BLASTP 7.6.0


Query=fugu4_742675 |jgi|Takru4|742675|fgh5_pg.C_scaffold_458000016
        (1619 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP...    187   1e-046
hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_0...    187   1e-046
hg18||uc002wux |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176...    181   8e-045
hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_...    169   3e-041
hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_8...    169   3e-041
hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_8...    169   3e-041
hg18||uc001wyp |14|BC065521|NA|NA|KIAA1565|NA|NA|Homo sapiens mR...    169   3e-041
hg18||uc002wux |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176...    116   4e-025
hg18||uc002wuw |20|AK021854|Q9HAD5|Q9HAD5_HUMAN|KIAA0980|NA|NA|C...     82   4e-015
hg18||uc002wux |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176...     82   4e-015
hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_...     81   1e-014
hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_...     75   5e-013
hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP...     75   5e-013
hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_8...     75   5e-013
hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_8...     75   5e-013
hg18||uc001qiz |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP...     66   4e-010
hg18||uc001qjb |12|NM_178040|Q8IUD2|RB6I2_HUMAN|ERC1|NM_178040|N...     64   1e-009
hg18||uc001qjc |12|NM_178039|Q8IUD2-3|Q8IUD2-3|ERC1|NM_178039|NP...     64   2e-009
hg18||uc001qjd |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP...     62   6e-009
hg18||uc001azt |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|N...     62   7e-009
hg18||uc002alm |15|AK131384|Q6ZN40|Q6ZN40_HUMAN|TPM1|NM_00101800...     58   8e-008
hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_0...     58   1e-007
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...     58   1e-007
hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_...     57   1e-007
hg18||uc002min |19|NM_145245|Q96CN4|EVI5L_HUMAN|EVI5L|NM_145245|...     57   1e-007
hg18||uc002wux |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176...     57   1e-007
hg18||uc002xcn |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_0010...     57   1e-007
hg18||uc002zzw |22|NM_015330|Q69YQ0|CYTSA_HUMAN|SPECC1L|NM_01533...     55   5e-007
hg18||uc002alj |15|NM_001018007|Q9Y427|Q9Y427_HUMAN|TPM1|NM_0010...     55   7e-007
hg18||uc002axa |15|NM_001038640|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001...     54   2e-006
hg18||uc002azs |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_0010386...     54   2e-006
hg18||uc002azv |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_0010386...     54   2e-006
hg18||uc002alo |15|AY640414|Q6DV90|Q6DV90_HUMAN|TPM1|NM_00101800...     53   3e-006
hg18||uc001azv |1|BC126912|NA|NA|KIAA0445|NA|NA|Homo sapiens mRN...     53   3e-006
hg18||uc003dhr |3|NM_015576|O15083|ERC2_HUMAN|ERC2|NM_015576|NP_...     52   5e-006
hg18||uc001hnl |1|NM_198551|Q5JRA6|Q5JRA6_HUMAN|MIA3|NM_198551|N...     52   8e-006
hg18||uc001hnm |1|AX775845|Q5JRB1|Q5JRB1_HUMAN|MIA3|NM_198551|NP...     52   8e-006
hg18||uc003eei |3|NM_004487|Q14789|GOGB1_HUMAN|GOLGB1|NM_004487|...     51   1e-005
hg18||uc003eej |3|D25542|NA|NA|GOLGB1|NA|NA|Homo sapiens cDNA cl...     51   1e-005
hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP...     50   2e-005
hg18||uc002xbi |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884...     50   2e-005
hg18||uc001wyp |14|BC065521|NA|NA|KIAA1565|NA|NA|Homo sapiens mR...     50   2e-005
hg18||uc003zab |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|...     50   2e-005
hg18||uc003zac |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|...     50   2e-005
hg18||uc003zad |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|...     50   2e-005
hg18||uc003zae |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|...     50   2e-005
hg18||uc003zaf |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|...     50   2e-005
hg18||uc003zag |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|...     50   2e-005
hg18||uc003zah |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|...     50   2e-005
hg18||uc003zai |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|...     50   2e-005
hg18||uc003zaj |8|U53204|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_...     50   2e-005
hg18||uc002all |15|NM_001018020|P09493-3|P09493-3|TPM1|NM_001018...     49   5e-005
hg18||uc001zih |15|AL137686|Q659D1|Q659D1_HUMAN|GOLGA8B|NM_00102...     48   9e-005
hg18||uc001zii |15|AK097551|Q52M46|Q52M46_HUMAN|GOLGA8A|NM_18107...     48   9e-005
hg18||uc001zij |15|NM_181077|Q52M46|Q52M46_HUMAN|GOLGA8A|NM_1810...     48   9e-005
hg18||uc001zik |15|BX648575|Q68DK6|Q68DK6_HUMAN|GOLGA8B|NM_00102...     48   9e-005
hg18||uc001zip |15|NM_001023567|Q659D1|Q659D1_HUMAN|GOLGA8B|NM_0...     48   9e-005
hg18||uc001ziq |15|AK097551|Q52M46|Q52M46_HUMAN|GOLGA8A|NM_18107...     48   9e-005
hg18||uc004bpc |9|NM_002077|Q5T164|Q5T164_HUMAN|GOLGA1|NM_002077...     48   9e-005
hg18||uc002bhl |15|AK097432|NA|NA|AK097432|NA|NA|Homo sapiens cD...     47   1e-004
hg18||uc002auw |15|NM_018652|NA|NA|GOLGA|NM_018652|NP_061122|gol...     45   6e-004
hg18||uc002tbc |2|NM_145686|Q53TX8|Q53TX8_HUMAN|MAP4K4|NM_145686...     45   6e-004
hg18||uc002tbg |2|AY212247|O95819|M4K4_HUMAN|MAP4K4|NM_145687|NP...     45   6e-004
hg18||uc002tbi |2|AY834276|Q5MD60|Q5MD60_HUMAN|MAP4K4|NM_004834|...     45   6e-004
hg18||uc001iwe |10|NM_004521|P33176|KINH_HUMAN|KIF5B|NM_004521|N...     45   7e-004
hg18||uc002alm |15|AK131384|Q6ZN40|Q6ZN40_HUMAN|TPM1|NM_00101800...     45   7e-004
hg18||uc002iof |17|NM_005831|Q13137|Q13137_HUMAN|CALCOCO2|NM_005...     45   9e-004
hg18||uc002ivx |17|NM_004758|O95153|RIMB1_HUMAN|BZRAP1|NM_004758...     44   0.001
hg18||uc001wvc |14|AL833415|O15320-2|O15320-2|CTAGE5|NM_203355|N...     44   0.002
hg18||uc002jqc |17|NM_001080542|NA|NA|FBF1|NM_001080542|NP_00107...     43   0.004
hg18||uc001xcb |14|NM_182926|Q86UP2|KTN1_HUMAN|KTN1|NM_182926|NP...     41   0.010
hg18||uc001xcc |14|NM_001079521|Q86UP2|KTN1_HUMAN|KTN1|NM_001079...     41   0.010
hg18||uc001xcd |14|NM_001079522|Q17RZ5|Q17RZ5_HUMAN|KTN1|NM_0010...     41   0.010
hg18||uc001xce |14|NM_004986|Q86UP2-2|Q86UP2-2|KTN1|NM_004986|NP...     41   0.010
hg18||uc001xcf |14|BC112337|Q17RZ5|Q17RZ5_HUMAN|KTN1|NM_00107952...     41   0.010
hg18||uc002tbd |2|NM_145687|O95819-2|O95819-2|MAP4K4|NM_145687|N...     41   0.014
hg18||uc002tbe |2|NM_004834|O95819-4|O95819-4|MAP4K4|NM_004834|N...     41   0.014
hg18||uc002tbf |2|BC064691|O95819-2|O95819-2|MAP4K4|NM_145687|NP...     41   0.014
hg18||uc002tbh |2|AF096300|O95819-4|O95819-4|MAP4K4|NM_004834|NP...     41   0.014
hg18||uc002tbj |2|AK074900|NA|NA|MAP4K4|NM_004834|NP_004825|mito...     41   0.014
hg18||uc001wve |14|AK055791|Q96N90|Q96N90_HUMAN|CTAGE5|NM_203355...     40   0.018
hg18||uc001wvf |14|NM_203357|Q86TF6|Q86TF6_HUMAN|CTAGE5|NM_20335...     40   0.018
hg18||uc001wvi |14|BC064355|O15320-3|O15320-3|CTAGE5|NM_203357|N...     40   0.018
hg18||uc002cez |15_random|NM_198181|Q8IVV3|Q8IVV3_HUMAN|LOC44029...     40   0.018
hg18||uc001rgx |12|AB093206|Q8NHQ8|RASF8_HUMAN|RASSF8|NM_007211|...     40   0.023
hg18||uc001rgy |12|AY665468|Q8NHQ8|RASF8_HUMAN|RASSF8|NM_007211|...     40   0.023
hg18||uc001rgz |12|NM_007211|Q8NHQ8-2|Q8NHQ8-2|RASSF8|NM_007211|...     40   0.023
hg18||uc002rgu |2|NM_002254|O14782|KIF3C_HUMAN|KIF3C|NM_002254|N...     40   0.030
hg18||uc004cqa |X|NM_005088|Q5JQ74|Q5JQ74_HUMAN|CXYorf3|NM_00508...     40   0.030
hg18||uc004fpn |Y|NM_005088|Q5JQ74|Q5JQ74_HUMAN|CXYorf3|NM_00508...     40   0.030
hg18||uc002bhl |15|AK097432|NA|NA|AK097432|NA|NA|Homo sapiens cD...     39   0.040
hg18||uc002auw |15|NM_018652|NA|NA|GOLGA|NM_018652|NP_061122|gol...     39   0.052
hg18||uc002kzz |18|NM_020776|Q86T90|Q86T90_HUMAN|KIAA1328|NM_020...     39   0.052
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...     39   0.052
hg18||uc002xcn |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_0010...     39   0.052
hg18||uc003upw |7|NR_002147|Q9H6N6|Q9H6N6_HUMAN|MYH16|NA|NA|CDNA...     39   0.068
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...     38   0.088
hg18||uc004czr |X|NM_152780|Q5JPS7|Q5JPS7_HUMAN|MAP7D2|NM_152780...     37   0.151
hg18||uc002ktv |18|NM_172241|Q8NEG8|Q8NEG8_HUMAN|CTAGE1|NM_17224...     37   0.257
hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP...     36   0.335

>hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP_891991|ninein
        isoform 5

          Length = 1377

 Score =  187 bits (474), Expect = 1e-046
 Identities = 102/284 (35%), Positives = 161/284 (56%), Gaps = 1/284 (0%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 269 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 328

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 329 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 388

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQV 406
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| | 
Sbjct: 389 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQA 448

Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXXHATAQENVGXXXXXXXXXXXXTDAQNSVSRXXXXX 466
                                      . .||               . .|  ..     
Sbjct: 449 GKQRLELEQEIEKAKTEENYIRDRLALSLKENSRLENELLENAEKLAEYENLTNKLQRNL 508

Query: 467 XXXXXXKFGNLDSAGCGLSL-DERFADLIKEYEQQCRELRDRND 509
                 |||.|| .     | .||   .  |||.||| |.|. |
Sbjct: 509 ENVLAEKFGDLDPSSAEFFLQEERLTQMRNEYERQCRVLQDQVD 552

>hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_057434|ninein
        isoform 4

          Length = 2096

 Score =  187 bits (474), Expect = 1e-046
 Identities = 102/284 (35%), Positives = 161/284 (56%), Gaps = 1/284 (0%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 275 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 334

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 335 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 394

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQV 406
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| | 
Sbjct: 395 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQA 454

Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXXHATAQENVGXXXXXXXXXXXXTDAQNSVSRXXXXX 466
                                      . .||               . .|  ..     
Sbjct: 455 GKQRLELEQEIEKAKTEENYIRDRLALSLKENSRLENELLENAEKLAEYENLTNKLQRNL 514

Query: 467 XXXXXXKFGNLDSAGCGLSL-DERFADLIKEYEQQCRELRDRND 509
                 |||.|| .     | .||   .  |||.||| |.|. |
Sbjct: 515 ENVLAEKFGDLDPSSAEFFLQEERLTQMRNEYERQCRVLQDQVD 558

>hg18||uc002wux
        |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176|NP_079452|hypothetica
        l protein LOC22981

          Length = 1382

 Score =  181 bits (458), Expect = 8e-045
 Identities = 105/292 (35%), Positives = 164/292 (56%), Gaps = 4/292 (1%)

Query: 220 LEPVNAKSQEVLEECSG--RSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGI 277
           ..|  | |   . | ||   .|| ||.      |. | .|||.|   |.||. .||.|||
Sbjct: 277 VKPSKAWSHYQVPEESGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGI 336

Query: 278 RSSREILQTLDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQA 337
           .. |||||.||||.|....|..|| ||||||.   . . ||||  |  |. . |   || 
Sbjct: 337 QNGREILQSLDFSVDEKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQL 396

Query: 338 SRERDKVKADLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQ 397
           .||||| . ||. |..|||. | |.|| |...| | . .|. ||| .|.||. .||.|| 
Sbjct: 397 ARERDKARQDLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEA 456

Query: 398 ESDILLLQVXXXXXXXXXXXXXXXXXXXXXXXXXHATAQENVGXXXXXXXXXXXXTDAQN 457
           | ..   |                              .||              .|.. 
Sbjct: 457 ERELFWEQAHRQRAALEWDVGRLQAEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSER 516

Query: 458 SVSRXXXXXXXXXXXKFGNLDSAGCGLSLDERFADLIKEYEQQCRELRDRND 509
              .           |     ||   |. .|||| ..|||| .||.|.||||
Sbjct: 517 LALKLQKDLEFVLKDKL-EPQSAEL-LAQEERFAAVLKEYELKCRDLQDRND 566

>hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_065972|ninein
        isoform 2

          Length = 2116

 Score =  169 bits (427), Expect = 3e-041
 Identities = 82/179 (45%), Positives = 128/179 (71%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 269 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 328

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 329 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 388

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQ 405
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| |
Sbjct: 389 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQ 447

>hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_891990|ninein
        isoform 3

          Length = 2073

 Score =  169 bits (427), Expect = 3e-041
 Identities = 82/179 (45%), Positives = 128/179 (71%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 269 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 328

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 329 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 388

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQ 405
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| |
Sbjct: 389 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQ 447

>hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_891989|ninein
        isoform 1

          Length = 2029

 Score =  169 bits (427), Expect = 3e-041
 Identities = 82/179 (45%), Positives = 128/179 (71%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 269 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 328

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 329 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 388

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQ 405
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| |
Sbjct: 389 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQ 447

>hg18||uc001wyp |14|BC065521|NA|NA|KIAA1565|NA|NA|Homo sapiens mRNA for KIAA1565
        protein, partial cds

          Length = 440

 Score =  169 bits (427), Expect = 3e-041
 Identities = 82/179 (45%), Positives = 128/179 (71%)

Query: 227 SQEVLEECSGRSTTPSLLMATVGQRVLSRLDDGTGCCSPEQVVTLWTEEGIRSSREILQT 286
           | .  .|   |.|| | . .|.| || | |||| |  | |...  | |||| .|.|||. 
Sbjct: 231 SMQSFDESGRRTTTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKA 290

Query: 287 LDFSLDDRLSLVDLTLALDNELLVSGNGIHQAALISYKNEIQHLQVLAEQASRERDKVKA 346
           ||||||  ..| .|||||.|||||. | |||||| |.| ||.||    .|  ||..|...
Sbjct: 291 LDFSLDGNINLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRS 350

Query: 347 DLDHADQRNLQLVSEVDDRHASMENLNQSRIRDLEQEFRDRLTAVRSQVEQESDILLLQ 405
           ||| |..    . ||||| ||..|  |.  .| |..|...|. |..... .| . .| |
Sbjct: 351 DLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQ 409

>hg18||uc002wux
        |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176|NP_079452|hypothetica
        l protein LOC22981

          Length = 1382

 Score =  116 bits (288), Expect = 4e-025
 Identities = 69/169 (40%), Positives = 86/169 (50%), Gaps = 3/169 (1%)

Query:  22 DDDHGDYISQLRAEFDSCDSSASGFLDRDELTALCQKLHLESHLQQLLDTLLRRGACGRV 81
           |..   |.||||  . |||.. .||||| ||| || |||||  |  || |||      ||
Sbjct:   2 DEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFARV 61

Query:  82 NFEEFKDGFVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPESA 141
           ||||||.|||||                ||      . ||.| | | |||||||.  ..|
Sbjct:  62 NFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDAA 121

Query: 142 LSQGSEDFGPPGVESSDLSPSGIRRAKLRRSTSLESIESLKSDVEPANQ 190
                    |     . |     | | |    | .| |  .|  |  |.
Sbjct: 122 TEARRV---PEQQTQASLKSHLWRSASLESVESPKSDEEAESTKEAQNE 167

>hg18||uc002wuw |20|AK021854|Q9HAD5|Q9HAD5_HUMAN|KIAA0980|NA|NA|CDNA FLJ11792
        fis, clone HEMBA1006121

          Length = 173

 Score =  82 bits (202), Expect = 4e-015
 Identities = 44/111 (39%), Positives = 69/111 (62%)

Query: 1507 QQSSSQINIKQDQYEKALMGLQQRVQELETRLKGVQMXXXXXXXXXXXXXXXNTKSSSQL 1566
            .|.  ... .....|| |   ..||.| |  || ..|               ||||   |
Sbjct:   62 EQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLL 121

Query: 1567 KELYAENAQLMTALQITEQRQKNAEKKNFVLEGKVGALNKLLRDVVHVALA 1617
            |||| ||| |. ||| ||..|. |||.. .|| || |||||.  .   ||.
Sbjct:  122 KELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAALS 172

>hg18||uc002wux
        |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176|NP_079452|hypothetica
        l protein LOC22981

          Length = 1382

 Score =  82 bits (202), Expect = 4e-015
 Identities = 44/111 (39%), Positives = 69/111 (62%)

Query: 1507 QQSSSQINIKQDQYEKALMGLQQRVQELETRLKGVQMXXXXXXXXXXXXXXXNTKSSSQL 1566
            .|.  ... .....|| |   ..||.| |  || ..|               ||||   |
Sbjct: 1271 EQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLL 1330

Query: 1567 KELYAENAQLMTALQITEQRQKNAEKKNFVLEGKVGALNKLLRDVVHVALA 1617
            |||| ||| |. ||| ||..|. |||.. .|| || |||||.  .   ||.
Sbjct: 1331 KELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAALS 1381

>hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_065972|ninein
        isoform 2

          Length = 2116

 Score =  81 bits (198), Expect = 1e-014
 Identities = 40/113 (35%), Positives = 70/113 (61%)

Query: 1506 VQQSSSQINIKQDQYEKALMGLQQRVQELETRLKGVQMXXXXXXXXXXXXXXXNTKSSSQ 1565
            ..  .|. |  |   |. .  ...|. |.| .|| |.                |||. . 
Sbjct: 1998 LENRTSETNTPQGNQEQLVTVMEERMIEVEQKLKLVKRLLQEKVNQLKEQLCKNTKADAM 2057

Query: 1566 LKELYAENAQLMTALQITEQRQKNAEKKNFVLEGKVGALNKLLRDVVHVALAT 1618
            .|.|| |||||. ||..|||||| |||||..|| |. .|. ..|..    | .
Sbjct: 2058 VKDLYVENAQLLKALEVTEQRQKTAEKKNYLLEEKIASLSNIVRNLTPAPLTS 2110

>hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_065972|ninein
        isoform 2

          Length = 2116

 Score =  75 bits (184), Expect = 5e-013
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query:  30 SQLRAEFDSCDSSASGFLDRDELTALCQKLHLESHLQQLLDTLLRRGACGRVNFEEFKDG 89
           ..|.  ||| |.. .| | ..||| ||  | ||     |  |||.    |||.|..||. 
Sbjct:  11 ARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEA 70

Query:  90 FVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPES 140
            . .               . ||    | .||.|.| ||||||| |.  ||
Sbjct:  71 LILI-----LSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQES 116

>hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP_891991|ninein
        isoform 5

          Length = 1377

 Score =  75 bits (184), Expect = 5e-013
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query:  30 SQLRAEFDSCDSSASGFLDRDELTALCQKLHLESHLQQLLDTLLRRGACGRVNFEEFKDG 89
           ..|.  ||| |.. .| | ..||| ||  | ||     |  |||.    |||.|..||. 
Sbjct:  11 ARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEA 70

Query:  90 FVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPES 140
            . .               . ||    | .||.|.| ||||||| |.  ||
Sbjct:  71 LILI-----LSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQES 116

>hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_891990|ninein
        isoform 3

          Length = 2073

 Score =  75 bits (184), Expect = 5e-013
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query:  30 SQLRAEFDSCDSSASGFLDRDELTALCQKLHLESHLQQLLDTLLRRGACGRVNFEEFKDG 89
           ..|.  ||| |.. .| | ..||| ||  | ||     |  |||.    |||.|..||. 
Sbjct:  11 ARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEA 70

Query:  90 FVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPES 140
            . .               . ||    | .||.|.| ||||||| |.  ||
Sbjct:  71 LILI-----LSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQES 116

>hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_891989|ninein
        isoform 1

          Length = 2029

 Score =  75 bits (184), Expect = 5e-013
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query:  30 SQLRAEFDSCDSSASGFLDRDELTALCQKLHLESHLQQLLDTLLRRGACGRVNFEEFKDG 89
           ..|.  ||| |.. .| | ..||| ||  | ||     |  |||.    |||.|..||. 
Sbjct:  11 ARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEA 70

Query:  90 FVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPES 140
            . .               . ||    | .||.|.| ||||||| |.  ||
Sbjct:  71 LILI-----LSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQES 116

>hg18||uc001qiz
        |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP_829881|RAB6-interacti
        ng protein 2 isoform beta

          Length = 992

 Score =  66 bits (159), Expect = 4e-010
 Identities = 108/613 (17%), Positives = 237/613 (38%), Gaps = 68/613 (11%)

Query:  685 EQERKMQRERAEMEQNF--------AREIGNLVQRLSSEKDQLEAELKLKMDQEVSLLR- 735
            |.|  | ||  || . |         . .  ...   |.   .|  |.  ...|. .|. 
Sbjct:  354 EKENSMLRE--EMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLR-DLEEEIQMLKS 410

Query:  736 ------EKAEQQRSHLELQQADSQ--RRLLHQLHCERQRMQEPRVLWEIE---LTQSEQE 784
                  |. |..   .|. .. |.  .  . |.  |  |     .  . .   ||    .
Sbjct:  411 NGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSD 470

Query:  785 KKRVVEQHEEANQTSNLQISQSEKSVEALRARCGRVEEELKESRAQASELEARLLEACAQ 844
             |. .|  .|.      . .  .  |.||| |    |  | .   |  ..         .
Sbjct:  471 SKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGE 530

Query:  845 LEESIAFIXXXXXXXXXXXXXKGREQDLLQ-QVYRLRAELENMHTNSCSLSDFV--VQHT 901
            . .                  | |. ..|| ..  |. .| .      || . |  .|  
Sbjct:  531 IHD-----------LKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQAD 579

Query:  902 XXXXXXXXXXXQKTIRSRASELDSLKADRDR-----------LIQDLKDQAMAVDTLQLQ 950
                       .. .  .   .. ||  |||             .||||    |  ||  
Sbjct:  580 TTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGD 639

Query:  951 L-DQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXXXXXXVGHLRQEKQTY-----A 1004
            | .. .  ||    | |     |...                 .    | |. .     |
Sbjct:  640 LSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEA 699

Query: 1005 GLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQLNAKTSEADWLRTSSE 1064
              . ..| .|  .| ||   ..   .   ....   .. ..  . | |  .   | . . 
Sbjct:  700 RASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTS 759

Query: 1065 SLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAEDNFEQEKQRMTRQLV 1124
              ...  |      .|  .    ||    ||.         |  |||     |..   | 
Sbjct:  760 RQVKD--QNKKVANLKHKEQVEKKKSAQMLEEA--------RRREDNLNDSSQQLQDSLR 809

Query: 1125 E----MEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRR 1180
            .    .| |  || | |  |.     | .  |     ....  .   .. .. .    . 
Sbjct:  810 KKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKA 869

Query: 1181 KLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLSKDNAELSARLRGDQESVRL 1240
            ||   ...          |  |  .. ||||..    |  .    . .  |     | . 
Sbjct:  870 KLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKK 929

Query: 1241 LQERLVTVAREQE 1253
             || .  . ||..
Sbjct:  930 TQEEVAALKREKD 942

>hg18||uc001qjb
        |12|NM_178040|Q8IUD2|RB6I2_HUMAN|ERC1|NM_178040|NP_829884|RAB6-interact
        ing protein 2 isoform epsilon

          Length = 1116

 Score =  64 bits (155), Expect = 1e-009
 Identities = 99/567 (17%), Positives = 218/567 (38%), Gaps = 39/567 (6%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHLELQQA--DSQRRLLHQLHCERQRMQE 769
            ||.|. . | .           .. | || .  |  ..|  .  ..    |  |  ....
Sbjct:  414 LSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQ 473

Query:  770 PRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCGRVEEELKESRA 829
                 . ||   . . . .  |  .. |     |   ..|. |   |   .. |.   | 
Sbjct:  474 ELSRKDTELLALQTKLETLTNQFSDSKQ----HIEVLKESLTAKEQRAAILQTEVDALRL 529

Query:  830 QASELEARLLEACAQLE---ESIAFIXXXXXXXXXXXXXKGREQDLLQ-QVYRLRAELEN 885
            .  | |  | .   |..   |                  | |. ..|| ..  |. .| .
Sbjct:  530 RLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRD 589

Query:  886 MHTNSCSLSDFV--VQHTXXXXXXXXXXXQKTIRSRASELDSLKADRDR----------- 932
                  || . |  .|             .. .  .   .. ||  |||           
Sbjct:  590 KEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDN 649

Query:  933 LIQDLKDQAMAVDTLQLQL-DQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXXXXX 991
              .||||    |  ||  | .. .  ||    | |     |...                
Sbjct:  650 YKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEE 709

Query:  992 XVGHLRQEKQTY-----AGLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLR 1046
             .    | |. .     |  . ..| .|  .| ||   ..   .   ....   .. .. 
Sbjct:  710 CLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVE 769

Query: 1047 TQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLR 1106
             . | |  .   |    .   ..|  |  . .|.     .  ..    |  | ||   | 
Sbjct:  770 NEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQL- 828

Query: 1107 LAEDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQ 1166
              .|.  ..  |       .| |  || | |  |.     | .  |     ....  .  
Sbjct:  829 --QDSLRKKDDR-------IEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLM 879

Query: 1167 EVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLSKDNAE 1226
             .. .. .    . ||   ...          |  |  .. ||||..    |  .    .
Sbjct:  880 AMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKD 939

Query: 1227 LSARLRGDQESVRLLQERLVTVAREQE 1253
             .  |     | .  || .  . ||..
Sbjct:  940 ANIALLELSSSKKKTQEEVAALKREKD 966

>hg18||uc001qjc
        |12|NM_178039|Q8IUD2-3|Q8IUD2-3|ERC1|NM_178039|NP_829883|RAB6-interacti
        ng protein 2 isoform delta

          Length = 1088

 Score =  64 bits (154), Expect = 2e-009
 Identities = 98/583 (16%), Positives = 227/583 (38%), Gaps = 54/583 (9%)

Query:  703 REIGNLVQRLSSEKDQLEAELKLKMDQEVSLLR-------EKAEQQRSHLELQQADSQ-- 753
            . .  ...   |.   .|  |.  ...|. .|.       |. |..   .|. .. |.  
Sbjct:  378 KALQTVIEMKDSKISSMERGLR-DLEEEIQMLKSNGALSTEEREEEMKQMEVYRSHSKFM 436

Query:  754 RRLLHQLHCERQRMQEPRVLWEIE---LTQSEQEKKRVVEQHEEANQTSNLQISQSEKSV 810
            .  . |.  |  |     .  . .   ||    . |. .|  .|.      . .  .  |
Sbjct:  437 KNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEV 496

Query:  811 EALRARCGRVEEELKESRAQASELEARLLEACAQLEESIAFIXXXXXXXXXXXXXKGREQ 870
            .||| |    |  | .   |  ..         .. .                  | |. 
Sbjct:  497 DALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHD-----------LKDMLDVKERKV 545

Query:  871 DLLQ-QVYRLRAELENMHTNSCSLSDFV--VQHTXXXXXXXXXXXQKTIRSRASELDSLK 927
            ..|| ..  |. .| .      || . |  .|             .. .  .   .. ||
Sbjct:  546 NVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLK 605

Query:  928 ADRDR-----------LIQDLKDQAMAVDTLQLQL-DQISEELDQMRTARSTVEKTLEEE 975
              |||             .||||    |  ||  | .. .  ||    | |     |...
Sbjct:  606 EQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKD 665

Query:  976 QARSXXXXXXXXXXXXXVGHLRQEKQTY-----AGLADQLSTQIVEMEEEICTLREHLRE 1030
                             .    | |. .     |  . ..| .|  .| ||   ..   .
Sbjct:  666 SRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSK 725

Query: 1031 VSCQLNQTSNLVLDLRTQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQ 1090
               ....   .. ..  . | |  .   |    .   ..|  |  . .|.     .  ..
Sbjct:  726 AQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEE 785

Query: 1091 VLHLEQVLLDSKNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEV 1150
                |  | ||   |   .|.  ..  |       .| |  || | |  |.     | . 
Sbjct:  786 ARRREDNLNDSSQQL---QDSLRKKDDR-------IEELEEALRESVQITAEREMVLAQE 835

Query: 1151 RSENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEV 1210
             |     ....  .   .. .. .    . ||   ...          |  |  .. |||
Sbjct:  836 ESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEV 895

Query: 1211 LDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQE 1253
            |..    |  .    . .  |     | .  || .  . ||..
Sbjct:  896 LEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKD 938

>hg18||uc001qjd
        |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP_829882|RAB6-interacti
        ng protein 2 isoform gamma

          Length = 720

 Score =  62 bits (149), Expect = 6e-009
 Identities = 93/514 (18%), Positives = 192/514 (37%), Gaps = 53/514 (10%)

Query:  767 MQEPRVLWEIELTQSEQEKKRVVEQHEEANQT---SNLQISQSEKSVEALRARCGRVEEE 823
            |   .  |  ||     .|.| . . | .  |      .. | |  |.||| |    |  
Sbjct:  183 MNSIKTFWSPEL-----KKERALRKDEASKITIWKEQYRVVQEENQVDALRLRLEEKETM 237

Query:  824 LKESRAQASELEARLLEACAQLEESIAFIXXXXXXXXXXXXXKGREQDLLQ-QVYRLRAE 882
            | .   |  ..         .. .                  | |. ..|| ..  |. .
Sbjct:  238 LNKKTKQIQDMAEEKGTQAGEIHD-----------LKDMLDVKERKVNVLQKKIENLQEQ 286

Query:  883 LENMHTNSCSLSDFV--VQHTXXXXXXXXXXXQKTIRSRASELDSLKADRDR-------- 932
            | .      || . |  .|             .. .  .   .. ||  |||        
Sbjct:  287 LRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEE 346

Query:  933 ---LIQDLKDQAMAVDTLQLQL-DQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXX 988
                 .||||    |  ||  | .. .  ||    | |     |...             
Sbjct:  347 IDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQK 406

Query:  989 XXXXVGHLRQEKQTY-----AGLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVL 1043
                .    | |. .     |  . ..| .|  .| ||   ..   .   ....   .. 
Sbjct:  407 KEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILK 466

Query: 1044 DLRTQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKN 1103
            ..  . | |  .   | . .   ...  |      .|  .    ||    ||.       
Sbjct:  467 EVENEKNDKDKKIAELESLTSRQVKD--QNKKVANLKHKEQVEKKKSAQMLEEA------ 518

Query: 1104 HLRLAEDNFEQEKQRMTRQLVE----MEGLVLALEEVVDPTSPHRTRLEEVRSENGALQE 1159
              |  |||     |..   | .    .| |  || | |  |.     | .  |     ..
Sbjct:  519 --RRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEK 576

Query: 1160 RLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQ 1219
            ..  .   .. .. .    . ||   ...          |  |  .. ||||..    | 
Sbjct:  577 QVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQEALL 636

Query: 1220 LSKDNAELSARLRGDQESVRLLQERLVTVAREQE 1253
             .    . .  |     | .  || .  . ||..
Sbjct:  637 AAISEKDANIALLELSSSKKKTQEEVAALKREKD 670

>hg18||uc001azt
        |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 2017

 Score =  62 bits (148), Expect = 7e-009
 Identities = 87/410 (21%), Positives = 159/410 (38%), Gaps = 38/410 (9%)

Query:  913 QKTIRSRASELDSLKADRDRLIQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTL 972
            .|  . .|.|   |. |. || . |         |.||   .  || . |   |  |   
Sbjct: 1621 EKISKMKANE-TKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQA 1679

Query:  973 EEEQARSXXXXXXXXXXXXXVGHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVS 1032
            .  | |               | |.   .   |   ..      . ...  | | | . |
Sbjct: 1680 QALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSS 1739

Query: 1033 CQLNQTSNLVLDLRTQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVL 1092
              || | .  | |.  | |   .               | | ..|.     |  |.||  
Sbjct: 1740 ASLNSTRDKNLHLQKALTACEHDR--------------QVLQERLDAARQALSEARKQSS 1785

Query: 1093 HL-EQVLLDSKNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVV----DPTSPHRTRL 1147
             | |||                 |   .  | || || .  | ||.    .  .     .
Sbjct: 1786 SLGEQV------------QTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTV 1833

Query: 1148 EEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYR 1207
            .... |   |||||  .|. .  .| .  .  |    ||.     |   ...  |  |  
Sbjct: 1834 QKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSH 1893

Query: 1208 EEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXXXX 1267
            |. . ||    .| .        |   |  .. |. ..| .  ||               
Sbjct: 1894 EDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVL--EQSHSPAQLEVDAQQQQ 1951

Query: 1268 XXXXEKLQQ-HVAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQ 1316
                .....   |  | .. .|     ||..   |  || ..|..  .||
Sbjct: 1952 LELQQEVERLRSAQAQTERTLEARERAHRQR---VRGLEEQVSTLKGQLQ 1998

>hg18||uc002alm
        |15|AK131384|Q6ZN40|Q6ZN40_HUMAN|TPM1|NM_001018007|NP_001018007|tropomy
        osin 1 alpha chain isoform 2

          Length = 326

 Score =  58 bits (139), Expect = 8e-008
 Identities = 66/321 (20%), Positives = 133/321 (41%), Gaps = 20/321 (6%)

Query: 1099 LDSKNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQ 1158
            || .| |  ||   | .|.    .  ..|  . | |...  .   | |. |   |    .
Sbjct:   13 LDKENALDRAE-QAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRVLE---ELHKAE 68

Query: 1159 ERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRN- 1217
            . |   ..    .||.    ..||.  |        .|   . |  .  .| |.|. .  
Sbjct:   69 DSLLAAEEAAAKLEDELVSLQKKLKGTE--------DELDKYSEALKDAQEKLELAEKKA 120

Query: 1218 LQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXXXXXXXXEKLQQH 1277
                 | | |. |..  .| .   |||| |  .. ||                  |. . 
Sbjct:  121 TDAEADVASLNRRIQLVEEELDRAQERLATALQKLEE------AEKAADESERGMKVIES 174

Query: 1278 VAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQWSEDDKTRLLRETEEQSNKVV 1337
             |   |...  .|. |   | .   | . .   .  ||   | |  |     |    |  
Sbjct:  175 RAQKDEEKMEIQEIQLKEAKHIAEDA-DRKYEEVARKLVIIESDLERAEERAELSEGKCA 233

Query: 1338 ELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTELRRRLHDAEDKERELHTSIRKLVR 1397
            || .              | .  .|..    .|.  |  .| .|| .      |. || .
Sbjct:  234 ELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEK 293

Query: 1398 EKEEHHQALVEQEDQISSLHK 1418
              ..  . .   ...  |.|.
Sbjct:  294 SIDDLEEKVAHAKEENLSMHQ 314

>hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_057434|ninein
        isoform 4

          Length = 2096

 Score =  58 bits (138), Expect = 1e-007
 Identities = 37/105 (35%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query:  38 SCDSSASGFLDRDE--LTALCQKLHLESHLQQLLDTLLRRGACGRVNFEEFKDGFVAVXX 95
           | |   |||  . .     ||  | ||     |  |||.    |||.|..||.  . .  
Sbjct:  23 SSDVQVSGFHRKIQHVKNELCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEALILI-- 80

Query:  96 XXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKKRYGRRSRPDKPES 140
                        . ||    | .||.|.| ||||||| |.  ||
Sbjct:  81 ---LSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQES 122

>hg18||uc002xcm
        |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186|NP_009117|centrosomal
        protein 2 isoform 1

          Length = 2442

 Score =  58 bits (138), Expect = 1e-007
 Identities = 57/283 (20%), Positives = 121/283 (42%), Gaps = 14/283 (4%)

Query: 1144 RTRLEEVRS-ENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVE-EERLHE 1201
            | . |. ||     | . |  ...|   .|    ... ..| ..   |  | . |  | .
Sbjct:  859 REKWEKERSWHQQELAKALESLEREKMELEMRLKEQQTEMEAIQAQREEERTQAESALCQ 918

Query: 1202 ENSRYREEVLDLSNRNLQLSKDNAELS---ARLRGDQESVRLLQERLVTVAREQEEEGXX 1258
                  .| . |    ||  |. |. |    ||| | .  .| ..    . . | .|   
Sbjct:  919 MQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQR 978

Query: 1259 XXXXXXXXXXXXXEKLQQHVAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQWS 1318
                           ||.     .   |.. .. | ..    |  |.... .     .  
Sbjct:  979 ELKEAARQHRDDLAALQE-----ESSSLLQDKMDLQKQ----VEDLKSQLVAQDDSQRLV 1029

Query: 1319 EDDKTRLLRETEEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTELRRRL 1378
            | .    ||||.| .    || .              .|  . .    . ||.. ||. .
Sbjct: 1030 EQEVQEKLRETQEYNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQQELSALRQDM 1089

Query: 1379 HDAEDKERELHTSIRKLVREKEEHHQALVEQEDQISSLHKESH 1421
             .|. ...||   .  | .| .|     . || |.    . ||
Sbjct: 1090 QEAQGEQKELSAQMELLRQEVKEKEADFLAQEAQLLEELEASH 1132

>hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 1313

 Score =  57 bits (137), Expect = 1e-007
 Identities = 84/402 (20%), Positives = 154/402 (38%), Gaps = 38/402 (9%)

Query:  913 QKTIRSRASELDSLKADRDRLIQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTL 972
            .|  . .|.|   |. |. || . |         |.||   .  || . |   |  |   
Sbjct:  924 EKISKMKANE-TKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQA 982

Query:  973 EEEQARSXXXXXXXXXXXXXVGHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVS 1032
            .  | |               | |.   .   |   ..      . ...  | | | . |
Sbjct:  983 QALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSS 1042

Query: 1033 CQLNQTSNLVLDLRTQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVL 1092
              || | .  | |.  | |   .               | | ..|.     |  |.||  
Sbjct: 1043 ASLNSTRDKNLHLQKALTACEHDR--------------QVLQERLDAARQALSEARKQSS 1088

Query: 1093 HL-EQVLLDSKNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVV----DPTSPHRTRL 1147
             | |||                 |   .  | || || .  | ||.    .  .     .
Sbjct: 1089 SLGEQV------------QTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTV 1136

Query: 1148 EEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYR 1207
            .... |   |||||  .|. .  .| .  .  |    ||.     |   ...  |  |  
Sbjct: 1137 QKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSH 1196

Query: 1208 EEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXXXX 1267
            |. . ||    .| .        |   |  .. |. ..| .  ||               
Sbjct: 1197 EDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVL--EQSHSPAQLEVDAQQQQ 1254

Query: 1268 XXXXEKLQQ-HVAWTQEKQLMEKELGLHREKLVHVSALEAEI 1308
                .....   |  | .. .|     ||..   || |. ..
Sbjct: 1255 LELQQEVERLRSAQAQTERTLEARERAHRQR---VSTLKGQL 1293

>hg18||uc002min
        |19|NM_145245|Q96CN4|EVI5L_HUMAN|EVI5L|NM_145245|NP_660288|ecotropic
        viral integration site 5-like

          Length = 794

 Score =  57 bits (137), Expect = 1e-007
 Identities = 66/332 (19%), Positives = 135/332 (40%), Gaps = 27/332 (8%)

Query:  923 LDSLKADRDRLIQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTLEEEQARSXXX 982
            ...|.  .    |. ..  .    | .   | |   . .. |.||. . |.|.|      
Sbjct:  395 IETLEKGQVTRAQEAEENYVIKRELAVVRQQCSSAAEDLQKAQSTI-RQLQEQQENPRLT 453

Query:  983 XXXXXXXXXXVGHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLV 1042
                      .   |  .    |   ..  ....||.   .| .             | |
Sbjct:  454 EDFVSHLETELEQSRLRETETLGALREMQDKVLDMEKRNSSLPD------------ENNV 501

Query: 1043 LDLRTQLNAKTSEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHL-EQVLLDS 1101
              |. .| |          |.  |  ..|.|||  .      || |.    |    | | 
Sbjct:  502 AQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGRWKESPRKLVVGELQDE 561

Query: 1102 KNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERL 1161
               .|| |     | . . ...||.|               ||  |  | .|  ||||.|
Sbjct:  562 LMSVRLREAQALAEGRELRQRVVELE----------TQDHIHRNLLNRVEAERAALQEKL 611

Query: 1162 RVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLS 1221
            . .  . . ..   .. |||  | |    .  |   || | .|      .      |.. 
Sbjct:  612 QYLAAQNKGLQTQLSESRRKQAEAE-CKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQ 670

Query: 1222 KDNAELSARLRGDQES--VRLLQERLVTVARE 1251
            ..   .  .|     |  .| |....  .  |
Sbjct:  671 REEGRIQGQLNHSDSSQYIRELKDQIEELKAE 702

>hg18||uc002wux
        |20|NM_025176|Q9Y2I6|NLP_HUMAN|KIAA0980|NM_025176|NP_079452|hypothetica
        l protein LOC22981

          Length = 1382

 Score =  57 bits (137), Expect = 1e-007
 Identities = 29/61 (47%), Positives = 43/61 (70%), Gaps = 4/61 (6%)

Query: 590 VSIQTEMALEQLKRKHDQELQQLRIQLETQVNYYERSLEQMRQSMELERKDICQTFKLEI 649
           |||.||. .||.|    .  | || ||||.|||||| .  .... | ||||. |  . |.
Sbjct: 614 VSIETELMMEQVK----EHYQDLRTQLETKVNYYEREIAALKRNFEKERKDMEQARRREV 669

Query: 650 S 650
           |
Sbjct: 670 S 670

>hg18||uc002xcn
        |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_001035518|NP_001030595|cen
        trosomal protein 2 isoform 2

          Length = 2386

 Score =  57 bits (137), Expect = 1e-007
 Identities = 57/293 (19%), Positives = 126/293 (43%), Gaps = 26/293 (8%)

Query: 1146 RLEEVRSENGALQERLRVMQQEVQSMEDDAAKKR----RKLEELERTNERSRVEEERLHE 1201
            ... |      .|  .| .. |. .    | ..|    |.| . |.  . .  ...  ||
Sbjct:  793 QIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHE 852

Query: 1202 -ENSRYREEVLDLSNRN---------LQLSKDNAELS---ARLRGDQESVRLLQERLVTV 1248
             | .. ||. . |             ||  |. |. |    ||| | .  .| ..    .
Sbjct:  853 KEVNQLREKWMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGI 912

Query: 1249 AREQEEEGXXXXXXXXXXXXXXXEKLQQHVAWTQEKQLMEKELGLHREKLVHVSALEAEI 1308
             . | .|                  ||.     .   |.. .. | ..    |  |....
Sbjct:  913 LQTQLQEAQRELKEAARQHRDDLAALQE-----ESSSLLQDKMDLQKQ----VEDLKSQL 963

Query: 1309 SSMTLKLQWSEDDKTRLLRETEEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQA 1368
             .     .  | .    ||||.| .    || .              .|  . .    . 
Sbjct:  964 VAQDDSQRLVEQEVQEKLRETQEYNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQ 1023

Query: 1369 QEVTELRRRLHDAEDKERELHTSIRKLVREKEEHHQALVEQEDQISSLHKESH 1421
            ||.. ||. . .|. ...||   .  | .| .|     . || |.    . ||
Sbjct: 1024 QELSALRQDMQEAQGEQKELSAQMELLRQEVKEKEADFLAQEAQLLEELEASH 1076

>hg18||uc002zzw
        |22|NM_015330|Q69YQ0|CYTSA_HUMAN|SPECC1L|NM_015330|NP_056145|cytospin
        A

          Length = 1117

 Score =  55 bits (132), Expect = 5e-007
 Identities = 95/506 (18%), Positives = 195/506 (38%), Gaps = 44/506 (8%)

Query:  924 DSLKADRDRLIQDLKDQAMAVDTLQLQLDQISEELDQMRTA-----RSTVEKTLEEEQAR 978
            | |  | . |.      .|  | |  .  .. . |     |      |  |  |  |..|
Sbjct:  324 DLLSQDENTLMDHQHSNSM--DNLDSECSEVYQPLTSSDDALDAPSSSESEGILSIERSR 381

Query:  979 SXXXXXXXXXXXX-XVGHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVSCQLNQ 1037
                              . | ..     ...|   . |.  ..  . . |   . .| .
Sbjct:  382 KGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQEL-ADLQQITQELNSENERLGE 440

Query: 1038 TSNLVLDLRTQLNAKTSEADWLRTSSESLLRE--VQQLSDQLEVKSGDLGRAKKQVLHLE 1095
               ....   | . |            ||| |  .  . |. .||||       . . ||
Sbjct:  441 EKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVIDE-DVKSG-------RYMELE 492

Query: 1096 QVLLDSKNHLRLAEDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEE-VRSEN 1154
            |  .|   . |   .     .| ..  |   |      .|..         .|  . || 
Sbjct:  493 QRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQ 552

Query: 1155 GALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEE-ERLHEENSRYREEVLDL 1213
                     ...   ..  |  .  |   .||  ||. .| |   .|  ||  . .. ||
Sbjct:  553 KGKAALAATLEEYKATVASDQIEMNRLKAQLE--NEKQKVAELYSIH--NSGDKSDIQDL 608

Query: 1214 SNRNLQLSKDNAE-LSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXXXXXXXXE 1272
               ...| |. || |.. |. |    |    ||     . |.|                 
Sbjct:  609 L-ESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNM 667

Query: 1273 KLQQHVAWTQEKQL-----------MEKELGLHREKLVHVSALEAEISSMTLKLQWSEDD 1321
             |..  .   ||.            .| |.  ||   .| . . ... .   |||  . |
Sbjct:  668 TLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHD 727

Query: 1322 KTRLLRETEEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTELRRRLHDA 1381
              | ..    .      | .               .   |  |    .|. .|.||||.|
Sbjct:  728 MEREIKTLHRR------LREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEA 781

Query: 1382 EDKERELHTSIRKLVREKEEHHQALV 1407
            ..|  .|   . ..   |.|  .  |
Sbjct:  782 QEKNEKLTKELEEIKSRKQEEERGRV 807

>hg18||uc002alj
        |15|NM_001018007|Q9Y427|Q9Y427_HUMAN|TPM1|NM_001018007|NP_001018007|tro
        pomyosin 1 alpha chain isoform 2

          Length = 284

 Score =  55 bits (131), Expect = 7e-007
 Identities = 58/273 (21%), Positives = 113/273 (41%), Gaps = 21/273 (7%)

Query: 1146 RLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSR 1205
            | |.  ..  | ..| . ..      || |||     |.| | .|    | .|. ||  .
Sbjct:   21 RAEQAEADKKAAEDRSKQLE------EDIAAK-----EKLLRVSED---ERDRVLEELHK 66

Query: 1206 YREEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXX 1265
              . .|       .   | | |. |..  .| .   |||| |  .. ||           
Sbjct:   67 AEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEE------AEKAA 120

Query: 1266 XXXXXXEKLQQHVAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQWSEDDKTRL 1325
                   |. .  |   |...  .|. |   | .   | . .   .  ||   | |  | 
Sbjct:  121 DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDA-DRKYEEVARKLVIIESDLERA 179

Query: 1326 LRETEEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTELRRRLHDAEDKE 1385
                |    |  || .              | .  .|..    .|.  |  .| .|| . 
Sbjct:  180 EERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRA 239

Query: 1386 RELHTSIRKLVREKEEHHQALVEQEDQISSLHK 1418
                 |. || .  ..  . .   ...  |.|.
Sbjct:  240 EFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQ 272

>hg18||uc002axa
        |15|NM_001038640|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|go
        lgi autoantigen, golgin subfamily a, 6

          Length = 693

 Score =  54 bits (128), Expect = 2e-006
 Identities = 72/332 (21%), Positives = 146/332 (43%), Gaps = 34/332 (10%)

Query:  934 IQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXXXXXXV 993
            ||.|.    || | | . |. |          . ... |..                  .
Sbjct:  169 IQELERALCAVSTQQQEEDRSSS------CREAVLQRRLQQTIKERALLNAHVTQVTESL 222

Query:  994 GHLRQEKQTYA----GLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQL 1049
              .. |.  ||    |   .   .. .|  |  ||.|  .    .. .    . .|. |.
Sbjct:  223 KQVQLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQM 282

Query: 1050 NAKTSEADWLRTS-SESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLA 1108
                | |    ||  | |  | . |  ..|   |  |. . || . . . | ||   .  
Sbjct:  283 AEPPSLAPPAVTSVVEQLQDEAKHLRQEVE---GLEGKLQSQVENNQALSLLSKEQKQRL 339

Query: 1109 EDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEV 1168
            ..  |  ...  ... | | |                . | .| .   |||.   .... 
Sbjct:  340 QEQEEMLREQEAQRVREQERLC--------------EQNERLREQQKTLQEQGERLRKQE 385

Query: 1169 QSMEDDAAKKRRKLEELERTNERSRVEEERL--HEENSRYREEVLDLSNRNLQLSKDNAE 1226
            | .     . |.. | |..  .|   .||||   ||  . .|| | || .| .| |  ||
Sbjct:  386 QRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKEERLQKQEERLALS-QNHKLDKQLAE 444

Query: 1227 LSAR---LRGDQESVRLLQERLVTVAREQEEE 1255
                   |  ...|   |....  .  . .||
Sbjct:  445 PQCSFEDLNNEKKSALQLEQQVKELQEKLDEE 476

>hg18||uc002azs
        |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|golgi
        autoantigen, golgin subfamily a, 6

          Length = 681

 Score =  54 bits (128), Expect = 2e-006
 Identities = 72/332 (21%), Positives = 146/332 (43%), Gaps = 34/332 (10%)

Query:  934 IQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXXXXXXV 993
            ||.|.    || | | . |. |          . ... |..                  .
Sbjct:  157 IQELERALSAVSTQQQEEDRSSS------CREAVLQRRLQQTIKERALLNAHVTQVTESL 210

Query:  994 GHLRQEKQTYA----GLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQL 1049
              .. |.  ||    |   .   .. .|  |  ||.|  .    .. .    . .|. |.
Sbjct:  211 KQVQLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQM 270

Query: 1050 NAKTSEADWLRTS-SESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLA 1108
                | |    ||  | |  | . |  ..|   |  |. . || . . . | ||   .  
Sbjct:  271 AEPPSLAPPAVTSVVEQLQDEAKHLRQEVE---GLEGKLQSQVENNQALSLLSKEQKQRL 327

Query: 1109 EDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEV 1168
            ..  |  ...  ... | | |                . | .| .   |||.   .... 
Sbjct:  328 QEQEEMLREQEAQRVREQERLC--------------EQNERLREQQKTLQEQGERLRKQE 373

Query: 1169 QSMEDDAAKKRRKLEELERTNERSRVEEERL--HEENSRYREEVLDLSNRNLQLSKDNAE 1226
            | .     . |.. | |..  .|   .||||   ||  . .|| | || .| .| |  ||
Sbjct:  374 QRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKEERLQKQEERLALS-QNHKLDKQLAE 432

Query: 1227 LSAR---LRGDQESVRLLQERLVTVAREQEEE 1255
                   |  ...|   |....  .  . .||
Sbjct:  433 PQCSFEDLNNEKKSALQLEQQVKELQEKLDEE 464

>hg18||uc002azv
        |15|AF263742|Q9NYA3|GOGA6_HUMAN|GOLGA6|NM_001038640|NP_001033729|golgi
        autoantigen, golgin subfamily a, 6

          Length = 681

 Score =  54 bits (128), Expect = 2e-006
 Identities = 72/332 (21%), Positives = 146/332 (43%), Gaps = 34/332 (10%)

Query:  934 IQDLKDQAMAVDTLQLQLDQISEELDQMRTARSTVEKTLEEEQARSXXXXXXXXXXXXXV 993
            ||.|.    || | | . |. |          . ... |..                  .
Sbjct:  157 IQELERALCAVSTQQQEEDRSSS------CREAVLQRRLQQTIKERALLNAHVTQVTESL 210

Query:  994 GHLRQEKQTYA----GLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQL 1049
              .. |.  ||    |   .   .. .|  |  ||.|  .    .. .    . .|. |.
Sbjct:  211 KQVQLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQM 270

Query: 1050 NAKTSEADWLRTS-SESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLA 1108
                | |    ||  | |  | . |  ..|   |  |. . || . . . | ||   .  
Sbjct:  271 AEPPSLAPPAVTSVVEQLQDEAKHLRQEVE---GLEGKLQSQVENNQALSLLSKEQKQRL 327

Query: 1109 EDNFEQEKQRMTRQLVEMEGLVLALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEV 1168
            ..  |  ...  ... | | |                . | .| .   |||.   .... 
Sbjct:  328 QEQEEMLREQEAQRVREQERLC--------------EQNERLREQQKTLQEQGERLRKQE 373

Query: 1169 QSMEDDAAKKRRKLEELERTNERSRVEEERL--HEENSRYREEVLDLSNRNLQLSKDNAE 1226
            | .     . |.. | |..  .|   .||||   ||  . .|| | || .| .| |  ||
Sbjct:  374 QRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKEERLQKQEERLALS-QNHKLDKQLAE 432

Query: 1227 LSAR---LRGDQESVRLLQERLVTVAREQEEE 1255
                   |  ...|   |....  .  . .||
Sbjct:  433 PQCSFEDLNNEKKSALQLEQQVKELQEKLDEE 464

>hg18||uc002alo
        |15|AY640414|Q6DV90|Q6DV90_HUMAN|TPM1|NM_001018007|NP_001018007|tropomy
        osin 1 alpha chain isoform 2

          Length = 283

 Score =  53 bits (126), Expect = 3e-006
 Identities = 59/274 (21%), Positives = 112/274 (40%), Gaps = 21/274 (7%)

Query: 1146 RLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEELERTNERSRVEEERLHEENSR 1205
            | |.  ..  | ..| . ..      || |||     |.| | .|    | .|. ||  .
Sbjct:   21 RAEQAEADKKAAEDRSKQLE------EDIAAK-----EKLLRVSED---ERDRVLEELHK 66

Query: 1206 YREEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEGXXXXXXXXX 1265
              . .|       .   | | |. |..  .| .   |||| |  .. ||           
Sbjct:   67 AEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEE------AEKAA 120

Query: 1266 XXXXXXEKLQQHVAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQWSEDDKTRL 1325
                   |. .  |   |...  .|. |   | .   | . .   .  ||   | |  | 
Sbjct:  121 DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDA-DRKYEEVARKLVIIESDLERA 179

Query: 1326 LRETEEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTELRRRLHDAEDKE 1385
                |    |  || .              | .  .|..    .|.  |  .| .|| . 
Sbjct:  180 EERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRA 239

Query: 1386 RELHTSIRKLVREKEEHHQALVEQEDQISSLHKE 1419
                 |. || .  ..    |  |. .  .. .|
Sbjct:  240 EFAERSVTKLEKSIDDLEDELYAQKLKYKAISEE 273

>hg18||uc001azv |1|BC126912|NA|NA|KIAA0445|NA|NA|Homo sapiens mRNA for KIAA0445
        protein, partial cds

          Length = 353

 Score =  53 bits (125), Expect = 3e-006
 Identities = 67/315 (21%), Positives = 133/315 (42%), Gaps = 30/315 (9%)

Query: 1008 DQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQLNAKTSEADWLRTSSESLL 1067
            ..|.  . ..||    ||. .| ..  | |.|         ||.   .   |. .  .  
Sbjct:   44 ERLNGALAKVEESEGALRDKVRGLTEALAQSS-------ASLNSTRDKNLHLQKALTACE 96

Query: 1068 REVQQLSDQLEVKSGDLGRAKKQVLHL-EQVLLDSKNHLRLAEDNFEQEKQRMTRQLVEM 1126
             . | | ..|.     |  |.||   | |||                 |   .  | || 
Sbjct:   97 HDRQVLQERLDAARQALSEARKQSSSLGEQV------------QTLRGEVADLELQRVEA 144

Query: 1127 EGLVLALEEVV----DPTSPHRTRLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKL 1182
            || .  | ||.    .  .     ..... |   |||||  .|. .  .| .  .  |  
Sbjct:  145 EGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSA 204

Query: 1183 EELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQ 1242
              ||.     |   ...  |  |  |. . ||    .| .        |   |  .. |.
Sbjct:  205 LRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLE 264

Query: 1243 ERLVTVAREQEEEGXXXXXXXXXXXXXXXEKLQQ-HVAWTQEKQLMEKELGLHREKLVHV 1301
             ..| .  ||                   .....   |  | .. .|     ||..   |
Sbjct:  265 AQVVVL--EQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQR---V 319

Query: 1302 SALEAEISSMTLKLQ 1316
              || ..|..  .||
Sbjct:  320 RGLEEQVSTLKGQLQ 334

>hg18||uc003dhr
        |3|NM_015576|O15083|ERC2_HUMAN|ERC2|NM_015576|NP_056391|cytomatrix
        protein p110

          Length = 957

 Score =  52 bits (124), Expect = 5e-006
 Identities = 45/183 (24%), Positives = 80/183 (43%), Gaps = 18/183 (9%)

Query: 1008 DQLSTQIVEMEEEICTLREHL--REVSCQLNQTSNLVLDLRTQ-----LNAKTSEADWLR 1060
            . || |  . .. |  |.| |  .|    . ||    | || .     || || .   | 
Sbjct:  458 ETLSNQNSDCKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLT 517

Query: 1061 TSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAED---NFEQEKQ 1117
                .|  |.. . | ||||   .   .|.. .|.. | |    |   .|   . . .  
Sbjct:  518 EEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSS 577

Query: 1118 RMTRQLVEMEGLVLALEEVVDPTSPHRTR--------LEEVRSENGALQERLRVMQQEVQ 1169
                 |  .|  .   | ...     | |        .|  | ||  |.|..  .| |. 
Sbjct:  578 NTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVNALQAELT 637

Query: 1170 SME 1172
              |
Sbjct:  638 EKE 640

>hg18||uc001hnl
        |1|NM_198551|Q5JRA6|Q5JRA6_HUMAN|MIA3|NM_198551|NP_940953|melanoma
        inhibitory activity family, member 3

          Length = 1907

 Score =  52 bits (122), Expect = 8e-006
 Identities = 44/188 (23%), Positives = 95/188 (50%), Gaps = 19/188 (10%)

Query: 1071 QQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAEDNFEQEKQRM--TRQLVEMEG 1128
            ||.|..|.    .     ... . || . .|| |..      |  || |  . . .. . 
Sbjct: 1214 QQISEKLKTIMKENTELVQKLSNYEQKIKESKKHVQ------ETRKQNMILSDEAIKYKD 1267

Query: 1129 LVLALE---EVVDPTSPH-RTRLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEE 1184
             .  ||   |..| |. . |  ||  | .|   |. .   .. .. ..|  .    .  |
Sbjct: 1268 KIKTLEKNQEILDDTAKNLRVMLESEREQNVKNQDLISENKKSIEKLKDVISMNASEFSE 1327

Query: 1185 LERTNERSRVEEERLHEENSRYREEVLDLSNRNLQL-------SKDNAELSARLRGDQES 1237
            ..     ... ||..  |  | .||   |  .  ||       || .|||| ...  ..|
Sbjct: 1328 VQIALNEAKLSEEKVKSECHRVQEENARLKKKKEQLQQEIEDWSKLHAELSEQIKSFEKS 1387

Query: 1238 VRLLQERL 1245
             . |.  |
Sbjct: 1388 QKDLEVAL 1395

>hg18||uc001hnm
        |1|AX775845|Q5JRB1|Q5JRB1_HUMAN|MIA3|NM_198551|NP_940953|melanoma
        inhibitory activity family, member 3

          Length = 785

 Score =  52 bits (122), Expect = 8e-006
 Identities = 44/188 (23%), Positives = 95/188 (50%), Gaps = 19/188 (10%)

Query: 1071 QQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAEDNFEQEKQRM--TRQLVEMEG 1128
            ||.|..|.    .     ... . || . .|| |..      |  || |  . . .. . 
Sbjct:   92 QQISEKLKTIMKENTELVQKLSNYEQKIKESKKHVQ------ETRKQNMILSDEAIKYKD 145

Query: 1129 LVLALE---EVVDPTSPH-RTRLEEVRSENGALQERLRVMQQEVQSMEDDAAKKRRKLEE 1184
             .  ||   |..| |. . |  ||  | .|   |. .   .. .. ..|  .    .  |
Sbjct:  146 KIKTLEKNQEILDDTAKNLRVMLESEREQNVKNQDLISENKKSIEKLKDVISMNASEFSE 205

Query: 1185 LERTNERSRVEEERLHEENSRYREEVLDLSNRNLQL-------SKDNAELSARLRGDQES 1237
            ..     ... ||..  |  | .||   |  .  ||       || .|||| ...  ..|
Sbjct:  206 VQIALNEAKLSEEKVKSECHRVQEENARLKKKKEQLQQEIEDWSKLHAELSEQIKSFEKS 265

Query: 1238 VRLLQERL 1245
             . |.  |
Sbjct:  266 QKDLEVAL 273

>hg18||uc003eei |3|NM_004487|Q14789|GOGB1_HUMAN|GOLGB1|NM_004487|NP_004478|golgi
        autoantigen, golgin subfamily b,

          Length = 3259

 Score =  51 bits (120), Expect = 1e-005
 Identities = 48/256 (18%), Positives = 112/256 (43%), Gaps = 22/256 (8%)

Query:  994 GHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQLNAKT 1053
            | .| | .|      .|.  .||||...  . .  . .. |.      .  |.   .   
Sbjct: 2692 GIMRNETETAEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHAN 2751

Query: 1054 SEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAEDNFE 1113
             | | |.   .. |.|. || .|     | | | .      . .| ..   .   |.|  
Sbjct: 2752 EELDELKRKYDASLKELAQLKEQ-----GLLNRER------DALLSETAFSMNSTEENSL 2800

Query: 1114 QEKQRMTRQLVEMEGLVL----ALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEVQ 1169
               ... .||.  .  .|     ||.  .        .  ...|   |   |   ..  .
Sbjct: 2801 SHLEKLNQQLLSKDEQLLHLSSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEE 2860

Query: 1170 SMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLSKDNAE--- 1226
              .  ||.      |..   .        |  .  |  .|. .|  . ||....  |   
Sbjct: 2861 GKQRSAAQPSTSPAEVQSLKKAM----SSLQNDRDRLLKELKNLQQQYLQINQEITELHP 2916

Query: 1227 LSARLRGDQESVRLLQ 1242
            | |.|.  |.  .  |
Sbjct: 2917 LKAQLQEYQDKTKAFQ 2932

>hg18||uc003eej |3|D25542|NA|NA|GOLGB1|NA|NA|Homo sapiens cDNA clone
        IMAGE:4702419, partial cds

          Length = 3225

 Score =  51 bits (120), Expect = 1e-005
 Identities = 48/256 (18%), Positives = 112/256 (43%), Gaps = 22/256 (8%)

Query:  994 GHLRQEKQTYAGLADQLSTQIVEMEEEICTLREHLREVSCQLNQTSNLVLDLRTQLNAKT 1053
            | .| | .|      .|.  .||||...  . .  . .. |.      .  |.   .   
Sbjct: 2658 GIMRNETETAEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHAN 2717

Query: 1054 SEADWLRTSSESLLREVQQLSDQLEVKSGDLGRAKKQVLHLEQVLLDSKNHLRLAEDNFE 1113
             | | |.   .. |.|. || .|     | | | .      . .| ..   .   |.|  
Sbjct: 2718 EELDELKRKYDASLKELAQLKEQ-----GLLNRER------DALLSETAFSMNSTEENSL 2766

Query: 1114 QEKQRMTRQLVEMEGLVL----ALEEVVDPTSPHRTRLEEVRSENGALQERLRVMQQEVQ 1169
               ... .||.  .  .|     ||.  .        .  ...|   |   |   ..  .
Sbjct: 2767 SHLEKLNQQLLSKDEQLLHLSSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEE 2826

Query: 1170 SMEDDAAKKRRKLEELERTNERSRVEEERLHEENSRYREEVLDLSNRNLQLSKDNAE--- 1226
              .  ||.      |..   .        |  .  |  .|. .|  . ||....  |   
Sbjct: 2827 GKQRSAAQPSTSPAEVQSLKKAM----SSLQNDRDRLLKELKNLQQQYLQINQEITELHP 2882

Query: 1227 LSARLRGDQESVRLLQ 1242
            | |.|.  |.  .  |
Sbjct: 2883 LKAQLQEYQDKTKAFQ 2898

>hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP_003283|nuclear
        pore complex-associated protein TPR

          Length = 2363

 Score =  50 bits (119), Expect = 2e-005
 Identities = 61/287 (21%), Positives = 123/287 (42%), Gaps = 19/287 (6%)

Query: 1143 HRTRLEEVRSENGALQERLRVMQQEVQ------SMEDDAAKKRRKLEELERTNERSRVEE 1196
            .| |.| .  |   ||. |   ...||      .  ..  ||   .  .  ||.  | |.
Sbjct: 1224 YRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEK 1283

Query: 1197 ERLHEENSRYREEVLDLSNRNLQLSKDNAELSARLRGDQESVRLLQERLVTVAREQEEEG 1256
            ||| ..  . . .|  |    | | . ||||| .    |   .||.|    | | .    
Sbjct: 1284 ERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEKKLLEE---DVKRWKARNQ 1340

Query: 1257 XXXXXXXXXXXXXXXEKLQQHVAWTQEKQLMEKELGLHREKLVHVSALEAEISSMTLKLQ 1316
                           . | .    |.  | . .|.|  . ..   .|      ..   |.
Sbjct: 1341 HLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLK 1400

Query: 1317 WSEDDKTRLLRET--EEQSNKVVELHQXXXXXXXXXXXXXXQLQAVNQEKLSQAQEVTEL 1374
              . .| |  .||  ..   |.... |              . .   .|  .|  .| | 
Sbjct: 1401 -EDLNKVRTEKETIQKDLDAKIIDI-QEKVKTITQVKKIGRRYKTQYEELKAQQDKVMET 1458

Query: 1375 RRRLHDAEDKERELHTSIRKLVREKEEHHQALVEQ---EDQISSLHK 1418
              .   .    .| | |....   ||  .||  .    | |. .| |
Sbjct: 1459 SAQ---SSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENLQK 1502

>hg18||uc002xbi
        |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884|NP_065935|myosin,
        heavy polypeptide 7B, cardiac muscle,

          Length = 1983

 Score =  50 bits (119), Expect = 2e-005
 Identities = 39/165 (23%), Positives = 86/165 (52%), Gaps = 8/165 (4%)

Query:  685 EQERKMQRERAEMEQNFAREIGNLVQRLSSEKDQLEA--ELKLKMDQEVSLLREKAEQQR 742
            |   .. .|.  ...   . .|.    | .|.|.. |  . ||...|.|  |    ||..
Sbjct: 1036 ESVARLTKEKKALQEAHQQALGD----LQAEEDRVSALTKAKLRLEQQVEDLECSLEQEK 1091

Query:  743 SHLELQQADSQRRLLHQLHCERQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQ 802
              | .    ..|.|   |   .. . .     . .| .  ..|   . |     .   | 
Sbjct: 1092 K-LRMDTERAKRKLEGDLKLTQESVAD-AAQDKQQLEEKLKKKDSELSQLSLRVEDEQLL 1149

Query:  803 ISQSEKSVEALRARCGRVEEELKESRAQASELEARLLEACAQLEE 847
             .| .| .. |.||   .||||.  ||  . .| .  ||  .|||
Sbjct: 1150 GAQMQKKIKELQARAEELEEELEAERAARARVEKQRAEAARELEE 1194

>hg18||uc001wyp |14|BC065521|NA|NA|KIAA1565|NA|NA|Homo sapiens mRNA for KIAA1565
        protein, partial cds

          Length = 440

 Score =  50 bits (118), Expect = 2e-005
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query:  68 LLDTLLRRGACGRVNFEEFKDGFVAVXXXXXXXXXXXXXXXYLEPVIPEEVKPKFVKGKK 127
           |  |||.    |||.|..||.  . .               . ||    | .||.|.| |
Sbjct:  11 LQQTLLQDNLLGRVHFDQFKEALILI-----LSRTLSNEEHFQEPDCSLEAQPKYVRGGK 65

Query: 128 RYGRRSRPDKPES 140
           |||||| |.  ||
Sbjct:  66 RYGRRSLPEFQES 78

>hg18||uc003zab
        |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|NP_958786|plectin 1
        isoform 11

          Length = 4547

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1329 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1388

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1389 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1448

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1449 RIEEEIRVVRLQLEATE 1465

>hg18||uc003zac
        |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|NP_958785|plectin 1
        isoform 10

          Length = 4551

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1333 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1392

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1393 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1452

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1453 RIEEEIRVVRLQLEATE 1469

>hg18||uc003zad
        |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|NP_958784|plectin 1
        isoform 8

          Length = 4547

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1329 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1388

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1389 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1448

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1449 RIEEEIRVVRLQLEATE 1465

>hg18||uc003zae
        |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|NP_958783|plectin 1
        isoform 7

          Length = 4515

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1297 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1356

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1357 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1416

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1417 RIEEEIRVVRLQLEATE 1433

>hg18||uc003zaf
        |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|NP_958782|plectin 1
        isoform 6

          Length = 4684

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1466 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1525

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1526 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1585

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1586 RIEEEIRVVRLQLEATE 1602

>hg18||uc003zag
        |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|NP_958781|plectin 1
        isoform 3

          Length = 4525

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1307 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1366

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1367 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1426

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1427 RIEEEIRVVRLQLEATE 1443

>hg18||uc003zah
        |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|NP_958780|plectin 1
        isoform 2

          Length = 4533

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1315 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1374

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1375 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1434

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1435 RIEEEIRVVRLQLEATE 1451

>hg18||uc003zai
        |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_000436|plectin 1
        isoform 1

          Length = 4574

 Score =  50 bits (118), Expect = 2e-005
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query:  712 LSSEKDQLEAELKLKMDQEVSLLREKAEQQRSHL-ELQQADSQRRLLHQLHCE------- 763
            |.|.  .  .|   .|..|  |  ..  ..|  | |.. |  ..| | . | .       
Sbjct: 1356 LTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAER 1415

Query:  764 -----RQRMQEPRVLWEIELTQSEQEKKRVVEQHEEANQTSNLQISQSEKSVEALRARCG 818
                 .|||||  |  |     ..|.|. . |. ..  |.|  .|    .  ||      
Sbjct: 1416 EAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRL 1475

Query:  819 RVEEELKESRAQASELE 835
            |.|||..  | |    |
Sbjct: 1476 RIEEEIRVVRLQLEATE 1492

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0