 GNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAER-SGPGEQTGTRNAEAEA 109
           | | | .  |   ..   | ||   |.|  | ||||     |.   | ||| |
Sbjct: 292 GTTDREEATRLLAEKRRQAREQREREEQERRLQAERDKRMREEQLAREAEARA 344

>hg18||uc001cad
        |1|AK095939|Q8N905|Q8N905_HUMAN|MAP7D1|NM_018067|NP_060537|arginine/pro
        line rich coiled-coil 1

          Length = 377

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query:  58 GNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAER-SGPGEQTGTRNAEAEA 109
           | | | .  |   ..   | ||   |.|  | ||||     |.   | ||| |
Sbjct: 129 GTTDREEATRLLAEKRRQAREQREREEQERRLQAERDKRMREEQLAREAEARA 181

>hg18||uc001wip
        |14|BX247975|Q9UKV3-3|Q9UKV3-3|ACIN1|NM_014977|NP_055792|apoptotic
        chromatin condensation inducer 1

          Length = 583

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query:  48 NRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQTGTRNAEA 107
           ||   |.    ..   ||||    | |        |. | ||. ||     .  .|.   
Sbjct: 514 NRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGR-ERDRRDTKRHSRSRSR 572

Query: 108 EAVVRDR 114
              ||||
Sbjct: 573 STPVRDR 579

>hg18||uc001wiq
        |14|AF124727|Q9UKV3-3|Q9UKV3-3|ACIN1|NM_014977|NP_055792|apoptotic
        chromatin condensation inducer 1

          Length = 583

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query:  48 NRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQTGTRNAEA 107
           ||   |.    ..   ||||    | |        |. | ||. ||     .  .|.   
Sbjct: 514 NRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGR-ERDRRDTKRHSRSRSR 572

Query: 108 EAVVRDR 114
              ||||
Sbjct: 573 STPVRDR 579

>hg18||uc001wir
        |14|AF124728|Q9UKV3-2|Q9UKV3-2|ACIN1|NM_014977|NP_055792|apoptotic
        chromatin condensation inducer 1

          Length = 614

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query:  48 NRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQTGTRNAEA 107
           ||   |.    ..   ||||    | |        |. | ||. ||     .  .|.   
Sbjct: 545 NRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGR-ERDRRDTKRHSRSRSR 603

Query: 108 EAVVRDR 114
              ||||
Sbjct: 604 STPVRDR 610

>hg18||uc001wis
        |14|BC032770|Q9UKV3|ACINU_HUMAN|ACIN1|NM_014977|NP_055792|apoptotic
        chromatin condensation inducer 1

          Length = 1022

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query:   48 NRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQTGTRNAEA 107
            ||   |.    ..   ||||    | |        |. | ||. ||     .  .|.   
Sbjct:  953 NRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGR-ERDRRDTKRHSRSRSR 1011

Query:  108 EAVVRDR 114
               ||||
Sbjct: 1012 STPVRDR 1018

>hg18||uc001wit
        |14|NM_014977|Q9UKV3|ACINU_HUMAN|ACIN1|NM_014977|NP_055792|apoptotic
        chromatin condensation inducer 1

          Length = 1341

 Score =  28 bits (62), Expect = 6.713
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query:   48 NRNSGRQGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSGPGEQTGTRNAEA 107
            ||   |.    ..   ||||    | |        |. | ||. ||     .  .|.   
Sbjct: 1272 NRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGR-ERDRRDTKRHSRSRSR 1330

Query:  108 EAVVRDR 114
               ||||
Sbjct: 1331 STPVRDR 1337

>hg18||uc003uxx |7|NM_003378|Q9UDW8|Q9UDW8_HUMAN|VGF|NM_003378|NP_003369|VGF
        nerve growth factor inducible precursor

          Length = 615

 Score =  28 bits (62), Expect = 6.713
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 1/63 (1%)

Query:  54 QGNTGNTGRSDRERRTGDEADDAAEQTGDEQQRSRGQAERSG-PGEQTGTRNAEAEAVVR 112
           ||     |   |  .   |  ..| .  . .|  ||  || |   |.     ||||   |
Sbjct: 338 QGGARQRGLGGRGLQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAER 397

Query: 113 DRR 115
            |.
Sbjct: 398 ARQ 400

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,252,843
Number of Sequences: 45480
Number of Extensions: 191252843
Number of Successful Extensions: 11153049
Number of sequences better than 0.0: 0
BLASTP 7.6.0