BLASTP 7.6.0


Query=fugu4_742078 |jgi|Takru4|742078|fgh5_pg.C_scaffold_406000002
        (784 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001lde |10|NM_173791|Q8NEN9|PDZD8_HUMAN|PDZD8|NM_173791|...    653   3e-187
hg18||uc002atk |15|AL137287|Q9NTG2|Q9NTG2_HUMAN|MYO9A|NM_006901|...     57   1e-007
hg18||uc002atl |15|NM_006901|Q9UNJ2|Q9UNJ2_HUMAN|MYO9A|NM_006901...     57   1e-007
hg18||uc001zkd |15|AY954625|Q58G75|Q58G75_HUMAN|RASGRP1|NM_00573...     47   1e-004
hg18||uc001zke |15|NM_005739|Q9UNN9|Q9UNN9_HUMAN|RASGRP1|NM_0057...     47   1e-004
hg18||uc002rox |2|NM_170672|Q8IV61|GRP3_HUMAN|RASGRP3|NM_170672|...     46   2e-004
hg18||uc002roy |2|AB020653|Q53SD7|Q53SD7_HUMAN|RASGRP3|NM_170672...     46   2e-004
hg18||uc001wqh |14|NM_002742|Q15139|KPCD1_HUMAN|PRKD1|NM_002742|...     45   3e-004
hg18||uc001iji |10|BX647657|Q14DH6|Q14DH6_HUMAN|PRKCQ|NM_006257|...     45   4e-004
hg18||uc001ijj |10|NM_006257|Q04759|KPCT_HUMAN|PRKCQ|NM_006257|N...     45   4e-004
hg18||uc003szz |7|NM_004067|P52757|CHIO_HUMAN|CHN2|NM_004067|NP_...     42   0.003
hg18||uc003taa |7|NM_001039936|NA|NA|CHN2|NM_001039936|NP_001035...     42   0.003
hg18||uc002ack |15|NM_001080534|NA|NA|UNC13C|NM_001080534|NP_001...     42   0.004
hg18||uc002ujg |2|CR456864|P15882-2|P15882-2|CHN1|NA|NA|N-chimae...     41   0.005
hg18||uc002ujh |2|NM_001025201|P15882|CHIN_HUMAN|CHN1|NM_0010252...     41   0.005
hg18||uc002uji |2|NM_001822|P15882|CHIN_HUMAN|CHN1|NM_001822|NP_...     41   0.005
hg18||uc001oat |11|AX747767|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_15381...     41   0.006
hg18||uc001oau |11|AK092882|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_15381...     41   0.006
hg18||uc001oav |11|NM_005825|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_0058...     41   0.006
hg18||uc002nhd |19|NM_001080421|NA|NA|UNC13A|NM_001080421|NP_001...     40   0.011
hg18||uc003zwq |9|NM_006377|Q5VYM8|Q5VYM8_HUMAN|UNC13B|NM_006377...     40   0.011
hg18||uc003zwr |9|BC111781|Q2NKJ5|Q2NKJ5_HUMAN|UNC13B|NM_006377|...     40   0.011
hg18||uc002nfi |19|AB209997|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|...     39   0.024
hg18||uc002nfj |19|U42391|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP...     39   0.024
hg18||uc002nfk |19|NM_004145|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145...     39   0.024
hg18||uc001ubh |12|AB028999|NA|NA|KIAA1076|NA|NA|Homo sapiens mR...     31   4.905
hg18||uc002oit |19|NM_000540|P21817|RYR1_HUMAN|RYR1|NM_000540|NP...     31   4.905
hg18||uc002oiu |19|NM_001042723|P21817-2|P21817-2|RYR1|NM_001042...     31   4.905
hg18||uc003xtn |8|NM_005625|O00560|SDCB1_HUMAN|SDCBP|NM_005625|N...     30   8.367
hg18||uc003xto |8|NM_001007069|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_0010...     30   8.367
hg18||uc003xtp |8|NM_001007068|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_0010...     30   8.367
hg18||uc003xtq |8|NM_001007067|O00560|SDCB1_HUMAN|SDCBP|NM_00100...     30   8.367
hg18||uc003xtr |8|NM_001007070|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_0010...     30   8.367
hg18||uc003xts |8|AK128645|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_00100707...     30   8.367

>hg18||uc001lde |10|NM_173791|Q8NEN9|PDZD8_HUMAN|PDZD8|NM_173791|NP_776152|PDZ
        domain containing 8

          Length = 1154

 Score =  653 bits (1684), Expect = 3e-187
 Identities = 394/818 (48%), Positives = 488/818 (59%), Gaps = 93/818 (11%)

Query:    1 MTFRHVPATEGDAVHVSIETVTPNSPAALADLQRGDRLIAIGGLARILPVHEVPKLLKQA 60
            .| | | .|.| | || |||| ||||||.||||||||||||||. .|    .| ||.|||
Sbjct:  379 LTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIGGV-KITSTLQVLKLIKQA 437

Query:   61 GDRVMVLYERPVRHQVLTYGNLSTLQEGFGQLEETGFNSQ-PGGYEEDPAPITTLSDISD 119
            ||||.| |||||          . ||. ||||||   .|    ||||. | .|     ..
Sbjct:  438 GDRVLVYYERPVGQS----NQGAVLQDNFGQLEENFLSSSCQSGYEEEAAGLTV---DTE 490

Query:  120 SKDMDSEFEELIVESKTNQTSGPAGTTTVSDTKEDSLLTVNQSPKRTVANLASKPLGTIS 179
            |...|||||.|            |      .  .|   ... ||||    |. |||| ||
Sbjct:  491 SRELDSEFEDL------------ASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAIS 538

Query:  180 PILNRKLNLVGIQSPLKNQPKDSPKPSPLKTTLGSDPGEGXXXXXXXXXXXXXXXXXXXX 239
            |.||||| .     | | | ||  || ||||.  .|| .                     
Sbjct:  539 PVLNRKLAVGSHPLPPKIQSKDGNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAK 598

Query:  240 XXXXXXEKTPHA---------GTIDDKAAIEKSCAKQAEVKPSIRPTEASDEPPVPLTGS 290
                  .    |           .     ..||  |||      .  .| |.   |    
Sbjct:  599 VPLPSADAPNQAEPDVLVEKPEKVVPPPLVDKSAEKQA------KNVDAIDDAAAPKQFL 652

Query:  291 TKAEHTKDKAAE------DNVEDHSLWESPETMFRNRTASW--PNASVVFEVESNHKYLN 342
             | |  ||  .|      |. .|   ||| | ..||.   |    || .|..|. |.|||
Sbjct:  653 AKQEVAKDVTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASCLFDIEACHRYLN 712

Query:  343 VALWCKDPFKPVSLLCLGHVSLQLEHIALECMSTSSAEYQSTFRLRPPEPRANISRTALR 402
            .||||.||||   |.|||||||.|| .|| |..||. || |  ||  | |.| ..|||||
Sbjct:  713 IALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALR 772

Query:  403 SLSNHKGFNEKLCYGDITIHFCYLGE----HEVEYPVERERLGSLQEENPREKDREHVPA 458
            .||  ||||.| ||||||||| || |    | |   ||.|.   | ||         |  
Sbjct:  773 NLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEE---------VSV 823

Query:  459 APRDELAYGTMQLVEVRHNFQDTQFQNPTWCEYCKKKVWTKAASQCMICAYVCHKKCQDK 518
             |..|   | | | | .|.||||||||||||.||||||||||||||| ||||||||||.|
Sbjct:  824 LPKEEQFVGQMGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEK 883

Query:  519 CLAENPFCVAATERR---------------------GADPEAKSSINRATTGITRHIINT 557
            ||||   |  ||.||                       | ||  |.|. |||.|||||||
Sbjct:  884 CLAETSVC-GATDRRIDRTLKNLRLEGQETLLGLPPRVDAEASKSVNK-TTGLTRHIINT 941

Query:  558 SSRLLNLRQVPKTRLVEQVVDPVPGIVEPSPRHTPNTSDNESSDTETYTSSASPSKQPAG 617
            |||||||||| |||| |    |   .|||||.||||||||| ||||      ||||.  |
Sbjct:  942 SSRLLNLRQVSKTRLSE----PGTDLVEPSPKHTPNTSDNEGSDTEV-CGPNSPSKR--G 994

Query:  618 SGGSGKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTDERFQKLELMLDKLQQEIDQXXXXX 677
            .    ||||||||||||||||||||||||||||||.|| |||| |||||| ||||     
Sbjct:  995 NSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHN 1054

Query:  678 XXXXXXXXXXTDARRKALISTALVKSGERLQALTLLMIHYRAGIEDLESVESTSPSEHQA 737
                      || |.|.|.| || ||||||||||||||||||||||.|..|| |  .|  
Sbjct: 1055 NSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSK 1114

Query:  738 FKGKGEALEEEALVGSEVYDSDMCSPVEVQVLDEITEE 775
               |     || |      |...   .. |    |...
Sbjct: 1115 KISKYTDDTEEDL------DNEISQLIDSQPFSSISDD 1146

>hg18||uc002atk
        |15|AL137287|Q9NTG2|Q9NTG2_HUMAN|MYO9A|NM_006901|NP_008832|myosin IXA

          Length = 1343

 Score =  57 bits (135), Expect = 1e-007
 Identities = 34/89 (38%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query: 456 VPAAPRDELAYGTMQLVEVR--HNFQDTQFQNPTWCEYCKKKVW-TKAASQCMICAYVCH 512
           ||   | .       |||    | |. ||.  ||.||||   .|    || | .| | ||
Sbjct: 773 VPKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACH 832

Query: 513 KKCQDKCLAENPFCVAATERRGADPEAKS 541
           |||   ||     |      .  |||  |
Sbjct: 833 KKC---CLKTTAKC-----SKKYDPELSS 853

>hg18||uc002atl
        |15|NM_006901|Q9UNJ2|Q9UNJ2_HUMAN|MYO9A|NM_006901|NP_008832|myosin IXA

          Length = 2548

 Score =  57 bits (135), Expect = 1e-007
 Identities = 34/89 (38%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query:  456 VPAAPRDELAYGTMQLVEVR--HNFQDTQFQNPTWCEYCKKKVW-TKAASQCMICAYVCH 512
            ||   | .       |||    | |. ||.  ||.||||   .|    || | .| | ||
Sbjct: 1978 VPKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACH 2037

Query:  513 KKCQDKCLAENPFCVAATERRGADPEAKS 541
            |||   ||     |      .  |||  |
Sbjct: 2038 KKC---CLKTTAKC-----SKKYDPELSS 2058

>hg18||uc001zkd |15|AY954625|Q58G75|Q58G75_HUMAN|RASGRP1|NM_005739|NP_005730|RAS
        guanyl releasing protein 1

          Length = 624

 Score =  47 bits (109), Expect = 1e-004
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAENPFCVAATERR 533
           ||||.| .  ||.|. |   .|   |   .|  |   |||.|.|  . |        ..|
Sbjct: 369 HNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFE-------CKKR 421

Query: 534 GADPEAKSSIN 544
             .| | .  |
Sbjct: 422 AKNPVAPTENN 432

>hg18||uc001zke
        |15|NM_005739|Q9UNN9|Q9UNN9_HUMAN|RASGRP1|NM_005739|NP_005730|RAS
        guanyl releasing protein 1

          Length = 797

 Score =  47 bits (109), Expect = 1e-004
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAENPFCVAATERR 533
           ||||.| .  ||.|. |   .|   |   .|  |   |||.|.|  . |        ..|
Sbjct: 542 HNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFE-------CKKR 594

Query: 534 GADPEAKSSIN 544
             .| | .  |
Sbjct: 595 AKNPVAPTENN 605

>hg18||uc002rox |2|NM_170672|Q8IV61|GRP3_HUMAN|RASGRP3|NM_170672|NP_733772|RAS
        guanyl releasing protein 3 (calcium and

          Length = 690

 Score =  46 bits (107), Expect = 2e-004
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
           ||||.  .  ||.||.|   .|   |   .|  |   |||.|.|
Sbjct: 495 HNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKD 538

>hg18||uc002roy |2|AB020653|Q53SD7|Q53SD7_HUMAN|RASGRP3|NM_170672|NP_733772|RAS
        guanyl releasing protein 3 (calcium and

          Length = 612

 Score =  46 bits (107), Expect = 2e-004
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
           ||||.  .  ||.||.|   .|   |   .|  |   |||.|.|
Sbjct: 417 HNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKD 460

>hg18||uc001wqh
        |14|NM_002742|Q15139|KPCD1_HUMAN|PRKD1|NM_002742|NP_002733|protein
        kinase D1

          Length = 912

 Score =  45 bits (106), Expect = 3e-004
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 469 MQLVEVRHNFQDTQFQNPTWCEYCKK--KVWTKAASQCMICAYVCHKKCQDK----CLAE 522
           |  |.| | |    .  || |.||||  |   .   ||  | . |||.|  |    || |
Sbjct: 264 MSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGE 323

>hg18||uc001iji
        |10|BX647657|Q14DH6|Q14DH6_HUMAN|PRKCQ|NM_006257|NP_006248|protein
        kinase C, theta

          Length = 739

 Score =  45 bits (104), Expect = 4e-004
 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAE 522
           | |  | |  ||.|  | . ||   |   ||  |    |||| || .|.
Sbjct: 193 HEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAK 241

>hg18||uc001ijj
        |10|NM_006257|Q04759|KPCT_HUMAN|PRKCQ|NM_006257|NP_006248|protein
        kinase C, theta

          Length = 706

 Score =  45 bits (104), Expect = 4e-004
 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAE 522
           | |  | |  ||.|  | . ||   |   ||  |    |||| || .|.
Sbjct: 160 HEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAK 208

>hg18||uc003szz |7|NM_004067|P52757|CHIO_HUMAN|CHN2|NM_004067|NP_004058|beta
        chimerin isoform 2

          Length = 468

 Score =  42 bits (97), Expect = 0.003
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 473 EVRHNFQDTQFQNPTWCEYCKKKVWTKAAS--QCMICAYVCHKKC 515
           |  |||.   |. | |||||   .|   |   .|  |    ||.|
Sbjct: 212 EKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC 256

>hg18||uc003taa |7|NM_001039936|NA|NA|CHN2|NM_001039936|NP_001035025|beta
        chimerin isoform 1

          Length = 332

 Score =  42 bits (97), Expect = 0.003
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 473 EVRHNFQDTQFQNPTWCEYCKKKVWTKAAS--QCMICAYVCHKKC 515
           |  |||.   |. | |||||   .|   |   .|  |    ||.|
Sbjct:  76 EKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC 120

>hg18||uc002ack |15|NM_001080534|NA|NA|UNC13C|NM_001080534|NP_001074003|unc-13
        homolog C

          Length = 2214

 Score =  42 bits (96), Expect = 0.004
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query:  474 VRHNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
            . |||.      ||.|  |.  .|   .   .|. |   ||.||||
Sbjct: 1096 IPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQD 1141

>hg18||uc002ujg |2|CR456864|P15882-2|P15882-2|CHN1|NA|NA|N-chimaerin (NC)
        (N-chimerin) (Alpha chimerin) (A-chimaerin) (Rho GTPase-activating
        protein 2)

          Length = 334

 Score =  41 bits (95), Expect = 0.005
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVWTKAAS--QCMICAYVCHKKC 515
           |||.   |. | |||||   .|   |   .|  |    ||.|
Sbjct:  81 HNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQC 122

>hg18||uc002ujh
        |2|NM_001025201|P15882|CHIN_HUMAN|CHN1|NM_001025201|NP_001020372|chimer
        in (chimaerin) 1

          Length = 459

 Score =  41 bits (95), Expect = 0.005
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVWTKAAS--QCMICAYVCHKKC 515
           |||.   |. | |||||   .|   |   .|  |    ||.|
Sbjct: 206 HNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQC 247

>hg18||uc002uji |2|NM_001822|P15882|CHIN_HUMAN|CHN1|NM_001822|NP_001813|chimerin
        (chimaerin) 1

          Length = 459

 Score =  41 bits (95), Expect = 0.005
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVWTKAAS--QCMICAYVCHKKC 515
           |||.   |. | |||||   .|   |   .|  |    ||.|
Sbjct: 206 HNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQC 247

>hg18||uc001oat |11|AX747767|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_153819|NP_722541|RAS
        guanyl releasing protein 2 isoform 2

          Length = 512

 Score =  41 bits (94), Expect = 0.006
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAE 522
           ||||..    |  | .||  .    |   .|  |   |||.|.|.   |
Sbjct: 401 HNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVE 449

>hg18||uc001oau |11|AK092882|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_153819|NP_722541|RAS
        guanyl releasing protein 2 isoform 2

          Length = 465

 Score =  41 bits (94), Expect = 0.006
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAE 522
           ||||..    |  | .||  .    |   .|  |   |||.|.|.   |
Sbjct: 354 HNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVE 402

>hg18||uc001oav
        |11|NM_005825|Q7LDG7|Q7LDG7_HUMAN|RASGRP2|NM_005825|NP_005816|RAS
        guanyl releasing protein 2 isoform 1

          Length = 671

 Score =  41 bits (94), Expect = 0.006
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQDKCLAE 522
           ||||..    |  | .||  .    |   .|  |   |||.|.|.   |
Sbjct: 561 HNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVE 609

>hg18||uc002nhd |19|NM_001080421|NA|NA|UNC13A|NM_001080421|NP_001073890|unc-13
        homolog A

          Length = 1791

 Score =  40 bits (92), Expect = 0.011
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
           |||.      ||.|  |.  .|   .   .|  |   ||.||||
Sbjct: 642 HNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQD 685

>hg18||uc003zwq
        |9|NM_006377|Q5VYM8|Q5VYM8_HUMAN|UNC13B|NM_006377|NP_006368|UNC13 (C.
        elegans)-like

          Length = 1591

 Score =  40 bits (92), Expect = 0.011
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
           |||.      ||.|  |.  .|   .   .|  |   ||.||||
Sbjct: 478 HNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQD 521

>hg18||uc003zwr |9|BC111781|Q2NKJ5|Q2NKJ5_HUMAN|UNC13B|NM_006377|NP_006368|UNC13
        (C. elegans)-like

          Length = 1610

 Score =  40 bits (92), Expect = 0.011
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 476 HNFQDTQFQNPTWCEYCKKKVW--TKAASQCMICAYVCHKKCQD 517
           |||.      ||.|  |.  .|   .   .|  |   ||.||||
Sbjct: 478 HNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQD 521

>hg18||uc002nfi
        |19|AB209997|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin IXB

          Length = 2022

 Score =  39 bits (89), Expect = 0.024
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 1/63 (1%)

Query:  476 HNFQDTQFQNPTWCEYCKKKVW-TKAASQCMICAYVCHKKCQDKCLAENPFCVAATERRG 534
            | |   |   |  || |   .|    |  | .|   |||||  |  .   .        |
Sbjct: 1633 HVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPG 1692

Query:  535 ADP 537
             .|
Sbjct: 1693 VEP 1695

>hg18||uc002nfj |19|U42391|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin
        IXB

          Length = 1960

 Score =  39 bits (89), Expect = 0.024
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 1/63 (1%)

Query:  476 HNFQDTQFQNPTWCEYCKKKVW-TKAASQCMICAYVCHKKCQDKCLAENPFCVAATERRG 534
            | |   |   |  || |   .|    |  | .|   |||||  |  .   .        |
Sbjct: 1633 HVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPG 1692

Query:  535 ADP 537
             .|
Sbjct: 1693 VEP 1695

>hg18||uc002nfk
        |19|NM_004145|Q4LE74|Q4LE74_HUMAN|MYO9B|NM_004145|NP_004136|myosin IXB

          Length = 2157

 Score =  39 bits (89), Expect = 0.024
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 1/63 (1%)

Query:  476 HNFQDTQFQNPTWCEYCKKKVW-TKAASQCMICAYVCHKKCQDKCLAENPFCVAATERRG 534
            | |   |   |  || |   .|    |  | .|   |||||  |  .   .        |
Sbjct: 1633 HVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPG 1692

Query:  535 ADP 537
             .|
Sbjct: 1693 VEP 1695

>hg18||uc001ubh |12|AB028999|NA|NA|KIAA1076|NA|NA|Homo sapiens mRNA for KIAA1076
        protein, partial cds

          Length = 529

 Score =  31 bits (69), Expect = 4.905
 Identities = 18/57 (31%), Positives = 24/57 (42%)

Query: 568 PKTRLVEQVVDPVPGIVEPSPRHTPNTSDNESSDTETYTSSASPSKQPAGSGGSGKL 624
           |.|        |   . |  | |||    . .    | |  |.|  .|  ||||  |
Sbjct: 146 PETTDASHPSVPPEPLAEDHPPHTPGLCGSLAKSQSTETVPATPGGEPPLSGGSSGL 202

>hg18||uc002oit
        |19|NM_000540|P21817|RYR1_HUMAN|RYR1|NM_000540|NP_000531|skeletal
        muscle ryanodine receptor isoform 1

          Length = 5038

 Score =  31 bits (69), Expect = 4.905
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query:  171 ASKPLGTISPILNRKLNLVGIQSPLKNQPKDSPKPSPLKTTLGSDPGE 218
            |  |    |||| ||| . |..  |  .|.  |.|        .. ||
Sbjct: 4463 AEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKADAENGE 4510

>hg18||uc002oiu
        |19|NM_001042723|P21817-2|P21817-2|RYR1|NM_001042723|NP_001036188|skele
        tal muscle ryanodine receptor isoform 2

          Length = 5033

 Score =  31 bits (69), Expect = 4.905
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query:  171 ASKPLGTISPILNRKLNLVGIQSPLKNQPKDSPKPSPLKTTLGSDPGE 218
            |  |    |||| ||| . |..  |  .|.  |.|        .. ||
Sbjct: 4458 AEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELEPEKADAENGE 4505

>hg18||uc003xtn
        |8|NM_005625|O00560|SDCB1_HUMAN|SDCBP|NM_005625|NP_005616|syntenin
        isoform 1

          Length = 298

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 136 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 195

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 196 -ERTITMHKDSTGHVGF 211

>hg18||uc003xto
        |8|NM_001007069|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_001007069|NP_001007070|syn
        tenin isoform 3

          Length = 297

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 135 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 194

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 195 -ERTITMHKDSTGHVGF 210

>hg18||uc003xtp
        |8|NM_001007068|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_001007068|NP_001007069|syn
        tenin isoform 2

          Length = 292

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 130 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 189

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 190 -ERTITMHKDSTGHVGF 205

>hg18||uc003xtq
        |8|NM_001007067|O00560|SDCB1_HUMAN|SDCBP|NM_001007067|NP_001007068|synt
        enin isoform 1

          Length = 298

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 136 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 195

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 196 -ERTITMHKDSTGHVGF 211

>hg18||uc003xtr
        |8|NM_001007070|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_001007070|NP_001007071|syn
        tenin isoform 3

          Length = 297

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 135 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 194

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 195 -ERTITMHKDSTGHVGF 210

>hg18||uc003xts
        |8|AK128645|Q14CP2|Q14CP2_HUMAN|SDCBP|NM_001007070|NP_001007071|synteni
        n isoform 3

          Length = 304

 Score =  30 bits (67), Expect = 8.367
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query:  16 VSIETVTPNSPAALADLQRGDRLIAIGG-LARILPVHEVPKLLKQA-GDRV-MVLYERPV 72
           . .. |  ||||.|  |. ||... | |         .  |.|||| |... | . .|| 
Sbjct: 142 IFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPF 201

Query:  73 RHQVLTYGNLSTLQEGF 89
             . .|    ||   ||
Sbjct: 202 -ERTITMHKDSTGHVGF 217

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,290,635
Number of Sequences: 45480
Number of Extensions: 191290635
Number of Successful Extensions: 11080124
Number of sequences better than 0.0: 0
BLASTP 7.6.0