BLASTP 7.6.0


Query=fugu4_742515 |jgi|Takru4|742515|fgh5_pg.C_scaffold_441000002
        (424 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002qap |19|AK056776|Q1WWM0|Q1WWM0_HUMAN|FLJ32214|NA|NA|F...     36   0.095

>hg18||uc002qap |19|AK056776|Q1WWM0|Q1WWM0_HUMAN|FLJ32214|NA|NA|FLJ32214 protein
        (Fragment)

          Length = 327

 Score =  36 bits (81), Expect = 0.095
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 238 GGVAKNILRLEMVDYRLKVFTNLTKVALTGVKEELTALRLMTMQNRMALDLLTASGGGVC 297
           ||   . . |  .  ..      |. ... .|  . .|  . | ||.||| | |  ||||
Sbjct: 190 GGFTYHDVTLRNLSRQIDNIAKSTRDSISKLKASIDSLANVVMNNRLALDYLLAEQGGVC 249

Query: 298 TM 299
            .
Sbjct: 250 AV 251

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 190,549,688
Number of Sequences: 45480
Number of Extensions: 190549688
Number of Successful Extensions: 11294661
Number of sequences better than 0.0: 0
BLASTP 7.6.0