BLASTP 7.6.0


Query=fugu4_742031 |jgi|Takru4|742031|fgh5_pg.C_scaffold_402000020
        (1852 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...    112   4e-024
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...    105   9e-022
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     84   2e-015
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     74   2e-012
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     45   8e-004
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     44   0.001
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     42   0.007
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     42   0.007
hg18||uc002xfh |20|NM_183006|Q5T2Y6|Q5T2Y6_HUMAN|DLGAP4|NM_18300...     39   0.078
hg18||uc002miq |19|NM_001080403|NA|NA|FLJ22184|NM_001080403|NP_0...     37   0.173
hg18||uc002gkd |17|NM_002616|O15534|PER1_HUMAN|PER1|NM_002616|NP...     34   1.917
hg18||uc003cbi |3|AB209761|Q59EQ0|Q59EQ0_HUMAN|SATB1|NM_002971|N...     32   9.513

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  112 bits (280), Expect = 4e-024
 Identities = 66/170 (38%), Positives = 94/170 (55%), Gaps = 9/170 (5%)

Query: 1688 KSVYVDVTGKPRSTRVRLPASVLSSAGHFEPNQKFLTVEEPVKRRCRPVS-----LSRAQ 1742
            .|.  || |. |  .|.||  .|||    .|  |   |.. |  .    |     .. |.
Sbjct: 2014 QSLLQDVAGQTRKEKVKLPHYLLSSKPKSQPLAK---VQDSVGGKVNTSSVASAAINNAK 2070

Query: 1743 GALRSFQLFPSTVDFGTLAEGSSASVTVRMKNVGVDLCRFQVKQPPLKTGLRVLYTPGPV 1802
             .|  | | ||.| || | || . .  |..|||||| |||.|||||  |||.| | ||||
Sbjct: 2071 SSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPV 2130

Query: 1803 PAGLHVD-XXXXXXXXXXXXXXXXXXRIHHDLLIQTELEILYLPVTANIL 1851
             ||.  .                    | |.. | || |.|.||| | .|
Sbjct: 2131 AAGMQTELNIELFATAVGEDGAKGSAHISHNIEIMTEHEVLFLPVEATVL 2180

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  105 bits (260), Expect = 9e-022
 Identities = 64/187 (34%), Positives = 99/187 (52%), Gaps = 23/187 (12%)

Query: 164 EKKTKLKRRGHVAVATVMGNAPSPDRPEDGPQLYVLLCGFYRPLLIAALDAVGVHVSTVI 223
           .| |.|||||         |    | |.|| | |... ||  | |.| .  .|. ...||
Sbjct: 193 KKTTQLKRRGE----DDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAELGIPITSVI 248

Query: 224 RLCSEDPE------------RQERCQGDGQPAETEAEAELARKLDLFWSELVPVLNSGSA 271
           .. ||. |            ..   | .   ||   .    ..|  ||  | ||||.   
Sbjct: 249 KISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLEPVLNNEKP 308

Query: 272 KSRLPDVVQLSYTVQI-------HSPEAELETGIRIFGGVANLLYDCLEWRRQHQHYLNN 324
           .. | || .| | |.           |  |. |  ||  .| |.|| |.|.||||||| .
Sbjct: 309 ETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKRQHQHYLES 368

Query: 325 IRLIKVP 331
           ..|| ||
Sbjct: 369 MQLINVP 375

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  84 bits (205), Expect = 2e-015
 Identities = 41/96 (42%), Positives = 58/96 (60%)

Query: 623 ELELADIQSCRLRCLSAWCFTEQHEAAVLSQVLQAAWDQFCCLDTFTGRLNNIVYVFCHD 682
           | .| ||.  . | |  | |||  .  || |||| |  |. |.|..    .| . .  |.
Sbjct: 765 EADLEDIKKTQQRSLMDWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHN 824

Query: 683 PTGPQRHSKEFWEVGLHTDVRFRNYLEHVADTISDW 718
           |   ||   |.| . ||..| |||||| || .| ||
Sbjct: 825 PMNRQRLHCEYWNIALHSNVGFRNYLELVAKSIQDW 860

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  74 bits (180), Expect = 2e-012
 Identities = 41/94 (43%), Positives = 55/94 (58%), Gaps = 4/94 (4%)

Query: 1332 HLPRLFLVHVDGSGLELLSSPTVEEEFHQARSDPAVALLKEPLPDS-GGFGITVLRPARR 1390
            |.|| |... ||||.|||    .||    |  .    .|.||. .  |   ||||||   
Sbjct: 1638 HVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHE 1697

Query: 1391 SLWSQWTVGKRLPEITPPNLRNRSWADFPRTENK 1424
            .  | | | |.   | |||||.|||  ||  | |
Sbjct: 1698 A--SPWQV-KKEDTIVPPNLRSRSWETFPSVEKK 1728

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  45 bits (105), Expect = 8e-004
 Identities = 29/62 (46%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 1136 GSWITTTPRGERTHTGGSTHKRLAD---LLVIEATDPGTDEVVMVQKPDGSQAVEHADGT 1192
            |.| |||| | |  | |   .|.||   ||  .||||  .  ||  . |    ||  |||
Sbjct: 1391 GTWFTTTPEGNRIGTKGL--ERIADLTPLLSFQATDP-VNGTVMTTREDKVVIVERKDGT 1447

Query: 1193 RI 1194
            ||
Sbjct: 1448 RI 1449

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  44 bits (103), Expect = 0.001
 Identities = 18/28 (64%), Positives = 26/28 (92%)

Query: 1172 DEVVMVQKPDGSQAVEHADGTRITTWYQ 1199
            |.||.|.. ||.. |.|||||||||.||
Sbjct: 1436 DKVVIVERKDGTRIVDHADGTRITTFYQ 1463

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  42 bits (97), Expect = 0.007
 Identities = 21/33 (63%), Positives = 24/33 (72%)

Query: 398 EVDMRRYRNLLDQVPPESCSVGLILHCMLEQVL 430
           ||||| |  ||. .  |  || ||||||||||.
Sbjct: 423 EVDMRYYNYLLNPIREEFISVPLILHCMLEQVV 455

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  42 bits (97), Expect = 0.007
 Identities = 18/31 (58%), Positives = 25/31 (80%)

Query: 1066 EETFRIITSTGDVIRALRDGSTQVLFADGSV 1096
            .|  |.||| | |.. . |||||.|||||.|
Sbjct: 1281 QEASRVITSQGTVVKYMLDGSTQILFADGAV 1311

>hg18||uc002xfh
        |20|NM_183006|Q5T2Y6|Q5T2Y6_HUMAN|DLGAP4|NM_183006|NP_892118|disks
        large-associated protein 4 isoform b

          Length = 453

 Score =  39 bits (88), Expect = 0.078
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 7/116 (6%)

Query: 1561 PERLRRHRQELSQHQTLRAALRDKSFVPYFHPENLPLYQNLVQPTPSAEPSPVRRSETSG 1620
            ||   .|    |.  || ..       |     .. .  . .|| |  ||||  . .. |
Sbjct:   94 PEPPPKHAALKSEQGTLTSSESHPEAAPKRKLSSIGIQVDCIQPVPKEEPSPATKFQSIG 153

Query: 1621 VFLP---QQSSPRPSIPAPPQSDSGTA-GSDRKC---ERSLSDAATQTSGLVNGAG 1669
            | .    . | |  |. .   .|| |   .|  |   |||| |     . .   ||
Sbjct:  154 VQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAG 209

>hg18||uc002miq
        |19|NM_001080403|NA|NA|FLJ22184|NM_001080403|NP_001073872|hypothetical
        protein LOC80164

          Length = 1152

 Score =  37 bits (85), Expect = 0.173
 Identities = 28/82 (34%), Positives = 32/82 (39%), Gaps = 3/82 (3%)

Query: 1601 LVQPTPSAEPSPVRRSETSGVFLPQQSSPRPSIPAPPQSDSGTAGSDRKCERSLSDAATQ 1660
            | .| ||| | |        |    . |     ||  .  |   |  |   |||| .|| 
Sbjct:  403 LPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATP 462

Query: 1661 TSGLVN---GAGGFLSAPACPS 1679
             |        | |   ||| ||
Sbjct:  463 LSSPARSGPSARGTPRAPAHPS 484

>hg18||uc002gkd |17|NM_002616|O15534|PER1_HUMAN|PER1|NM_002616|NP_002607|period
        1

          Length = 1290

 Score =  34 bits (76), Expect = 1.917
 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 3/89 (3%)

Query: 1600 NLVQPTPSAEPSPVRRSETSGVFLPQQSSPRPSIPAPPQSDSGTAGS---DRKCERSLSD 1656
            | . ||||. |    ..   |   |   || ||.|| | |      |   . .|   |  
Sbjct:  925 NYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPALPPSPPHRPDSPLFNSRCSSPLQL 984

Query: 1657 AATQTSGLVNGAGGFLSAPACPSVGASSP 1685
               |   |    |  ..     | |   |
Sbjct:  985 NLLQLEELPRAEGAAVAGGPGSSAGPPPP 1013

>hg18||uc003cbi
        |3|AB209761|Q59EQ0|Q59EQ0_HUMAN|SATB1|NM_002971|NP_002962|special
        AT-rich sequence binding protein 1

          Length = 795

 Score =  32 bits (70), Expect = 9.513
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 1562 ERLRRHRQELSQHQTLRAALRDKSFVPYFHPENLPLYQNLVQPTPSAEPSP--VRRSETS 1619
            | |   |. ||  |  | |. ..      |  . | .   |       |||  . . |. 
Sbjct:  547 ENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTLGKGESR 606

Query: 1620 GVFLPQQSSPRPSIPAPPQ 1638
            |||||   .| | . | ||
Sbjct:  607 GVFLPGLPTPAPWLGAAPQ 625

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 194,224,609
Number of Sequences: 45480
Number of Extensions: 194224609
Number of Successful Extensions: 11176839
Number of sequences better than 0.0: 0
BLASTP 7.6.0