BLASTP 7.6.0


Query=fugu4_742495 |jgi|Takru4|742495|fgh5_pg.C_scaffold_439000008
        (389 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002gqu |17|NM_201274|Q6WCQ1|MRIP_HUMAN|M-RIP|NM_201274|N...     61   2e-009
hg18||uc002gqv |17|NM_015134|Q6WCQ1-2|Q6WCQ1-2|M-RIP|NM_015134|N...     61   2e-009
hg18||uc002gqw |17|BC009982|Q6WCQ1-3|Q6WCQ1-3|M-RIP|NM_015134|NP...     61   2e-009
hg18||uc002gqx |17|AK025604|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|K...     61   2e-009
hg18||uc002gqy |17|BC050323|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|K...     61   2e-009
hg18||uc003att |22|NM_001039141|Q9H2D6|TARA_HUMAN|TRIOBP|NM_0010...     58   2e-008
hg18||uc003atu |22|DQ228003|Q9H2D6-3|Q9H2D6-3|TRIOBP|NA|NA|TRIO ...     58   2e-008
hg18||uc003atw |22|NM_007032|Q9H2D6-5|Q9H2D6-5|TRIOBP|NM_007032|...     58   2e-008
hg18||uc003atx |22|AL713698|Q8TCM3|Q8TCM3_HUMAN|TRIOBP|NM_007032...     54   2e-007
hg18||uc003zab |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|...     38   0.022
hg18||uc003zac |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|...     38   0.022
hg18||uc003zad |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|...     38   0.022
hg18||uc003zae |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|...     38   0.022
hg18||uc003zaf |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|...     38   0.022
hg18||uc003zag |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|...     38   0.022
hg18||uc003zah |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|...     38   0.022
hg18||uc003zai |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|...     38   0.022
hg18||uc003zaj |8|U53204|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_...     38   0.022
hg18||uc002gqu |17|NM_201274|Q6WCQ1|MRIP_HUMAN|M-RIP|NM_201274|N...     32   1.230
hg18||uc002gqv |17|NM_015134|Q6WCQ1-2|Q6WCQ1-2|M-RIP|NM_015134|N...     32   1.230
hg18||uc002gqw |17|BC009982|Q6WCQ1-3|Q6WCQ1-3|M-RIP|NM_015134|NP...     32   1.230
hg18||uc002gqx |17|AK025604|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|K...     32   1.230
hg18||uc002gqy |17|BC050323|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|K...     32   1.230
hg18||uc001csp |1|BX647676|NA|NA|EPS15|NM_001981|NP_001972|epide...     31   2.097
hg18||uc001csq |1|NM_001981|P42566|EP15_HUMAN|EPS15|NM_001981|NP...     31   2.097
hg18||uc002pmr |19|NM_003660|O75145|LIPA3_HUMAN|PPFIA3|NM_003660...     31   2.097
hg18||uc002pms |19|AK025972|O75145-2|O75145-2|PPFIA3|NM_003660|N...     31   2.097
hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_0...     31   2.097
hg18||uc001xdz |14|NM_014992|Q9Y4D1|DAAM1_HUMAN|DAAM1|NM_014992|...     31   2.739
hg18||uc001xea |14|BC038428|Q9Y4D1-2|Q9Y4D1-2|DAAM1|NM_014992|NP...     31   2.739
hg18||uc002gjp |17|NM_001037144|Q8N137-2|Q8N137-2|CNTROB|NM_0010...     30   3.578
hg18||uc002gjq |17|NM_053051|Q8N137|CNTRB_HUMAN|CNTROB|NM_053051...     30   3.578
hg18||uc002gjr |17|BC014055|Q8N137-3|Q8N137-3|CNTROB|NM_053051|N...     30   3.578
hg18||uc002xbi |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884...     30   3.578
hg18||uc003kqj |5|NM_002387|P23508|CRCM_HUMAN|MCC|NM_002387|NP_0...     30   3.578
hg18||uc003kql |5|AK128596|Q6ZR04|Q6ZR04_HUMAN|MCC|NA|NA|CDNA FL...     30   3.578
hg18||uc003pyj |6|NM_024581|Q8NB25|CF060_HUMAN|C6orf60|NM_024581...     30   3.578
hg18||uc003pyk |6|BX538186|Q7Z323|Q7Z323_HUMAN|C6orf60|NM_024581...     30   3.578
hg18||uc003pyl |6|AX747126|Q8NB25-2|Q8NB25-2|C6orf60|NM_024581|N...     30   3.578
hg18||uc002cyd |16|NM_002705|Q14C98|Q14C98_HUMAN|PPL|NM_002705|N...     29   7.970

>hg18||uc002gqu |17|NM_201274|Q6WCQ1|MRIP_HUMAN|M-RIP|NM_201274|NP_958431|myosin
        phosphatase-Rho interacting protein

          Length = 1025

 Score =  61 bits (146), Expect = 2e-009
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query: 286 QAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFC-----S 340
           ||.|| | | . .  |  .     .|||   || ||||.|  |||    | .        
Sbjct: 839 QALEAERQALR-QCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGK 897

Query: 341 DSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETAS 381
           |. .|| ||| |..|.| ||.||| |. |.|   .... ||
Sbjct: 898 DAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYAS 938

>hg18||uc002gqv |17|NM_015134|Q6WCQ1-2|Q6WCQ1-2|M-RIP|NM_015134|NP_055949|myosin
        phosphatase-Rho interacting protein

          Length = 1038

 Score =  61 bits (146), Expect = 2e-009
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query: 286 QAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFC-----S 340
           ||.|| | | . .  |  .     .|||   || ||||.|  |||    | .        
Sbjct: 839 QALEAERQALR-QCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGK 897

Query: 341 DSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETAS 381
           |. .|| ||| |..|.| ||.||| |. |.|   .... ||
Sbjct: 898 DAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYAS 938

>hg18||uc002gqw |17|BC009982|Q6WCQ1-3|Q6WCQ1-3|M-RIP|NM_015134|NP_055949|myosin
        phosphatase-Rho interacting protein

          Length = 793

 Score =  61 bits (146), Expect = 2e-009
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query: 286 QAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFC-----S 340
           ||.|| | | . .  |  .     .|||   || ||||.|  |||    | .        
Sbjct: 594 QALEAERQALR-QCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGK 652

Query: 341 DSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETAS 381
           |. .|| ||| |..|.| ||.||| |. |.|   .... ||
Sbjct: 653 DAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYAS 693

>hg18||uc002gqx |17|AK025604|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|KIAA0864 protein
        (Fragment)

          Length = 1254

 Score =  61 bits (146), Expect = 2e-009
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query:  286 QAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFC-----S 340
            ||.|| | | . .  |  .     .|||   || ||||.|  |||    | .        
Sbjct: 1068 QALEAERQALR-QCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGK 1126

Query:  341 DSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETAS 381
            |. .|| ||| |..|.| ||.||| |. |.|   .... ||
Sbjct: 1127 DAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYAS 1167

>hg18||uc002gqy |17|BC050323|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|KIAA0864 protein
        (Fragment)

          Length = 1267

 Score =  61 bits (146), Expect = 2e-009
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query:  286 QAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFC-----S 340
            ||.|| | | . .  |  .     .|||   || ||||.|  |||    | .        
Sbjct: 1068 QALEAERQALR-QCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGK 1126

Query:  341 DSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETAS 381
            |. .|| ||| |..|.| ||.||| |. |.|   .... ||
Sbjct: 1127 DAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYAS 1167

>hg18||uc003att
        |22|NM_001039141|Q9H2D6|TARA_HUMAN|TRIOBP|NM_001039141|NP_001034230|TRI
        O and F-actin binding protein isoform 6

          Length = 2365

 Score =  58 bits (138), Expect = 2e-008
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 17/114 (14%)

Query:  281 IQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQ-------RS 333
            .. ||.    ||   .|     |      .|||   |.||| ..| |.  |       ||
Sbjct: 2220 MRQAEEREHTLRRCQQEGQELLRH-----NQELHGRLSEEIDQLRGFIASQGMGNGCGRS 2274

Query:  334 DEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKE-RETASKQQRV 386
            .| | |    .|| ||| |.||.| ||||.  |. |.| . |. | |. | | |
Sbjct: 2275 NERSSC----ELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDV 2324

>hg18||uc003atu |22|DQ228003|Q9H2D6-3|Q9H2D6-3|TRIOBP|NA|NA|TRIO and
        F-actin-binding protein (Protein Tara) (Trio-associated repeat on
        actin)

          Length = 2193

 Score =  58 bits (138), Expect = 2e-008
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 17/114 (14%)

Query:  281 IQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQ-------RS 333
            .. ||.    ||   .|     |      .|||   |.||| ..| |.  |       ||
Sbjct: 2048 MRQAEEREHTLRRCQQEGQELLRH-----NQELHGRLSEEIDQLRGFIASQGMGNGCGRS 2102

Query:  334 DEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKE-RETASKQQRV 386
            .| | |    .|| ||| |.||.| ||||.  |. |.| . |. | |. | | |
Sbjct: 2103 NERSSC----ELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDV 2152

>hg18||uc003atw |22|NM_007032|Q9H2D6-5|Q9H2D6-5|TRIOBP|NM_007032|NP_008963|TRIO
        and F-actin binding protein isoform 1

          Length = 652

 Score =  58 bits (138), Expect = 2e-008
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 17/114 (14%)

Query: 281 IQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQ-------RS 333
           .. ||.    ||   .|     |      .|||   |.||| ..| |.  |       ||
Sbjct: 507 MRQAEEREHTLRRCQQEGQELLRH-----NQELHGRLSEEIDQLRGFIASQGMGNGCGRS 561

Query: 334 DEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKE-RETASKQQRV 386
           .| | |    .|| ||| |.||.| ||||.  |. |.| . |. | |. | | |
Sbjct: 562 NERSSC----ELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDV 611

>hg18||uc003atx |22|AL713698|Q8TCM3|Q8TCM3_HUMAN|TRIOBP|NM_007032|NP_008963|TRIO
        and F-actin binding protein isoform 1

          Length = 247

 Score =  54 bits (129), Expect = 2e-007
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 16/102 (15%)

Query: 281 IQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQ-------RS 333
           .. ||.    ||   .|     |      .|||   |.||| ..| |.  |       ||
Sbjct: 103 MRQAEEREHTLRRCQQEGQELLRH-----NQELHGRLSEEIDQLRGFIASQGMGNGCGRS 157

Query: 334 DEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTK 375
           .| | |    .|| ||| |.||.| ||||.  |. |.| . |
Sbjct: 158 NERSSC----ELEVLLRVKENELQYLKKEVQCLRDELQMMQK 195

>hg18||uc003zab
        |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|NP_958786|plectin 1
        isoform 11

          Length = 4547

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1645 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1704

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1705 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1751

>hg18||uc003zac
        |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|NP_958785|plectin 1
        isoform 10

          Length = 4551

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1649 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1708

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1709 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1755

>hg18||uc003zad
        |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|NP_958784|plectin 1
        isoform 8

          Length = 4547

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1645 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1704

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1705 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1751

>hg18||uc003zae
        |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|NP_958783|plectin 1
        isoform 7

          Length = 4515

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1613 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1672

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1673 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1719

>hg18||uc003zaf
        |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|NP_958782|plectin 1
        isoform 6

          Length = 4684

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1782 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1841

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1842 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1888

>hg18||uc003zag
        |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|NP_958781|plectin 1
        isoform 3

          Length = 4525

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1623 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1682

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1683 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1729

>hg18||uc003zah
        |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|NP_958780|plectin 1
        isoform 2

          Length = 4533

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1631 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1690

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1691 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1737

>hg18||uc003zai
        |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_000436|plectin 1
        isoform 1

          Length = 4574

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1672 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1731

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1732 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1778

>hg18||uc003zaj |8|U53204|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_000436|plectin
        1 isoform 1

          Length = 4574

 Score =  38 bits (86), Expect = 0.022
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query:  275 RLMQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQEL--KANLAE-EITRMRYFLTGQ 331
            ||   |.   .   .|     |||  |  |  |  ...   .  ||| |. . |    | 
Sbjct: 1672 RLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGT 1731

Query:  332 RSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                 .   .  .|       . . | |..|..|||||  | |..|.
Sbjct: 1732 AQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQ 1778

>hg18||uc002gqu |17|NM_201274|Q6WCQ1|MRIP_HUMAN|M-RIP|NM_201274|NP_958431|myosin
        phosphatase-Rho interacting protein

          Length = 1025

 Score =  32 bits (71), Expect = 1.230
 Identities = 19/64 (29%), Positives = 26/64 (40%)

Query: 238 APCRAKLEAMEIAHXXXXXXXXXXXXXXXXXXXXXKDRLMQVEIQSAEQAMEALRAAHKE 297
           | |     |||  |                     ||||.  |  .   |.||.. ||.|
Sbjct: 722 ATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHRE 781

Query: 298 ELGR 301
           |. |
Sbjct: 782 EMER 785

>hg18||uc002gqv |17|NM_015134|Q6WCQ1-2|Q6WCQ1-2|M-RIP|NM_015134|NP_055949|myosin
        phosphatase-Rho interacting protein

          Length = 1038

 Score =  32 bits (71), Expect = 1.230
 Identities = 19/64 (29%), Positives = 26/64 (40%)

Query: 238 APCRAKLEAMEIAHXXXXXXXXXXXXXXXXXXXXXKDRLMQVEIQSAEQAMEALRAAHKE 297
           | |     |||  |                     ||||.  |  .   |.||.. ||.|
Sbjct: 722 ATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHRE 781

Query: 298 ELGR 301
           |. |
Sbjct: 782 EMER 785

>hg18||uc002gqw |17|BC009982|Q6WCQ1-3|Q6WCQ1-3|M-RIP|NM_015134|NP_055949|myosin
        phosphatase-Rho interacting protein

          Length = 793

 Score =  32 bits (71), Expect = 1.230
 Identities = 19/64 (29%), Positives = 26/64 (40%)

Query: 238 APCRAKLEAMEIAHXXXXXXXXXXXXXXXXXXXXXKDRLMQVEIQSAEQAMEALRAAHKE 297
           | |     |||  |                     ||||.  |  .   |.||.. ||.|
Sbjct: 477 ATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHRE 536

Query: 298 ELGR 301
           |. |
Sbjct: 537 EMER 540

>hg18||uc002gqx |17|AK025604|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|KIAA0864 protein
        (Fragment)

          Length = 1254

 Score =  32 bits (71), Expect = 1.230
 Identities = 19/64 (29%), Positives = 26/64 (40%)

Query:  238 APCRAKLEAMEIAHXXXXXXXXXXXXXXXXXXXXXKDRLMQVEIQSAEQAMEALRAAHKE 297
            | |     |||  |                     ||||.  |  .   |.||.. ||.|
Sbjct:  951 ATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHRE 1010

Query:  298 ELGR 301
            |. |
Sbjct: 1011 EMER 1014

>hg18||uc002gqy |17|BC050323|Q9Y6X7|Q9Y6X7_HUMAN|KIAA0864|NA|NA|KIAA0864 protein
        (Fragment)

          Length = 1267

 Score =  32 bits (71), Expect = 1.230
 Identities = 19/64 (29%), Positives = 26/64 (40%)

Query:  238 APCRAKLEAMEIAHXXXXXXXXXXXXXXXXXXXXXKDRLMQVEIQSAEQAMEALRAAHKE 297
            | |     |||  |                     ||||.  |  .   |.||.. ||.|
Sbjct:  951 ATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHRE 1010

Query:  298 ELGR 301
            |. |
Sbjct: 1011 EMER 1014

>hg18||uc001csp |1|BX647676|NA|NA|EPS15|NM_001981|NP_001972|epidermal growth
        factor receptor pathway

          Length = 582

 Score =  31 bits (69), Expect = 2.097
 Identities = 24/107 (22%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 277 MQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEP 336
           .| |.|     .. |.|  ..     . |    |.. || | |..  .|     .     
Sbjct:  59 LQDEVQRENTNLQKLQAQKQQ----VQELLDELDEQ-KAQLEEQLKEVRKKCAEEAQLIS 113

Query: 337 SFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQ 383
           |  .. .  |. .   . |.   ..|.||||.|   | .  |.   |
Sbjct: 114 SLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQ 160

>hg18||uc001csq
        |1|NM_001981|P42566|EP15_HUMAN|EPS15|NM_001981|NP_001972|epidermal
        growth factor receptor pathway

          Length = 896

 Score =  31 bits (69), Expect = 2.097
 Identities = 24/107 (22%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 277 MQVEIQSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEP 336
           .| |.|     .. |.|  ..     . |    |.. || | |..  .|     .     
Sbjct: 373 LQDEVQRENTNLQKLQAQKQQ----VQELLDELDEQ-KAQLEEQLKEVRKKCAEEAQLIS 427

Query: 337 SFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQ 383
           |  .. .  |. .   . |.   ..|.||||.|   | .  |.   |
Sbjct: 428 SLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQ 474

>hg18||uc002pmr
        |19|NM_003660|O75145|LIPA3_HUMAN|PPFIA3|NM_003660|NP_003651|PTPRF
        interacting protein alpha 3

          Length = 1194

 Score =  31 bits (69), Expect = 2.097
 Identities = 21/72 (29%), Positives = 31/72 (43%)

Query: 307 GGTDQELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRL 366
           ||      | | | . | |  .   |      |   ||||  |     |.   ..  |.|
Sbjct: 228 GGDSNRRTAELEEALERQRAEVCQLRERLAVLCRQMSQLEEELGTAHRELGKAEEANSKL 287

Query: 367 QREVQALTKERE 378
           ||...    .||
Sbjct: 288 QRDLKEALAQRE 299

>hg18||uc002pms |19|AK025972|O75145-2|O75145-2|PPFIA3|NM_003660|NP_003651|PTPRF
        interacting protein alpha 3

          Length = 1053

 Score =  31 bits (69), Expect = 2.097
 Identities = 21/72 (29%), Positives = 31/72 (43%)

Query: 307 GGTDQELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRL 366
           ||      | | | . | |  .   |      |   ||||  |     |.   ..  |.|
Sbjct:  96 GGDSNRRTAELEEALERQRAEVCQLRERLAVLCRQMSQLEEELGTAHRELGKAEEANSKL 155

Query: 367 QREVQALTKERE 378
           ||...    .||
Sbjct: 156 QRDLKEALAQRE 167

>hg18||uc003pdc |6|NM_001723|Q03001-3|Q03001-3|DST|NM_001723|NP_001714|dystonin
        isoform 1e precursor

          Length = 2649

 Score =  31 bits (69), Expect = 2.097
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query:  296 KEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNE 355
            | || |  .   |  |.|.     |. |     ||.  .      ..| |. . |    |
Sbjct: 1421 KLELERKDQAEKGYSQQLR-----ELGRQLNQTTGKAEEA---MQEASDLKKIKRNYQLE 1472

Query:  356 VQCLKKEISRLQREVQALTKERETASK 382
            .. |  |  .|||||  .|.    | |
Sbjct: 1473 LESLNHEKGKLQREVDRITRAHAVAEK 1499

>hg18||uc001xdz
        |14|NM_014992|Q9Y4D1|DAAM1_HUMAN|DAAM1|NM_014992|NP_055807|dishevelled-
        associated activator of

          Length = 1078

 Score =  31 bits (68), Expect = 2.739
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 312 ELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQ 371
           . |... . || . | .|   .  ||  . . .|  . .|    .  | |||| |.  ..
Sbjct: 845 DTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLK 904

Query: 372 ALTKERETASKQ 383
           |.  | |    |
Sbjct: 905 AVETELEYQKSQ 916

>hg18||uc001xea
        |14|BC038428|Q9Y4D1-2|Q9Y4D1-2|DAAM1|NM_014992|NP_055807|dishevelled-as
        sociated activator of

          Length = 1068

 Score =  31 bits (68), Expect = 2.739
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 312 ELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQ 371
           . |... . || . | .|   .  ||  . . .|  . .|    .  | |||| |.  ..
Sbjct: 835 DTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLK 894

Query: 372 ALTKERETASKQ 383
           |.  | |    |
Sbjct: 895 AVETELEYQKSQ 906

>hg18||uc002gjp
        |17|NM_001037144|Q8N137-2|Q8N137-2|CNTROB|NM_001037144|NP_001032221|LYS
        T-interacting protein LIP8 isoform beta

          Length = 925

 Score =  30 bits (67), Expect = 3.578
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 2/109 (1%)

Query: 282 QSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSD--EPSFC 339
           ||  .|||||    .    . |      ..     |  |  . |  .  .  |       
Sbjct: 283 QSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQL 342

Query: 340 SDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQQRVSS 388
           |.  .||||  | . | |   ..  .|.   ||| .| .   ....  |
Sbjct: 343 SEHRELETLRAALEEERQTWAQQEHQLKEHYQALQEESQAQLEREKEKS 391

>hg18||uc002gjq
        |17|NM_053051|Q8N137|CNTRB_HUMAN|CNTROB|NM_053051|NP_444279|LYST-intera
        cting protein LIP8 isoform alpha

          Length = 903

 Score =  30 bits (67), Expect = 3.578
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 2/109 (1%)

Query: 282 QSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSD--EPSFC 339
           ||  .|||||    .    . |      ..     |  |  . |  .  .  |       
Sbjct: 283 QSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQL 342

Query: 340 SDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQQRVSS 388
           |.  .||||  | . | |   ..  .|.   ||| .| .   ....  |
Sbjct: 343 SEHRELETLRAALEEERQTWAQQEHQLKEHYQALQEESQAQLEREKEKS 391

>hg18||uc002gjr
        |17|BC014055|Q8N137-3|Q8N137-3|CNTROB|NM_053051|NP_444279|LYST-interact
        ing protein LIP8 isoform alpha

          Length = 806

 Score =  30 bits (67), Expect = 3.578
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 2/109 (1%)

Query: 282 QSAEQAMEALRAAHKEELGRARRLAGGTDQELKANLAEEITRMRYFLTGQRSD--EPSFC 339
           ||  .|||||    .    . |      ..     |  |  . |  .  .  |       
Sbjct: 185 QSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQL 244

Query: 340 SDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQQRVSS 388
           |.  .||||  | . | |   ..  .|.   ||| .| .   ....  |
Sbjct: 245 SEHRELETLRAALEEERQTWAQQEHQLKEHYQALQEESQAQLEREKEKS 293

>hg18||uc002xbi
        |20|NM_020884|Q9P216|Q9P216_HUMAN|MYH7B|NM_020884|NP_065935|myosin,
        heavy polypeptide 7B, cardiac muscle,

          Length = 1983

 Score =  30 bits (67), Expect = 3.578
 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 2/103 (1%)

Query:  278 QVEIQSAEQAMEALRAAHKEELGRARRLAG--GTDQELKANLAEEITRMRYFLTGQRSDE 335
            |  .  ||.    |  .  .  |. . |.     ..|. |.||    ..    |  . | 
Sbjct:  944 QDNLADAEERCHLLIKSKVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDI 1003

Query:  336 PSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERE 378
                   .. |   .| .|.|. | .|.. |   |  ||||..
Sbjct: 1004 DDLKLTLAKAEKEKQATENKVKNLTEEMAALDESVARLTKEKK 1046

>hg18||uc003kqj |5|NM_002387|P23508|CRCM_HUMAN|MCC|NM_002387|NP_002378|mutated
        in colorectal cancers

          Length = 829

 Score =  30 bits (67), Expect = 3.578
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 305 LAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEIS 364
           . |   ..|  ||||| .|    | | | .  |  .     |  |      .  ...|  
Sbjct: 212 IEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERD 271

Query: 365 RLQREVQAL 373
           ||.| |. |
Sbjct: 272 RLRRRVREL 280

>hg18||uc003kql |5|AK128596|Q6ZR04|Q6ZR04_HUMAN|MCC|NA|NA|CDNA FLJ46755 fis,
        clone TRACH3023373, highly similar to Colorectal mutant cancer protein.
        (Fragment)

          Length = 980

 Score =  30 bits (67), Expect = 3.578
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 305 LAGGTDQELKANLAEEITRMRYFLTGQRSDEPSFCSDSSQLETLLRAKDNEVQCLKKEIS 364
           . |   ..|  ||||| .|    | | | .  |  .     |  |      .  ...|  
Sbjct: 363 IEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERD 422

Query: 365 RLQREVQAL 373
           ||.| |. |
Sbjct: 423 RLRRRVREL 431

>hg18||uc003pyj
        |6|NM_024581|Q8NB25|CF060_HUMAN|C6orf60|NM_024581|NP_078857|hypothetica
        l protein LOC79632

          Length = 1107

 Score =  30 bits (67), Expect = 3.578
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 343 SQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQ 383
           . |.  || ... .  | ||.  |   . ||||| |   |.
Sbjct: 837 TDLQEELRHREHHISELDKEVQHLHENISALTKELEFKGKE 877

>hg18||uc003pyk
        |6|BX538186|Q7Z323|Q7Z323_HUMAN|C6orf60|NM_024581|NP_078857|hypothetica
        l protein LOC79632

          Length = 971

 Score =  30 bits (67), Expect = 3.578
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 343 SQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQ 383
           . |.  || ... .  | ||.  |   . ||||| |   |.
Sbjct: 750 TDLQEELRHREHHISELDKEVQHLHENISALTKELEFKGKE 790

>hg18||uc003pyl
        |6|AX747126|Q8NB25-2|Q8NB25-2|C6orf60|NM_024581|NP_078857|hypothetical
        protein LOC79632

          Length = 936

 Score =  30 bits (67), Expect = 3.578
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 343 SQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQ 383
           . |.  || ... .  | ||.  |   . ||||| |   |.
Sbjct: 750 TDLQEELRHREHHISELDKEVQHLHENISALTKELEFKGKE 790

>hg18||uc002cyd
        |16|NM_002705|Q14C98|Q14C98_HUMAN|PPL|NM_002705|NP_002696|periplakin

          Length = 1756

 Score =  29 bits (64), Expect = 7.970
 Identities = 24/112 (21%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query:  280 EIQSAEQAMEALRAAHKEELGRARRL--AGGTDQELKANLAEEITRMRYFLTGQR----S 333
            |    .. . .|||   ||  .   |     . .|  |   ||..|..  .  |      
Sbjct: 1300 EDPQTKEEVASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRVKERVVQQEVVRYE 1359

Query:  334 DEPSFCSDSSQLETLLRAKDNEVQCLKKEISRLQREVQALTKERETASKQQR 385
            .||   ...|     .  .  ..  |. |. ||||    | .. |   ....
Sbjct: 1360 EEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELERQLEELERERQ 1411

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0