BLASTP 7.6.0


Query=fugu4_741390 |jgi|Takru4|741390|fgh5_pg.C_scaffold_362000013
        (686 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003lii |5|NM_018899|Q9Y5I4|PCDC2_HUMAN|PCDHAC2|NM_018899...    523   3e-148
hg18||uc003lij |5|NM_031883|Q9Y5I4-2|Q9Y5I4-2|PCDHAC2|NM_031883|...    523   3e-148
hg18||uc003lku |5|NM_032402|Q9UN70-2|Q9UN70-2|PCDHGC3|NM_032402|...    493   4e-139
hg18||uc003lkv |5|NM_002588|Q9UN70|PCDGK_HUMAN|PCDHGC3|NM_002588...    493   4e-139
hg18||uc003lkz |5|NM_032407|Q9Y5F6-2|Q9Y5F6-2|PCDHGC5|NM_032407|...    486   4e-137
hg18||uc003lla |5|NM_018929|Q9Y5F6|PCDGM_HUMAN|PCDHGC5|NM_018929...    486   4e-137
hg18||uc003lki |5|NM_032100|Q9Y5F9-2|Q9Y5F9-2|PCDHGB6|NM_032100|...    484   2e-136
hg18||uc003lkj |5|NM_018926|Q9Y5F9|PCDGI_HUMAN|PCDHGB6|NM_018926...    484   2e-136
hg18||uc003lks |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094...    484   2e-136
hg18||uc003lkt |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_00373...    484   2e-136
hg18||uc003lkm |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|...    480   3e-135
hg18||uc003lkn |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927...    480   3e-135
hg18||uc003lkk |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090...    479   6e-135
hg18||uc003lkl |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_01891...    479   6e-135
hg18||uc003lko |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091...    477   2e-134
hg18||uc003lkp |5|NM_032092|Q9Y5H2-3|Q9Y5H2-3|PCDHGA11|NM_032092...    477   2e-134
hg18||uc003lkq |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_01891...    477   2e-134
hg18||uc003ljp |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|...    475   8e-134
hg18||uc003ljq |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917...    475   8e-134
hg18||uc003ljt |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|...    475   1e-133
hg18||uc003lju |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918...    475   1e-133
hg18||uc003lkx |5|NM_032406|Q9Y5F7-2|Q9Y5F7-2|PCDHGC4|NM_032406|...    475   1e-133
hg18||uc003lky |5|NM_018928|Q9Y5F7|PCDGL_HUMAN|PCDHGC4|NM_018928...    475   1e-133
hg18||uc003lke |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|...    474   2e-133
hg18||uc003lkf |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925...    474   2e-133
hg18||uc003ljh |5|NM_031993|Q9Y5H4-2|Q9Y5H4-2|PCDHGA1|NM_031993|...    473   3e-133
hg18||uc003lji |5|NM_018912|Q9Y5H4|PCDG1_HUMAN|PCDHGA1|NM_018912...    473   3e-133
hg18||uc003ljv |5|NM_032097|Q9Y5G1-2|Q9Y5G1-2|PCDHGB3|NM_032097|...    473   4e-133
hg18||uc003ljw |5|NM_018924|Q9Y5G1|PCDGF_HUMAN|PCDHGB3|NM_018924...    473   4e-133
hg18||uc003lkg |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|...    473   4e-133
hg18||uc003lkh |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921...    473   4e-133
hg18||uc003lhe |5|NM_031497|Q9Y5H8-2|Q9Y5H8-2|PCDHA3|NM_031497|N...    470   3e-132
hg18||uc003lhf |5|NM_018906|Q9Y5H8|PCDA3_HUMAN|PCDHA3|NM_018906|...    470   3e-132
hg18||uc003lhj |5|NM_031501|Q9Y5H7-2|Q9Y5H7-2|PCDHA5|NM_031501|N...    470   5e-132
hg18||uc003lhk |5|BC033735|Q9Y5H7-3|Q9Y5H7-3|PCDHA5|NM_018908|NP...    470   5e-132
hg18||uc003lhl |5|NM_018908|Q9Y5H7|PCDA5_HUMAN|PCDHA5|NM_018908|...    470   5e-132
hg18||uc003lkb |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|...    467   2e-131
hg18||uc003lkd |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088...    467   2e-131
hg18||uc003lje |5|NM_018935|Q9Y5E8|PCDBF_HUMAN|PCDHB15|NM_018935...    465   9e-131
hg18||uc003lkc |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736...    465   9e-131
hg18||uc003lhc |5|NM_031495|Q9Y5H9-2|Q9Y5H9-2|PCDHA2|NM_031495|N...    465   1e-130
hg18||uc003lhd |5|NM_018905|Q9Y5H9|PCDA2_HUMAN|PCDHA2|NM_018905|...    465   1e-130
hg18||uc003liv |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957...    465   1e-130
hg18||uc003ljr |5|NM_032096|Q9Y5G2-2|Q9Y5G2-2|PCDHGB2|NM_032096|...    462   7e-130
hg18||uc003ljs |5|NM_018923|Q9Y5G2|PCDGE_HUMAN|PCDHGB2|NM_018923...    462   7e-130
hg18||uc003ljz |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|...    462   1e-129
hg18||uc003lka |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920...    462   1e-129
hg18||uc003ljl |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|...    461   1e-129
hg18||uc003ljm |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916...    461   1e-129
hg18||uc003ljx |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|...    460   5e-129
hg18||uc003ljy |5|NM_018919|Q9Y5G7|PCDG6_HUMAN|PCDHGA6|NM_018919...    460   5e-129
hg18||uc003lio |5|NM_018937|Q9Y5E6|PCDB3_HUMAN|PCDHB3|NM_018937|...    456   7e-128
hg18||uc003lhg |5|NM_031500|Q9UN74-2|Q9UN74-2|PCDHA4|NM_031500|N...    455   9e-128
hg18||uc003lhh |5|AB208925|Q59H34|Q59H34_HUMAN|PCDHA4|NM_018907|...    455   9e-128
hg18||uc003lhi |5|NM_018907|Q9UN74|PCDA4_HUMAN|PCDHA4|NM_018907|...    455   9e-128
hg18||uc003lid |5|NM_031865|Q9Y5I0-2|Q9Y5I0-2|PCDHA13|NM_031865|...    455   1e-127
hg18||uc003lie |5|AB208924|Q59H35|Q59H35_HUMAN|PCDHA13|NM_018904...    455   1e-127
hg18||uc003lif |5|NM_018904|Q9Y5I0|PCDAD_HUMAN|PCDHA13|NM_018904...    455   1e-127
hg18||uc003liq |5|NM_015669|Q9Y5E4|PCDB5_HUMAN|PCDHB5|NM_015669|...    455   1e-127
hg18||uc003ljj |5|NM_032009|Q9Y5H1-2|Q9Y5H1-2|PCDHGA2|NM_032009|...    455   1e-127
hg18||uc003ljk |5|NM_018915|Q9Y5H1|PCDG2_HUMAN|PCDHGA2|NM_018915...    455   1e-127
hg18||uc003lhr |5|NM_031856|Q9Y5H6-2|Q9Y5H6-2|PCDHA8|NM_031856|N...    455   2e-127
hg18||uc003lhs |5|NM_018911|Q9Y5H6|PCDA8_HUMAN|PCDHA8|NM_018911|...    455   2e-127
hg18||uc003lhv |5|NM_031859|Q9Y5I2-3|Q9Y5I2-3|PCDHA10|NM_031859|...    454   3e-127
hg18||uc003lhx |5|NM_018901|Q9Y5I2|PCDAA_HUMAN|PCDHA10|NM_018901...    454   3e-127
hg18||uc003lil |5|NM_018936|Q9Y5E7|PCDB2_HUMAN|PCDHB2|NM_018936|...    454   3e-127
hg18||uc003lhm |5|NM_031848|Q9UN73-3|Q9UN73-3|PCDHA6|NM_031848|N...    452   1e-126
hg18||uc003lho |5|NM_018909|Q9UN73|PCDA6_HUMAN|PCDHA6|NM_018909|...    452   1e-126
hg18||uc003liu |5|NM_019120|Q9UN66|PCDB8_HUMAN|PCDHB8|NM_019120|...    452   1e-126
hg18||uc003ihe |4|NM_019035|Q9HCL0|PCD18_HUMAN|PCDH18|NM_019035|...    450   3e-126
hg18||uc003ihf |4|BX647786|Q9HCL0|PCD18_HUMAN|PCDH18|NM_019035|N...    450   3e-126
hg18||uc003lhz |5|NM_031861|Q9Y5I1-2|Q9Y5I1-2|PCDHA11|NM_031861|...    450   3e-126
hg18||uc003lia |5|NM_018902|Q9Y5I1|PCDAB_HUMAN|PCDHA11|NM_018902...    450   3e-126
hg18||uc003lit |5|NM_018940|Q9Y5E2|PCDB7_HUMAN|PCDHB7|NM_018940|...    449   8e-126
hg18||uc003lir |5|NM_018939|Q9Y5E3|PCDB6_HUMAN|PCDHB6|NM_018939|...    447   2e-125
hg18||uc003liw |5|NM_019119|NA|NA|PCDHB9|NM_019119|NP_061992|pro...    445   2e-124
hg18||uc003lgz |5|NM_031410|Q9Y5I3-3|Q9Y5I3-3|PCDHA1|NM_031410|N...    443   6e-124
hg18||uc003lhb |5|NM_018900|Q9Y5I3|PCDA1_HUMAN|PCDHA1|NM_018900|...    443   6e-124
hg18||uc003ljb |5|NM_018934|Q9Y5E9|PCDBE_HUMAN|PCDHB14|NM_018934...    442   8e-124
hg18||uc003lht |5|NM_014005|Q9Y5H5-2|Q9Y5H5-2|PCDHA9|NM_014005|N...    439   5e-123
hg18||uc003lhu |5|NM_031857|Q9Y5H5|PCDA9_HUMAN|PCDHA9|NM_031857|...    439   5e-123
hg18||uc003lix |5|NM_018930|Q9UN67|PCDBA_HUMAN|PCDHB10|NM_018930...    439   9e-123
hg18||uc003liy |5|NM_018931|Q9Y5F2|PCDBB_HUMAN|PCDHB11|NM_018931...    439   9e-123
hg18||uc003lib |5|NM_031864|Q9UN75-2|Q9UN75-2|PCDHA12|NM_031864|...    438   1e-122
hg18||uc003lic |5|NM_018903|Q9UN75|PCDAC_HUMAN|PCDHA12|NM_018903...    438   1e-122
hg18||uc003lik |5|NM_013340|Q2M257|Q2M257_HUMAN|PCDHB1|NM_013340...    436   6e-122
hg18||uc003lig |5|NM_031882|Q9H158-2|Q9H158-2|PCDHAC1|NM_031882|...    434   2e-121
hg18||uc003lih |5|NM_018898|Q9H158|PCDC1_HUMAN|PCDHAC1|NM_018898...    434   2e-121
hg18||uc003liz |5|NM_018932|Q9Y5F1|PCDBC_HUMAN|PCDHB12|NM_018932...    433   4e-121
hg18||uc003lhp |5|NM_031852|Q9UN72-2|Q9UN72-2|PCDHA7|NM_031852|N...    433   6e-121
hg18||uc003lhq |5|NM_018910|Q9UN72|PCDA7_HUMAN|PCDHA7|NM_018910|...    433   6e-121
hg18||uc003ljn |5|NM_032095|Q9Y5G3-2|Q9Y5G3-2|PCDHGB1|NM_032095|...    429   5e-120
hg18||uc003ljo |5|NM_018922|Q9Y5G3|PCDGD_HUMAN|PCDHGB1|NM_018922...    429   5e-120
hg18||uc003lip |5|NM_018938|Q9Y5E5|PCDB4_HUMAN|PCDHB4|NM_018938|...    426   6e-119
hg18||uc003ljc |5|NR_001281|Q96TA0|Q96TA0_HUMAN|PCDHB18|NA|NA|Pr...    417   4e-116
hg18||uc003lhw |5|NM_031860|Q9Y5I2-2|Q9Y5I2-2|PCDHA10|NM_031860|...    402   9e-112
hg18||uc003lhn |5|NM_031849|Q9UN73-2|Q9UN73-2|PCDHA6|NM_031849|N...    396   8e-110
hg18||uc003lha |5|NM_031411|Q9Y5I3-2|Q9Y5I3-2|PCDHA1|NM_031411|N...    389   1e-107
hg18||uc003llx |5|NM_016580|Q9NPG4|PCD12_HUMAN|PCDH12|NM_016580|...    362   1e-099
hg18||uc003lkr |5|NR_001297|NA|NA|NR_001297|NA|NA|Homo sapiens P...    350   4e-096

>hg18||uc003lii
        |5|NM_018899|Q9Y5I4|PCDC2_HUMAN|PCDHAC2|NM_018899|NP_061722|protocadher
        in alpha subfamily C, 2 isoform 1

          Length = 1007

 Score =  523 bits (1347), Expect = 3e-148
 Identities = 279/656 (42%), Positives = 414/656 (63%), Gaps = 10/656 (1%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG--NKK 73
           ||||  ..     .   ||.|||   |..| |.|  |||... |    .|.. .|  . .
Sbjct:  29 LLLLLLLLPGPAASQLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRINHLGAPSPR 88

Query:  74 YLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAP 133
           ||...  .| ||. |||||| ||  .    | | |.    ||. .  .||||.|||||.|
Sbjct:  89 YLELDLTSGALFVNERIDREALC--EQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSP 146

Query: 134 HFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKF 193
            | |    | .||| . | || . .| |||||.|||. | || |||| ....  .. .| 
Sbjct: 147 RFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKV 206

Query: 194 ADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDV 253
            .|.| | ||||  |.|.|.|||||||.| |.||| | ||||| |||.|.| .  | | .
Sbjct: 207 LELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQL 266

Query: 254 MENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYE 313
            |.|| |.||.||||.| ||||| .. || | |||.| .|.|...|  ||.||   ..||
Sbjct: 267 REDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYE 326

Query: 314 DLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAV 373
           .   |.. . |.|.|   . | ||| . . |.||| ||. .    .|. ||   .|..||
Sbjct: 327 EASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIVAV 386

Query: 374 VSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRG 433
           .||.|.||| |  | | .   .||.|     | | |||| |||||.|  |.|| | || |
Sbjct: 387 LSVNDQDSGPNRKVSLGLEATLPFRL-NGFGNSYTLVVSGPLDRERVAVYNITVTATDGG 445

Query: 434 SPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLV 493
            | |.   |. .|. ||||| | | .  |.| . ||| || || .. | |||  ||  . 
Sbjct: 446 IPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVT 505

Query: 494 YFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSV 553
           | .||.||    ..   |||  .|.|||. .||||  .||   .||.| ||||||| |. 
Sbjct: 506 YSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTA 565

Query: 554 HIIIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTL 613
           .. .|| ||.|| |. |     |   | .||.   | || ||||    | .|. .     
Sbjct: 566 NVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLA 625

Query: 614 VSNDAYWYSLFLAETRKGKLVVRQPV--PKGSRYIVSSIPRGTGMTDTSGSAPSTL 667
            ..|     ||  |   |..   . .    || . .. . |  |    | |   |.
Sbjct: 626 QTSD---LDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITV 678

>hg18||uc003lij
        |5|NM_031883|Q9Y5I4-2|Q9Y5I4-2|PCDHAC2|NM_031883|NP_114089|protocadheri
        n alpha subfamily C, 2 isoform 2

          Length = 884

 Score =  523 bits (1347), Expect = 3e-148
 Identities = 279/656 (42%), Positives = 414/656 (63%), Gaps = 10/656 (1%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG--NKK 73
           ||||  ..     .   ||.|||   |..| |.|  |||... |    .|.. .|  . .
Sbjct:  29 LLLLLLLLPGPAASQLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRINHLGAPSPR 88

Query:  74 YLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAP 133
           ||...  .| ||. |||||| ||  .    | | |.    ||. .  .||||.|||||.|
Sbjct:  89 YLELDLTSGALFVNERIDREALC--EQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSP 146

Query: 134 HFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKF 193
            | |    | .||| . | || . .| |||||.|||. | || |||| ....  .. .| 
Sbjct: 147 RFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKV 206

Query: 194 ADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDV 253
            .|.| | ||||  |.|.|.|||||||.| |.||| | ||||| |||.|.| .  | | .
Sbjct: 207 LELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQL 266

Query: 254 MENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYE 313
            |.|| |.||.||||.| ||||| .. || | |||.| .|.|...|  ||.||   ..||
Sbjct: 267 REDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYE 326

Query: 314 DLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAV 373
           .   |.. . |.|.|   . | ||| . . |.||| ||. .    .|. ||   .|..||
Sbjct: 327 EASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIVAV 386

Query: 374 VSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRG 433
           .||.|.||| |  | | .   .||.|     | | |||| |||||.|  |.|| | || |
Sbjct: 387 LSVNDQDSGPNRKVSLGLEATLPFRL-NGFGNSYTLVVSGPLDRERVAVYNITVTATDGG 445

Query: 434 SPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLV 493
            | |.   |. .|. ||||| | | .  |.| . ||| || || .. | |||  ||  . 
Sbjct: 446 IPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVT 505

Query: 494 YFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSV 553
           | .||.||    ..   |||  .|.|||. .||||  .||   .||.| ||||||| |. 
Sbjct: 506 YSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTA 565

Query: 554 HIIIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTL 613
           .. .|| ||.|| |. |     |   | .||.   | || ||||    | .|. .     
Sbjct: 566 NVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLA 625

Query: 614 VSNDAYWYSLFLAETRKGKLVVRQPV--PKGSRYIVSSIPRGTGMTDTSGSAPSTL 667
            ..|     ||  |   |..   . .    || . .. . |  |    | |   |.
Sbjct: 626 QTSD---LDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITV 678

>hg18||uc003lku
        |5|NM_032402|Q9UN70-2|Q9UN70-2|PCDHGC3|NM_032402|NP_115778|protocadheri
        n gamma subfamily C, 3 isoform 2

          Length = 863

 Score =  493 bits (1268), Expect = 4e-139
 Identities = 260/629 (41%), Positives = 395/629 (62%), Gaps = 8/629 (1%)

Query:  11 GRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG 70
           ||   .|||   .  |   | || |||| |.|  | |.  .||||. .|  |. ||    
Sbjct:  14 GRVVGVLLLLGALNKA-STVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGA 72

Query:  71 NKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIND 130
           .... ..|.||||.|. .|.||| ||   |   | . |.  .|||. .|..|| | ||||
Sbjct:  73 SRRFFEVNRETGEMFVNDRLDREELC--GTLPSCTVTLELVVENPLELFSVEVVIQDIND 130

Query: 131 NAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDG 190
           | | |    | |.|||. . | || | .| ||||||||.. | || .|.|.. .||  | 
Sbjct: 131 NNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDS 190

Query: 191 TKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYV 250
           ||.|.|.| .||||| .    |.|||.||| |  . .  | ..||| ||||| | .  | 
Sbjct: 191 TKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYR 250

Query: 251 VDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMI 310
             |.|..| |. |... ||||||| | ...||.  .     .|.| |.   | . ..  .
Sbjct: 251 ARVLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRL 310

Query: 311 NYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTV 370
           ..|| ||.|. | | ||| |     ||| ..| |.||| |||.. |  .|. |.  . ||
Sbjct: 311 DFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSPVPEDAPLGTV 370

Query: 371 IAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVT 430
           ||..||.| |.|.||.|   .|  .|| |  |  ||. |  |  |||| ||||... |  
Sbjct: 371 IALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITAR 430

Query: 431 DRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQ 490
           | |.| ||    . ... ||||| |   || | . . ||| ||| . .|. .|||  .| 
Sbjct: 431 DAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNA 490

Query: 491 YLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSN 550
            | .|.||.      .   |.|| .|| . .|   |||  .||       | |.| |..|
Sbjct: 491 RLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHISDGGTPVLATN 550

Query: 551 VSVHIIIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIAD 610
           .||.| . |.||||| .. | |  || | | .|| |  | ||..|.     .  |. .. 
Sbjct: 551 ISVNIFVTDRNDNAPQVLYP-RPGGSSV-EMLPRGTSAGHLVSRVVGWDADAGHNAWLSY 608

Query: 611 STLVSNDAYWYSLFLAETRKGKLVVRQPV 639
           | | | .    |||      |..   .||
Sbjct: 609 SLLGSPN---QSLFAIGLHTGQISTARPV 634

>hg18||uc003lkv
        |5|NM_002588|Q9UN70|PCDGK_HUMAN|PCDHGC3|NM_002588|NP_002579|protocadher
        in gamma subfamily C, 3 isoform 1

          Length = 934

 Score =  493 bits (1268), Expect = 4e-139
 Identities = 260/629 (41%), Positives = 395/629 (62%), Gaps = 8/629 (1%)

Query:  11 GRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG 70
           ||   .|||   .  |   | || |||| |.|  | |.  .||||. .|  |. ||    
Sbjct:  14 GRVVGVLLLLGALNKA-STVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGA 72

Query:  71 NKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIND 130
           .... ..|.||||.|. .|.||| ||   |   | . |.  .|||. .|..|| | ||||
Sbjct:  73 SRRFFEVNRETGEMFVNDRLDREELC--GTLPSCTVTLELVVENPLELFSVEVVIQDIND 130

Query: 131 NAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDG 190
           | | |    | |.|||. . | || | .| ||||||||.. | || .|.|.. .||  | 
Sbjct: 131 NNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDS 190

Query: 191 TKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYV 250
           ||.|.|.| .||||| .    |.|||.||| |  . .  | ..||| ||||| | .  | 
Sbjct: 191 TKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYR 250

Query: 251 VDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMI 310
             |.|..| |. |... ||||||| | ...||.  .     .|.| |.   | . ..  .
Sbjct: 251 ARVLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRL 310

Query: 311 NYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTV 370
           ..|| ||.|. | | ||| |     ||| ..| |.||| |||.. |  .|. |.  . ||
Sbjct: 311 DFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSPVPEDAPLGTV 370

Query: 371 IAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVT 430
           ||..||.| |.|.||.|   .|  .|| |  |  ||. |  |  |||| ||||... |  
Sbjct: 371 IALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITAR 430

Query: 431 DRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQ 490
           | |.| ||    . ... ||||| |   || | . . ||| ||| . .|. .|||  .| 
Sbjct: 431 DAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNA 490

Query: 491 YLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSN 550
            | .|.||.      .   |.|| .|| . .|   |||  .||       | |.| |..|
Sbjct: 491 RLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHISDGGTPVLATN 550

Query: 551 VSVHIIIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIAD 610
           .||.| . |.||||| .. | |  || | | .|| |  | ||..|.     .  |. .. 
Sbjct: 551 ISVNIFVTDRNDNAPQVLYP-RPGGSSV-EMLPRGTSAGHLVSRVVGWDADAGHNAWLSY 608

Query: 611 STLVSNDAYWYSLFLAETRKGKLVVRQPV 639
           | | | .    |||      |..   .||
Sbjct: 609 SLLGSPN---QSLFAIGLHTGQISTARPV 634

>hg18||uc003lkz
        |5|NM_032407|Q9Y5F6-2|Q9Y5F6-2|PCDHGC5|NM_032407|NP_115783|protocadheri
        n gamma subfamily C, 5 isoform 2

          Length = 878

 Score =  486 bits (1251), Expect = 4e-137
 Identities = 249/601 (41%), Positives = 373/601 (62%), Gaps = 5/601 (0%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. || | |..| |.| |||| .  |  |....    | .|  ..  .| | . ..|||
Sbjct:  33 YSVVEESEPGTLVGNVAQDLGLKMTDLLSRRLQLGSEENGRYFSLSLMSGALAVNQKIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .| | | .    |.|. .  .||||.|.|||.| |      . ||||.. | 
Sbjct:  93 ESLC--GASTSCLLPVQVVTEHPLELIRVEVEILDLNDNSPSFATPEREMRISESAASGA 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |..| |||||.|.|  | || . |||.|..| .||  | .|.| . |||| || | |
Sbjct: 151 RFPLDSAQDPDVGTNTVSFYTLSPNSHFSLNVKTLKDGKPFPELVLEQQLDREAQARHQL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||||||| | |.||  | | |||.|||||.|      | . ||.|||.|...||||| |
Sbjct: 211 VLTAVDGGTPARSGTTLISVIVLDINDNAPTFQSSVLRVGIPENAPIGTLLLRLNATDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           ||.|  . ||.  .|||  . .| |.  .| | |   |..|. . ||.   | |.|   .
Sbjct: 271 EGTNGQLDYSFGDHTSEAVRNLFGLDPSSGAIHVLGPIDFEESRFYEIHARARDQGQPAM 330

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
            | | . . | |.||| ||. . |   |. |.  | ||. . .| |.||| || | | | 
Sbjct: 331 EGHCVIQVDVGDVNDNAPEVLLASLANPVLESTPVGTVVGLFNVRDRDSGRNGEVSLDIS 390

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            ..||...  |.|.| |. |.|||||    | |    .| ||| |  . |. | . |.||
Sbjct: 391 PDLPFQIK-PSENHYSLLTSQPLDREATSHYIIELLASDAGSPSLHKHLTIRLNISDVND 449

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | | |  ||  . ||  ||.|| .. | |||  .|  | | |.  ..     |    .
Sbjct: 450 NAPRFNQQLYTAYILENRPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYV 509

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSPWR 572
           |||.| ..| .|||||. .     .  |||||||| .| |.|. ..|.||||| .. |  
Sbjct: 510 NPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRP 569

Query: 573 AQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYSLFLAETRKGK 632
                  ...|||   |||| || |    .  |. .. | |  . |    |||  |  |.
Sbjct: 570 DWEHSAPQRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTA--PGLFLVSTHTGE 627

Query: 633 L 633
           .
Sbjct: 628 V 628

>hg18||uc003lla
        |5|NM_018929|Q9Y5F6|PCDGM_HUMAN|PCDHGC5|NM_018929|NP_061752|protocadher
        in gamma subfamily C, 5 isoform 1

          Length = 944

 Score =  486 bits (1251), Expect = 4e-137
 Identities = 249/601 (41%), Positives = 373/601 (62%), Gaps = 5/601 (0%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. || | |..| |.| |||| .  |  |....    | .|  ..  .| | . ..|||
Sbjct:  33 YSVVEESEPGTLVGNVAQDLGLKMTDLLSRRLQLGSEENGRYFSLSLMSGALAVNQKIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .| | | .    |.|. .  .||||.|.|||.| |      . ||||.. | 
Sbjct:  93 ESLC--GASTSCLLPVQVVTEHPLELIRVEVEILDLNDNSPSFATPEREMRISESAASGA 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |..| |||||.|.|  | || . |||.|..| .||  | .|.| . |||| || | |
Sbjct: 151 RFPLDSAQDPDVGTNTVSFYTLSPNSHFSLNVKTLKDGKPFPELVLEQQLDREAQARHQL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||||||| | |.||  | | |||.|||||.|      | . ||.|||.|...||||| |
Sbjct: 211 VLTAVDGGTPARSGTTLISVIVLDINDNAPTFQSSVLRVGIPENAPIGTLLLRLNATDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           ||.|  . ||.  .|||  . .| |.  .| | |   |..|. . ||.   | |.|   .
Sbjct: 271 EGTNGQLDYSFGDHTSEAVRNLFGLDPSSGAIHVLGPIDFEESRFYEIHARARDQGQPAM 330

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
            | | . . | |.||| ||. . |   |. |.  | ||. . .| |.||| || | | | 
Sbjct: 331 EGHCVIQVDVGDVNDNAPEVLLASLANPVLESTPVGTVVGLFNVRDRDSGRNGEVSLDIS 390

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            ..||...  |.|.| |. |.|||||    | |    .| ||| |  . |. | . |.||
Sbjct: 391 PDLPFQIK-PSENHYSLLTSQPLDREATSHYIIELLASDAGSPSLHKHLTIRLNISDVND 449

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | | |  ||  . ||  ||.|| .. | |||  .|  | | |.  ..     |    .
Sbjct: 450 NAPRFNQQLYTAYILENRPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYV 509

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSPWR 572
           |||.| ..| .|||||. .     .  |||||||| .| |.|. ..|.||||| .. |  
Sbjct: 510 NPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRP 569

Query: 573 AQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYSLFLAETRKGK 632
                  ...|||   |||| || |    .  |. .. | |  . |    |||  |  |.
Sbjct: 570 DWEHSAPQRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTA--PGLFLVSTHTGE 627

Query: 633 L 633
           .
Sbjct: 628 V 628

>hg18||uc003lki
        |5|NM_032100|Q9Y5F9-2|Q9Y5F9-2|PCDHGB6|NM_032100|NP_115271|protocadheri
        n gamma subfamily B, 6 isoform 2

          Length = 820

 Score =  484 bits (1245), Expect = 2e-136
 Identities = 259/621 (41%), Positives = 388/621 (62%), Gaps = 8/621 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMR 65
           |   | |     ||  .    .     ||||||. .|||| ||| |||| |  .  ||.|
Sbjct:   8 RRRAGPRQVLFPLLLPLFYPTLSEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLR 67

Query:  66 VDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEI 125
           |     | .  .. |.|.| .  ||||| .|  |    | |.|.| .|||. .|.. | |
Sbjct:  68 VS--AEKLHFSVDAESGDLLVKNRIDREQIC--KERRRCELQLEAVVENPLNIFHVIVVI 123

Query: 126 MDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQ 185
            |.||.|| | .  .||.| ||.| | | ||. | |||.  ||.||| .... .||. ..
Sbjct: 124 EDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKINSNPYFSLMVR 183

Query: 186 TGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFG 245
              || |. .| | | |||| |  |.|||||.||| | |. || | . | | ||| | | 
Sbjct: 184 VNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFS 243

Query: 246 KDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIR 305
           .|.| . . || | || |... ||| ||| |... | |   |.. |. .|.|. . | |.
Sbjct: 244 RDEYRISLSENLPPGSPVLQVTATDQDEGVNAEINY-YFRSTAQSTKHMFSLDEKTGMIK 302

Query: 306 VREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENI 365
             .  ..||.. | ||. | | |   |. |||| |.. | ||| ||| | |    . || 
Sbjct: 303 NNQSFDFEDVERYTMEVEAKDGGG--LSTQCKVIIEILDENDNSPEIIITSLSDQILENS 360

Query: 366 DVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDI 425
               |.|.    | | | || |  .|  ..|||.  ||.|||.||    ||||. |||..
Sbjct: 361 PPGMVVALFKTRDLDFGGNGEVRCNIETDIPFKIYSSSNNYYKLVTDGALDREQTPEYNV 420

Query: 426 TFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPD 485
           |   |||| |||| . ..|| . ||||| | | |. | . | ||| ||| .. ..| |||
Sbjct: 421 TIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPD 480

Query: 486 LHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSP 545
           |  | .. | |.  ..   ..|   |.. ..| ..| . ||.|  . |   ..||| |||
Sbjct: 481 LGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSP 540

Query: 546 PLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISER 604
            ||.|||. ... |.||||| .. |     ||   . .||| . | || ||.|    |  
Sbjct: 541 TLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAEPGYLVTKVVAVDADSGH 600

Query: 605 NSTIADSTLVSNDAYWYSLFL 625
           |. ..   | ...   .|| |
Sbjct: 601 NAWLSYHVLQASEPGLFSLGL 621

>hg18||uc003lkj
        |5|NM_018926|Q9Y5F9|PCDGI_HUMAN|PCDHGB6|NM_018926|NP_061749|protocadher
        in gamma subfamily B, 6 isoform 1

          Length = 930

 Score =  484 bits (1245), Expect = 2e-136
 Identities = 259/621 (41%), Positives = 388/621 (62%), Gaps = 8/621 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMR 65
           |   | |     ||  .    .     ||||||. .|||| ||| |||| |  .  ||.|
Sbjct:   8 RRRAGPRQVLFPLLLPLFYPTLSEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLR 67

Query:  66 VDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEI 125
           |     | .  .. |.|.| .  ||||| .|  |    | |.|.| .|||. .|.. | |
Sbjct:  68 VS--AEKLHFSVDAESGDLLVKNRIDREQIC--KERRRCELQLEAVVENPLNIFHVIVVI 123

Query: 126 MDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQ 185
            |.||.|| | .  .||.| ||.| | | ||. | |||.  ||.||| .... .||. ..
Sbjct: 124 EDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKINSNPYFSLMVR 183

Query: 186 TGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFG 245
              || |. .| | | |||| |  |.|||||.||| | |. || | . | | ||| | | 
Sbjct: 184 VNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFS 243

Query: 246 KDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIR 305
           .|.| . . || | || |... ||| ||| |... | |   |.. |. .|.|. . | |.
Sbjct: 244 RDEYRISLSENLPPGSPVLQVTATDQDEGVNAEINY-YFRSTAQSTKHMFSLDEKTGMIK 302

Query: 306 VREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENI 365
             .  ..||.. | ||. | | |   |. |||| |.. | ||| ||| | |    . || 
Sbjct: 303 NNQSFDFEDVERYTMEVEAKDGGG--LSTQCKVIIEILDENDNSPEIIITSLSDQILENS 360

Query: 366 DVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDI 425
               |.|.    | | | || |  .|  ..|||.  ||.|||.||    ||||. |||..
Sbjct: 361 PPGMVVALFKTRDLDFGGNGEVRCNIETDIPFKIYSSSNNYYKLVTDGALDREQTPEYNV 420

Query: 426 TFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPD 485
           |   |||| |||| . ..|| . ||||| | | |. | . | ||| ||| .. ..| |||
Sbjct: 421 TIVATDRGKPPLSSSRSITLYVADINDNAPVFDQTSYVVHVAENNPPGASIAQVSASDPD 480

Query: 486 LHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSP 545
           |  | .. | |.  ..   ..|   |.. ..| ..| . ||.|  . |   ..||| |||
Sbjct: 481 LGLNGHISYSIVASDLEPLAVSSYVSVSAQSGVVFAQRAFDHEQLRAFALTLQARDHGSP 540

Query: 546 PLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISER 604
            ||.|||. ... |.||||| .. |     ||   . .||| . | || ||.|    |  
Sbjct: 541 TLSANVSLRVLVGDRNDNAPRVLYPALGPDGSAFFDMVPRSAEPGYLVTKVVAVDADSGH 600

Query: 605 NSTIADSTLVSNDAYWYSLFL 625
           |. ..   | ...   .|| |
Sbjct: 601 NAWLSYHVLQASEPGLFSLGL 621

>hg18||uc003lks
        |5|NM_032094|O60330-2|O60330-2|PCDHGA12|NM_032094|NP_115265|protocadher
        in gamma subfamily A, 12 isoform 2

          Length = 820

 Score =  484 bits (1244), Expect = 2e-136
 Identities = 264/614 (42%), Positives = 382/614 (62%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.|||.|.|| | ... ||||. . |  | .|.   |  .   .|  .| |    ||||
Sbjct:  33 YSVPEELEKGSRVGDISRDLGLEPRELAERGVRIIPRGRTQLFALNPRSGSLVTAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||       | | ||  .|. .... .|||. |||||||.||   . . |||...   
Sbjct:  93 EELC--MGAIKCQLNLDILMEDKVKIYGVEVEVRDINDNAPYFRESELEIKISENAATEM 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || | .| |||.| ||.. | || . |||. .| | ||.|. .|.| .||||| .| |.|
Sbjct: 151 RFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | ||||| | | ||| |||||.| . .|   | ||  .|. .. .|||| |
Sbjct: 211 VLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || |..| ||.  |  ..  |.| |.  .| |     ...|.   |.||. | |      
Sbjct: 271 EGVNAEVRYSFR-YVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAG--Y 327

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           . . || | | |.||| ||. . |  . . ||    |.||...|.|.|| .|| |   | 
Sbjct: 328 SARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQ 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            |.|||| .|  ||| ||    ||||.|| |.|| | ||||.||||    ..| . | ||
Sbjct: 388 GNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | |||. |.  . |||  |  | |.|| |||  ||  . | . |  |   |.|   ||
Sbjct: 448 NPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | |||| .||||  ..    . |||.| ||||||||. . ..||||||| |. |  
Sbjct: 508 NSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLAETR 629
              ||   |  ||| . | || ||.|    | .|. ..   | ...   .|  |   | |
Sbjct: 568 PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003lkt
        |5|NM_003735|O60330|PCDGC_HUMAN|PCDHGA12|NM_003735|NP_003726|protocadhe
        rin gamma subfamily A, 12 isoform 1

          Length = 932

 Score =  484 bits (1244), Expect = 2e-136
 Identities = 264/614 (42%), Positives = 382/614 (62%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.|||.|.|| | ... ||||. . |  | .|.   |  .   .|  .| |    ||||
Sbjct:  33 YSVPEELEKGSRVGDISRDLGLEPRELAERGVRIIPRGRTQLFALNPRSGSLVTAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||       | | ||  .|. .... .|||. |||||||.||   . . |||...   
Sbjct:  93 EELC--MGAIKCQLNLDILMEDKVKIYGVEVEVRDINDNAPYFRESELEIKISENAATEM 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || | .| |||.| ||.. | || . |||. .| | ||.|. .|.| .||||| .| |.|
Sbjct: 151 RFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | ||||| | | ||| |||||.| . .|   | ||  .|. .. .|||| |
Sbjct: 211 VLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || |..| ||.  |  ..  |.| |.  .| |     ...|.   |.||. | |      
Sbjct: 271 EGVNAEVRYSFR-YVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAG--Y 327

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           . . || | | |.||| ||. . |  . . ||    |.||...|.|.|| .|| |   | 
Sbjct: 328 SARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQ 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            |.|||| .|  ||| ||    ||||.|| |.|| | ||||.||||    ..| . | ||
Sbjct: 388 GNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | |||. |.  . |||  |  | |.|| |||  ||  . | . |  |   |.|   ||
Sbjct: 448 NPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | |||| .||||  ..    . |||.| ||||||||. . ..||||||| |. |  
Sbjct: 508 NSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLAETR 629
              ||   |  ||| . | || ||.|    | .|. ..   | ...   .|  |   | |
Sbjct: 568 PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003lkm
        |5|NM_032101|Q9Y5F8-2|Q9Y5F8-2|PCDHGB7|NM_032101|NP_115272|protocadheri
        n gamma subfamily B, 7 isoform 2

          Length = 808

 Score =  480 bits (1235), Expect = 3e-135
 Identities = 249/621 (40%), Positives = 392/621 (63%), Gaps = 8/621 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMR 65
           |   | |     ||  .    .     ||||||. .|||| ||| |||| |  .  |..|
Sbjct:   8 RRRAGPRQVLFPLLLPLFYPTLCEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARELR 67

Query:  66 VDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEI 125
           |     | .  .. ..|.| . .||||| .|  |    | |.|.| .|||. .|.. | |
Sbjct:  68 VS--AEKLHFSVDAQSGDLLVKDRIDREQIC--KERRRCELQLEAVVENPLNIFHVIVVI 123

Query: 126 MDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQ 185
            |.||.|| ||.  ..|.|||| |.|    | .| |||.  ||.  | || .|.||.  .
Sbjct: 124 EDVNDHAPQFRKDEINLEISESVSLGMGTILESAEDPDISMNSLSKYQLSPNEYFSLVEK 183

Query: 186 TGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFG 245
              || |. .|.| | |||| |. |.|.|||.||| | |.||| | . |.| ||| | | 
Sbjct: 184 DNPDGGKYPELVLQKTLDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPPVFS 243

Query: 246 KDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIR 305
           .| | | . |. | |. .... ||| ||| ||.. ||.    ... | .|.|.   | | 
Sbjct: 244 QDVYRVSLREDVPPGTSILRVKATDQDEGINSEITYSF-FGVADKAQHVFSLDYTTGNIL 302

Query: 306 VREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENI 365
            .. ...|... | . | | |.|.  |. .||| ..| | ||| ||| | |    . |. 
Sbjct: 303 TQQPLDFEEVERYTINIEAKDRGS--LSTRCKVIVEVVDENDNSPEIIITSLSDQIMEDS 360

Query: 366 DVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDI 425
               |.|.    |.|||.|| |   .   .|||.  ||.|||.||  | ||||. |||..
Sbjct: 361 PPGVVVALFKTRDQDSGENGEVRCSLSRGVPFKIHSSSNNYYKLVTDEALDREQTPEYNV 420

Query: 426 TFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPD 485
           |   |||| |||| ..|.|| . |.||| | | || | . | ||| ||| .. ..| |||
Sbjct: 421 TIAATDRGKPPLSSSKTITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPD 480

Query: 486 LHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSP 545
              |  . | ..  .. . ..|   |.. ..| ..| . ||.|  . |   ..||| |||
Sbjct: 481 FGLNGRVSYSLIASDLESRTLSSYVSVSAQSGVVFAQRAFDHEQLRTFELTLQARDQGSP 540

Query: 546 PLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISER 604
            ||.|||. ... |.||||| .. |     || . . .||.   | || ||.|    |  
Sbjct: 541 ALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGH 600

Query: 605 NSTIADSTLVSNDAYWYSLFL 625
           |. ..   . ...   .|| |
Sbjct: 601 NAWLSYHVVQASEPGLFSLGL 621

>hg18||uc003lkn
        |5|NM_018927|Q9Y5F8|PCDGJ_HUMAN|PCDHGB7|NM_018927|NP_061750|protocadher
        in gamma subfamily B, 7 isoform 1

          Length = 929

 Score =  480 bits (1235), Expect = 3e-135
 Identities = 249/621 (40%), Positives = 392/621 (63%), Gaps = 8/621 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMR 65
           |   | |     ||  .    .     ||||||. .|||| ||| |||| |  .  |..|
Sbjct:   8 RRRAGPRQVLFPLLLPLFYPTLCEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARELR 67

Query:  66 VDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEI 125
           |     | .  .. ..|.| . .||||| .|  |    | |.|.| .|||. .|.. | |
Sbjct:  68 VS--AEKLHFSVDAQSGDLLVKDRIDREQIC--KERRRCELQLEAVVENPLNIFHVIVVI 123

Query: 126 MDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQ 185
            |.||.|| ||.  ..|.|||| |.|    | .| |||.  ||.  | || .|.||.  .
Sbjct: 124 EDVNDHAPQFRKDEINLEISESVSLGMGTILESAEDPDISMNSLSKYQLSPNEYFSLVEK 183

Query: 186 TGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFG 245
              || |. .|.| | |||| |. |.|.|||.||| | |.||| | . |.| ||| | | 
Sbjct: 184 DNPDGGKYPELVLQKTLDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPPVFS 243

Query: 246 KDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIR 305
           .| | | . |. | |. .... ||| ||| ||.. ||.    ... | .|.|.   | | 
Sbjct: 244 QDVYRVSLREDVPPGTSILRVKATDQDEGINSEITYSF-FGVADKAQHVFSLDYTTGNIL 302

Query: 306 VREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENI 365
            .. ...|... | . | | |.|.  |. .||| ..| | ||| ||| | |    . |. 
Sbjct: 303 TQQPLDFEEVERYTINIEAKDRGS--LSTRCKVIVEVVDENDNSPEIIITSLSDQIMEDS 360

Query: 366 DVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDI 425
               |.|.    |.|||.|| |   .   .|||.  ||.|||.||  | ||||. |||..
Sbjct: 361 PPGVVVALFKTRDQDSGENGEVRCSLSRGVPFKIHSSSNNYYKLVTDEALDREQTPEYNV 420

Query: 426 TFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPD 485
           |   |||| |||| ..|.|| . |.||| | | || | . | ||| ||| .. ..| |||
Sbjct: 421 TIAATDRGKPPLSSSKTITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPD 480

Query: 486 LHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSP 545
              |  . | ..  .. . ..|   |.. ..| ..| . ||.|  . |   ..||| |||
Sbjct: 481 FGLNGRVSYSLIASDLESRTLSSYVSVSAQSGVVFAQRAFDHEQLRTFELTLQARDQGSP 540

Query: 546 PLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISER 604
            ||.|||. ... |.||||| .. |     || . . .||.   | || ||.|    |  
Sbjct: 541 ALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGH 600

Query: 605 NSTIADSTLVSNDAYWYSLFL 625
           |. ..   . ...   .|| |
Sbjct: 601 NAWLSYHVVQASEPGLFSLGL 621

>hg18||uc003lkk
        |5|NM_032090|Q9Y5H3-2|Q9Y5H3-2|PCDHGA10|NM_032090|NP_114479|protocadher
        in gamma subfamily A, 10 isoform 2

          Length = 850

 Score =  479 bits (1232), Expect = 6e-135
 Identities = 262/603 (43%), Positives = 368/603 (61%), Gaps = 6/603 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           | | | .   |      ||||||.|.|| | |.. ||||  . |  | .|.   |  .  
Sbjct:  20 LCLFFGIPWEAGARQISYSIPEELEKGSFVGNISKDLGLAPRELAERGVRIVSRGRTQLF 79

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .|  .| |    ||||| ||    .  | .  .  .|. ...| ||.|. ||||||| |
Sbjct:  80 SLNPRSGSLITAGRIDREELC--AQSARCVVSFNILVEDRVKLFGIEIEVTDINDNAPKF 137

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
           .   . . |.|. . | || |  | ||||| ||.. | || ..|||. .|.  .| |. .
Sbjct: 138 QAENLDVKINENVAAGMRFPLPEAIDPDVGVNSLQSYQLSPNKHFSLRVQSRANGVKYPE 197

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.|  .|||| .|.|.|.||| ||| | |.||  . | | | ||||| |   .| | | |
Sbjct: 198 LVLEHSLDREEEAIHHLVLTASDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPE 257

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           | |.|. .. . ||| |||.| .| ||.      .  . | ||   |||.. | ..||. 
Sbjct: 258 NLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLK-FQLNKYTGEIKISENLDYEET 316

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             ||.|| | | |  | |   || | | |.||| ||..| |  .|. |.  . ||.|...
Sbjct: 317 GFYEIEIQAEDGGAYLAT--AKVLITVEDVNDNSPELTITSLFSPVTEDSPLGTVVALLN 374

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||  || |   |   .|||| .| |.|| ||.   ||||.|  |.|| | || |||
Sbjct: 375 VHDLDSEQNGQVTCSILAYLPFKLEKSIDSYYRLVIHRALDREQVSSYNITVTATDGGSP 434

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           |||      |.. ||||| | | |  |   . |||| || . |.|| |||  ||  ..| 
Sbjct: 435 PLSTEAHFMLQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDSKENAQIIYS 494

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           . |  |    .|   ||| . | ||||..||||   |    . | ||| ||||||||. .
Sbjct: 495 LAEDTIQGVPLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASDSGDPPLSSNVSLSL 554

Query: 556 IIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLV 614
            ..||||||| |. |     ||   |  ||| . | || ||.|    | .|. ..   | 
Sbjct: 555 FVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLK 614

Query: 615 SND 617
           ...
Sbjct: 615 ASE 617

>hg18||uc003lkl
        |5|NM_018913|Q9Y5H3|PCDGA_HUMAN|PCDHGA10|NM_018913|NP_061736|protocadhe
        rin gamma subfamily A, 10 isoform 1

          Length = 936

 Score =  479 bits (1232), Expect = 6e-135
 Identities = 262/603 (43%), Positives = 368/603 (61%), Gaps = 6/603 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           | | | .   |      ||||||.|.|| | |.. ||||  . |  | .|.   |  .  
Sbjct:  20 LCLFFGIPWEAGARQISYSIPEELEKGSFVGNISKDLGLAPRELAERGVRIVSRGRTQLF 79

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .|  .| |    ||||| ||    .  | .  .  .|. ...| ||.|. ||||||| |
Sbjct:  80 SLNPRSGSLITAGRIDREELC--AQSARCVVSFNILVEDRVKLFGIEIEVTDINDNAPKF 137

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
           .   . . |.|. . | || |  | ||||| ||.. | || ..|||. .|.  .| |. .
Sbjct: 138 QAENLDVKINENVAAGMRFPLPEAIDPDVGVNSLQSYQLSPNKHFSLRVQSRANGVKYPE 197

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.|  .|||| .|.|.|.||| ||| | |.||  . | | | ||||| |   .| | | |
Sbjct: 198 LVLEHSLDREEEAIHHLVLTASDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPE 257

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           | |.|. .. . ||| |||.| .| ||.      .  . | ||   |||.. | ..||. 
Sbjct: 258 NLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLK-FQLNKYTGEIKISENLDYEET 316

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             ||.|| | | |  | |   || | | |.||| ||..| |  .|. |.  . ||.|...
Sbjct: 317 GFYEIEIQAEDGGAYLAT--AKVLITVEDVNDNSPELTITSLFSPVTEDSPLGTVVALLN 374

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||  || |   |   .|||| .| |.|| ||.   ||||.|  |.|| | || |||
Sbjct: 375 VHDLDSEQNGQVTCSILAYLPFKLEKSIDSYYRLVIHRALDREQVSSYNITVTATDGGSP 434

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           |||      |.. ||||| | | |  |   . |||| || . |.|| |||  ||  ..| 
Sbjct: 435 PLSTEAHFMLQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDSKENAQIIYS 494

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           . |  |    .|   ||| . | ||||..||||   |    . | ||| ||||||||. .
Sbjct: 495 LAEDTIQGVPLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASDSGDPPLSSNVSLSL 554

Query: 556 IIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLV 614
            ..||||||| |. |     ||   |  ||| . | || ||.|    | .|. ..   | 
Sbjct: 555 FVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLK 614

Query: 615 SND 617
           ...
Sbjct: 615 ASE 617

>hg18||uc003lko
        |5|NM_032091|Q9Y5H2-2|Q9Y5H2-2|PCDHGA11|NM_032091|NP_114480|protocadher
        in gamma subfamily A, 11 isoform 2

          Length = 837

 Score =  477 bits (1227), Expect = 2e-134
 Identities = 266/616 (43%), Positives = 377/616 (61%), Gaps = 9/616 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATA---VVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGR 62
           ||  | |   ||||   . |          ||.||| |.|| | |.. ||||. . |  |
Sbjct:   4 RLQRGDRSRLLLLLCIFLGTLRGFRARQIRYSVPEETEKGSFVGNISKDLGLEPRELAKR 63

Query:  63 KMRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIE 122
            .|.   |  .   .|  .| |    ||||| ||  .| . ||| ..  .|. .... .|
Sbjct:  64 GVRIVSRGKTQLFAVNPRSGSLITAGRIDREELC--ETVSSCFLNMELLVEDTLKIYGVE 121

Query: 123 VEIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSI 182
           |||.||||||| |.   . . .|| .  | ||.| || ||||| ||.. | || . .||.
Sbjct: 122 VEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSL 181

Query: 183 NIQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAP 242
            ..   || |  .|.|  .|||| .| | |.|||.||| | | |   | | ||||||. |
Sbjct: 182 QLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIP 241

Query: 243 SFGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENG 302
            | .  | | | ||   |. |. .|||| ||| | .|.||.    | .  .|| |... |
Sbjct: 242 MFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMES-KASEIFQLDSQTG 300

Query: 303 EIRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLN 362
           |..||  ...|  . |||||   | |    |    .|  | |.||| |||.| |    . 
Sbjct: 301 EVQVRGSLDFEKYRFYEMEIQGQDGGGLFTTTTMLIT--VVDVNDNAPEITITSSINSIL 358

Query: 363 ENIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPE 422
           ||    ||||...| |.|||.|| |   ||...|||| ..  |||.|. |  |||| |  
Sbjct: 359 ENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGNYYKLITSRVLDRELVQS 418

Query: 423 YDITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAF 482
           |.|| | ||.||||||    . | . | ||| | || | |.  . |||  || . |.|| 
Sbjct: 419 YNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTAL 478

Query: 483 DPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDS 542
           |||  .|  . | . .  .    .|   |||   | ||||..||||  ..    . ||||
Sbjct: 479 DPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDS 538

Query: 543 GSPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVI 601
           | ||||||||. . ..||||||| |. |     ||   |  ||| . | || ||.|    
Sbjct: 539 GDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKD 598

Query: 602 SERNSTIADSTLVSND 617
           | .|. ..   | ...
Sbjct: 599 SGQNAWLSYRLLKASE 614

>hg18||uc003lkp
        |5|NM_032092|Q9Y5H2-3|Q9Y5H2-3|PCDHGA11|NM_032092|NP_114481|protocadher
        in gamma subfamily A, 11 isoform 3

          Length = 750

 Score =  477 bits (1227), Expect = 2e-134
 Identities = 266/616 (43%), Positives = 377/616 (61%), Gaps = 9/616 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATA---VVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGR 62
           ||  | |   ||||   . |          ||.||| |.|| | |.. ||||. . |  |
Sbjct:   4 RLQRGDRSRLLLLLCIFLGTLRGFRARQIRYSVPEETEKGSFVGNISKDLGLEPRELAKR 63

Query:  63 KMRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIE 122
            .|.   |  .   .|  .| |    ||||| ||  .| . ||| ..  .|. .... .|
Sbjct:  64 GVRIVSRGKTQLFAVNPRSGSLITAGRIDREELC--ETVSSCFLNMELLVEDTLKIYGVE 121

Query: 123 VEIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSI 182
           |||.||||||| |.   . . .|| .  | ||.| || ||||| ||.. | || . .||.
Sbjct: 122 VEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSL 181

Query: 183 NIQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAP 242
            ..   || |  .|.|  .|||| .| | |.|||.||| | | |   | | ||||||. |
Sbjct: 182 QLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIP 241

Query: 243 SFGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENG 302
            | .  | | | ||   |. |. .|||| ||| | .|.||.    | .  .|| |... |
Sbjct: 242 MFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMES-KASEIFQLDSQTG 300

Query: 303 EIRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLN 362
           |..||  ...|  . |||||   | |    |    .|  | |.||| |||.| |    . 
Sbjct: 301 EVQVRGSLDFEKYRFYEMEIQGQDGGGLFTTTTMLIT--VVDVNDNAPEITITSSINSIL 358

Query: 363 ENIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPE 422
           ||    ||||...| |.|||.|| |   ||...|||| ..  |||.|. |  |||| |  
Sbjct: 359 ENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGNYYKLITSRVLDRELVQS 418

Query: 423 YDITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAF 482
           |.|| | ||.||||||    . | . | ||| | || | |.  . |||  || . |.|| 
Sbjct: 419 YNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTAL 478

Query: 483 DPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDS 542
           |||  .|  . | . .  .    .|   |||   | ||||..||||  ..    . ||||
Sbjct: 479 DPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDS 538

Query: 543 GSPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVI 601
           | ||||||||. . ..||||||| |. |     ||   |  ||| . | || ||.|    
Sbjct: 539 GDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKD 598

Query: 602 SERNSTIADSTLVSND 617
           | .|. ..   | ...
Sbjct: 599 SGQNAWLSYRLLKASE 614

>hg18||uc003lkq
        |5|NM_018914|Q9Y5H2|PCDGB_HUMAN|PCDHGA11|NM_018914|NP_061737|protocadhe
        rin gamma subfamily A, 11 isoform 1

          Length = 935

 Score =  477 bits (1227), Expect = 2e-134
 Identities = 266/616 (43%), Positives = 377/616 (61%), Gaps = 9/616 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIATA---VVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGR 62
           ||  | |   ||||   . |          ||.||| |.|| | |.. ||||. . |  |
Sbjct:   4 RLQRGDRSRLLLLLCIFLGTLRGFRARQIRYSVPEETEKGSFVGNISKDLGLEPRELAKR 63

Query:  63 KMRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIE 122
            .|.   |  .   .|  .| |    ||||| ||  .| . ||| ..  .|. .... .|
Sbjct:  64 GVRIVSRGKTQLFAVNPRSGSLITAGRIDREELC--ETVSSCFLNMELLVEDTLKIYGVE 121

Query: 123 VEIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSI 182
           |||.||||||| |.   . . .|| .  | ||.| || ||||| ||.. | || . .||.
Sbjct: 122 VEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSL 181

Query: 183 NIQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAP 242
            ..   || |  .|.|  .|||| .| | |.|||.||| | | |   | | ||||||. |
Sbjct: 182 QLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIP 241

Query: 243 SFGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENG 302
            | .  | | | ||   |. |. .|||| ||| | .|.||.    | .  .|| |... |
Sbjct: 242 MFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMES-KASEIFQLDSQTG 300

Query: 303 EIRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLN 362
           |..||  ...|  . |||||   | |    |    .|  | |.||| |||.| |    . 
Sbjct: 301 EVQVRGSLDFEKYRFYEMEIQGQDGGGLFTTTTMLIT--VVDVNDNAPEITITSSINSIL 358

Query: 363 ENIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPE 422
           ||    ||||...| |.|||.|| |   ||...|||| ..  |||.|. |  |||| |  
Sbjct: 359 ENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGNYYKLITSRVLDRELVQS 418

Query: 423 YDITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAF 482
           |.|| | ||.||||||    . | . | ||| | || | |.  . |||  || . |.|| 
Sbjct: 419 YNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTAL 478

Query: 483 DPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDS 542
           |||  .|  . | . .  .    .|   |||   | ||||..||||  ..    . ||||
Sbjct: 479 DPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDS 538

Query: 543 GSPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVI 601
           | ||||||||. . ..||||||| |. |     ||   |  ||| . | || ||.|    
Sbjct: 539 GDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKD 598

Query: 602 SERNSTIADSTLVSND 617
           | .|. ..   | ...
Sbjct: 599 SGQNAWLSYRLLKASE 614

>hg18||uc003ljp
        |5|NM_032053|Q9Y5G9-2|Q9Y5G9-2|PCDHGA4|NM_032053|NP_114442|protocadheri
        n gamma subfamily A, 4 isoform 2

          Length = 820

 Score =  475 bits (1222), Expect = 8e-134
 Identities = 255/603 (42%), Positives = 375/603 (62%), Gaps = 6/603 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           . ||  |.         ||. || |||||| |.| ||||  . |  | .|.   |  .  
Sbjct:  16 ICLLLGVLVEIRAEQILYSVFEEQEEGSVVGNIAKDLGLAPRELAERGVRIVSRGRTQLF 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .|  .| |    ||||| ||    . .|   |.  .|. ...  .||||.|.||| | |
Sbjct:  76 ALNPRSGTLVTAGRIDREELC--DRSPNCVTNLEILLEDTVKILRVEVEIIDVNDNPPSF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
                 . ..|. . | || |  | ||||| ||.. | |... .||...|.| || |. .
Sbjct: 134 GTEQREIKVAENENPGARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.| .||||| .|||.|.||| ||| | |.||| |.. ..| ||||| | . .| | | |
Sbjct: 194 LVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           | |.|. .. . ||| |||.| || ||.     ..  |.| ||. .|.| .   ..||| 
Sbjct: 254 NVPVGTRLLTVKATDPDEGANGDVTYSFR-KVRDKISQLFQLNSLSGDITILGGLDYEDS 312

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             |.... | |     |  . || . | | ||| ||... |  . . |.    ||||. .
Sbjct: 313 GFYDIDVEAHDGPG--LRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFN 370

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||| ||.|   ||||.|| | ..  ||| |.    ||||.| ||.|| | ||.|.|
Sbjct: 371 VHDSDSGGNGLVTCSIPDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTP 430

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           |||    ..|...||||| | || . |.  . |||  || . |.|| |||  .|  . | 
Sbjct: 431 PLSTETHISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYS 490

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           . |       .|   |||   | |||| .||||  ..    . | ||| ||||||||. .
Sbjct: 491 LAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSL 550

Query: 556 IIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLV 614
            ..||||| | |. | .   ||   |  ||| | | || ||.|    | .|. .. | | 
Sbjct: 551 FVLDQNDNVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLK 610

Query: 615 SND 617
           |..
Sbjct: 611 SSE 613

>hg18||uc003ljq
        |5|NM_018917|Q9Y5G9|PCDG4_HUMAN|PCDHGA4|NM_018917|NP_061740|protocadher
        in gamma subfamily A, 4 isoform 1

          Length = 931

 Score =  475 bits (1222), Expect = 8e-134
 Identities = 255/603 (42%), Positives = 375/603 (62%), Gaps = 6/603 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           . ||  |.         ||. || |||||| |.| ||||  . |  | .|.   |  .  
Sbjct:  16 ICLLLGVLVEIRAEQILYSVFEEQEEGSVVGNIAKDLGLAPRELAERGVRIVSRGRTQLF 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .|  .| |    ||||| ||    . .|   |.  .|. ...  .||||.|.||| | |
Sbjct:  76 ALNPRSGTLVTAGRIDREELC--DRSPNCVTNLEILLEDTVKILRVEVEIIDVNDNPPSF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
                 . ..|. . | || |  | ||||| ||.. | |... .||...|.| || |. .
Sbjct: 134 GTEQREIKVAENENPGARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.| .||||| .|||.|.||| ||| | |.||| |.. ..| ||||| | . .| | | |
Sbjct: 194 LVLERALDREEEAVHHLVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           | |.|. .. . ||| |||.| || ||.     ..  |.| ||. .|.| .   ..||| 
Sbjct: 254 NVPVGTRLLTVKATDPDEGANGDVTYSFR-KVRDKISQLFQLNSLSGDITILGGLDYEDS 312

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             |.... | |     |  . || . | | ||| ||... |  . . |.    ||||. .
Sbjct: 313 GFYDIDVEAHDGPG--LRARSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFN 370

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||| ||.|   ||||.|| | ..  ||| |.    ||||.| ||.|| | ||.|.|
Sbjct: 371 VHDSDSGGNGLVTCSIPDNLPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTP 430

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           |||    ..|...||||| | || . |.  . |||  || . |.|| |||  .|  . | 
Sbjct: 431 PLSTETHISLQVMDINDNPPTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYS 490

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           . |       .|   |||   | |||| .||||  ..    . | ||| ||||||||. .
Sbjct: 491 LAEDTFQGAPLSSYVSINSNTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSL 550

Query: 556 IIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLV 614
            ..||||| | |. | .   ||   |  ||| | | || ||.|    | .|. .. | | 
Sbjct: 551 FVLDQNDNVPEILYPTFPTDGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLK 610

Query: 615 SND 617
           |..
Sbjct: 611 SSE 613

>hg18||uc003ljt
        |5|NM_032054|Q9Y5G8-2|Q9Y5G8-2|PCDHGA5|NM_032054|NP_114443|protocadheri
        n gamma subfamily A, 5 isoform 2

          Length = 813

 Score =  475 bits (1221), Expect = 1e-133
 Identities = 261/640 (40%), Positives = 385/640 (60%), Gaps = 11/640 (1%)

Query:  10 GGRCNCLLLLFSVIATAV---VAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRV 66
           |  |  ||| | .. |          ||.|||...|| | |.| ||||. . |  | .|.
Sbjct:   7 GWGCGELLLPFMLLGTLCEPGSGQIRYSMPEELDKGSFVGNIAKDLGLEPQELAERGVRI 66

Query:  67 DVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIM 126
              |  .   .|  .| |    ||||| ||    .  | .  .  .|| .... .||||.
Sbjct:  67 VSRGRTQLFALNPRSGSLVTAGRIDREELC--AQSPLCVVNFNILVENKMKIYGVEVEII 124

Query: 127 DINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQT 186
           ||||| | ||   . . ..|... | |  |  | | ||| ||.. | ||.. |||... .
Sbjct: 125 DINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDADVGVNSLRSYQLSSNLHFSLDVVS 184

Query: 187 GRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGK 246
           | || |. .|.| . |||| . ||.|.|||.||| |  .||  | | ||| ||||| |  
Sbjct: 185 GTDGQKYPELVLEQPLDREKETVHDLLLTALDGGDPVLSGTTHIRVTVLDANDNAPLFTP 244

Query: 247 DKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRV 306
            .| | | || |.|. .. | ||| ||| |  . ||.     |.  . | |..  |||  
Sbjct: 245 SEYSVSVPENIPVGTRLLMLTATDPDEGINGKLTYSFR-NEEEKISETFQLDSNLGEIST 303

Query: 307 REMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENID 366
            . ..||. . | ||..| | |   |    || . | |.||| ||. . |  . ..|.  
Sbjct: 304 LQSLDYEESRFYLMEVVAQDGGA--LVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCL 361

Query: 367 VDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDIT 426
             ||||. || | |||.|| .   || |.|||| .| |||| |. .  ||||.  .|.||
Sbjct: 362 PGTVIALFSVHDGDSGENGEIACSIPRNLPFKLEKSVDNYYHLLTTRDLDREETSDYNIT 421

Query: 427 FTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDL 486
            || | |.||||    . |.. |.||| |.|||. |.  |||||  |  . |.|| ||| 
Sbjct: 422 LTVMDHGTPPLSTESHIPLKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDS 481

Query: 487 HENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPP 546
            .|  . | . |       .|   ||| . | ||||..||||  ..    . | |||.||
Sbjct: 482 GDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP 541

Query: 547 LSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERN 605
           ||||||. . ..||||| | |. |     ||   |  ||| . | || ||.|    | .|
Sbjct: 542 LSSNVSLSLFVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQN 601

Query: 606 STIADSTLVSND--AYWYSLFLAETRKGKLVVRQPVPKGS 643
           . ..   | ...   .   |   | |  . .. .   | |
Sbjct: 602 AWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003lju
        |5|NM_018918|Q9Y5G8|PCDG5_HUMAN|PCDHGA5|NM_018918|NP_061741|protocadher
        in gamma subfamily A, 5 isoform 1

          Length = 931

 Score =  475 bits (1221), Expect = 1e-133
 Identities = 261/640 (40%), Positives = 385/640 (60%), Gaps = 11/640 (1%)

Query:  10 GGRCNCLLLLFSVIATAV---VAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRV 66
           |  |  ||| | .. |          ||.|||...|| | |.| ||||. . |  | .|.
Sbjct:   7 GWGCGELLLPFMLLGTLCEPGSGQIRYSMPEELDKGSFVGNIAKDLGLEPQELAERGVRI 66

Query:  67 DVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIM 126
              |  .   .|  .| |    ||||| ||    .  | .  .  .|| .... .||||.
Sbjct:  67 VSRGRTQLFALNPRSGSLVTAGRIDREELC--AQSPLCVVNFNILVENKMKIYGVEVEII 124

Query: 127 DINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQT 186
           ||||| | ||   . . ..|... | |  |  | | ||| ||.. | ||.. |||... .
Sbjct: 125 DINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDADVGVNSLRSYQLSSNLHFSLDVVS 184

Query: 187 GRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGK 246
           | || |. .|.| . |||| . ||.|.|||.||| |  .||  | | ||| ||||| |  
Sbjct: 185 GTDGQKYPELVLEQPLDREKETVHDLLLTALDGGDPVLSGTTHIRVTVLDANDNAPLFTP 244

Query: 247 DKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRV 306
            .| | | || |.|. .. | ||| ||| |  . ||.     |.  . | |..  |||  
Sbjct: 245 SEYSVSVPENIPVGTRLLMLTATDPDEGINGKLTYSFR-NEEEKISETFQLDSNLGEIST 303

Query: 307 REMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENID 366
            . ..||. . | ||..| | |   |    || . | |.||| ||. . |  . ..|.  
Sbjct: 304 LQSLDYEESRFYLMEVVAQDGGA--LVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCL 361

Query: 367 VDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDIT 426
             ||||. || | |||.|| .   || |.|||| .| |||| |. .  ||||.  .|.||
Sbjct: 362 PGTVIALFSVHDGDSGENGEIACSIPRNLPFKLEKSVDNYYHLLTTRDLDREETSDYNIT 421

Query: 427 FTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDL 486
            || | |.||||    . |.. |.||| |.|||. |.  |||||  |  . |.|| ||| 
Sbjct: 422 LTVMDHGTPPLSTESHIPLKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDS 481

Query: 487 HENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPP 546
            .|  . | . |       .|   ||| . | ||||..||||  ..    . | |||.||
Sbjct: 482 GDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP 541

Query: 547 LSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERN 605
           ||||||. . ..||||| | |. |     ||   |  ||| . | || ||.|    | .|
Sbjct: 542 LSSNVSLSLFVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQN 601

Query: 606 STIADSTLVSND--AYWYSLFLAETRKGKLVVRQPVPKGS 643
           . ..   | ...   .   |   | |  . .. .   | |
Sbjct: 602 AWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003lkx
        |5|NM_032406|Q9Y5F7-2|Q9Y5F7-2|PCDHGC4|NM_032406|NP_115782|protocadheri
        n gamma subfamily C, 4 isoform 2

          Length = 871

 Score =  475 bits (1221), Expect = 1e-133
 Identities = 250/625 (40%), Positives = 381/625 (60%), Gaps = 6/625 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           || ||  .   |     | .||| .||. | |.| |  ||  .|  |...|    |... 
Sbjct:  17 LLFLFYHLG-YVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQRHF 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .. ..| | |   |||| || |  .  | . |.   | |. |.  ||||.|.||.|| |
Sbjct:  76 RVDLDSGALLIKNPIDREALCGLSAS--CIVPLEFVTEGPLEMYRAEVEIVDVNDHAPRF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
            |  . |.| |..  |.|| |  | | ||||||.  | ||..|||.....   ||.   .
Sbjct: 134 PRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKKRSDGSLVPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.| | |||| |. . |.||||||| | |.||| . | |||||||||.| .  | . |.|
Sbjct: 194 LLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           ..| | ..|.|||.| | | . .| . .| .| .| . .|.|.   |.. .   ...|  
Sbjct: 254 SAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESE 313

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             || .. | | |.  .   | . . . |.||| | |.. |    | |. .  ||.|..|
Sbjct: 314 NYYEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALIS 373

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||| || | | |||..|| |. .  | . || . |||||    |||  | .| |.|
Sbjct: 374 VQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREAKSSYDIMVTASDAGNP 433

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           ||| . |. | . |.||| | | |  . . | ||| || || || | |||   |  . | 
Sbjct: 434 PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYS 493

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           .||    . | |   |.||. | ..| ..||||  .   | ..||| |.||||| |.| .
Sbjct: 494 LLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRL 553

Query: 556 IIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
            ..| ||||| .. |    ||.  . .| |   | |. || |  . |  |. ..   | .
Sbjct: 554 FVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDSGYNAWVSYQLLEA 613

Query: 616 NDAYWYSLFLAETRKGKLVVRQPVP 640
            |    |||      |..    |.|
Sbjct: 614 PDP---SLFAVSRYAGEVRTAVPIP 635

>hg18||uc003lky
        |5|NM_018928|Q9Y5F7|PCDGL_HUMAN|PCDHGC4|NM_018928|NP_061751|protocadher
        in gamma subfamily C, 4 isoform 1

          Length = 938

 Score =  475 bits (1221), Expect = 1e-133
 Identities = 250/625 (40%), Positives = 381/625 (60%), Gaps = 6/625 (0%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           || ||  .   |     | .||| .||. | |.| |  ||  .|  |...|    |... 
Sbjct:  17 LLFLFYHLG-YVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQRHF 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .. ..| | |   |||| || |  .  | . |.   | |. |.  ||||.|.||.|| |
Sbjct:  76 RVDLDSGALLIKNPIDREALCGLSAS--CIVPLEFVTEGPLEMYRAEVEIVDVNDHAPRF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
            |  . |.| |..  |.|| |  | | ||||||.  | ||..|||.....   ||.   .
Sbjct: 134 PRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKKRSDGSLVPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.| | |||| |. . |.||||||| | |.||| . | |||||||||.| .  | . |.|
Sbjct: 194 LLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           ..| | ..|.|||.| | | . .| . .| .| .| . .|.|.   |.. .   ...|  
Sbjct: 254 SAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESE 313

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             || .. | | |.  .   | . . . |.||| | |.. |    | |. .  ||.|..|
Sbjct: 314 NYYEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALIS 373

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | | ||| || | | |||..|| |. .  | . || . |||||    |||  | .| |.|
Sbjct: 374 VQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREAKSSYDIMVTASDAGNP 433

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           ||| . |. | . |.||| | | |  . . | ||| || || || | |||   |  . | 
Sbjct: 434 PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYS 493

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           .||    . | |   |.||. | ..| ..||||  .   | ..||| |.||||| |.| .
Sbjct: 494 LLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRL 553

Query: 556 IIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
            ..| ||||| .. |    ||.  . .| |   | |. || |  . |  |. ..   | .
Sbjct: 554 FVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDSGYNAWVSYQLLEA 613

Query: 616 NDAYWYSLFLAETRKGKLVVRQPVP 640
            |    |||      |..    |.|
Sbjct: 614 PDP---SLFAVSRYAGEVRTAVPIP 635

>hg18||uc003lke
        |5|NM_032099|Q9Y5G0-2|Q9Y5G0-2|PCDHGB5|NM_032099|NP_115270|protocadheri
        n gamma subfamily B, 5 isoform 2

          Length = 818

 Score =  474 bits (1218), Expect = 2e-133
 Identities = 253/610 (41%), Positives = 378/610 (61%), Gaps = 12/610 (1%)

Query:  17 LLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLD 76
           | | |.   |.     | ||||| .|||| |||||||  |. |  ||.||     | |  
Sbjct:  19 LFLLSLFCPALCEQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVS--SEKPYFT 76

Query:  77 INKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFR 136
           .. |.||| .  |.||| .|  |    | |. .|  |||.  ... ||| ||||. | | 
Sbjct:  77 VSAESGELLVSSRLDREEICGKKPA--CALEFEAVAENPLNFYHVNVEIEDINDHTPKFT 134

Query: 137 RGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADL 196
           . .  | ||||.  | || |  | | |.| ||.. | || .  ||. |.  .||.|. .|
Sbjct: 135 QNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPEL 194

Query: 197 ILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMEN 256
            | | |||| |. | |.|||.||| |  .||  . ..| | ||| | | .| | | . ||
Sbjct: 195 ALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLREN 254

Query: 257 SPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLK 316
            | |. |....||| ||| ||.. ||.      || |||.||...|||  .. ...|. |
Sbjct: 255 VPPGTTVLQVSATDQDEGINSEITYSF-----YRTGQIFSLNSKSGEITTQKKLDFEETK 309

Query: 317 LYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSV 376
            | | .   | |   |  || | | . | ||| ||..  |    . ||    |.||.. .
Sbjct: 310 EYSMVVEGRDGGG--LVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKI 367

Query: 377 SDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPP 436
            |.|||.|| |.  .   .|||.  || | |.||    ||||. |||..| | |||| ||
Sbjct: 368 HDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPP 427

Query: 437 LSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFI 496
           || . .. | . |.||| | | |. | . | ||| ||| .. . | | ||  |  . | |
Sbjct: 428 LSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSI 487

Query: 497 LEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHII 556
           .  ..   ...   |.. ..| ..| . ||||  . |   ..||| ||| ||.|||. ..
Sbjct: 488 MASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVL 547

Query: 557 IVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
           . |.||||| .. |     || . . .||. . | || ||.|    |  |. ..   | .
Sbjct: 548 VGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQA 607

Query: 616 NDAYWYSLFL 625
           ..   .|| |
Sbjct: 608 SEPGLFSLGL 617

>hg18||uc003lkf
        |5|NM_018925|Q9Y5G0|PCDGH_HUMAN|PCDHGB5|NM_018925|NP_061748|protocadher
        in gamma subfamily B, 5 isoform 1

          Length = 923

 Score =  474 bits (1218), Expect = 2e-133
 Identities = 253/610 (41%), Positives = 378/610 (61%), Gaps = 12/610 (1%)

Query:  17 LLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLD 76
           | | |.   |.     | ||||| .|||| |||||||  |. |  ||.||     | |  
Sbjct:  19 LFLLSLFCPALCEQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVS--SEKPYFT 76

Query:  77 INKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFR 136
           .. |.||| .  |.||| .|  |    | |. .|  |||.  ... ||| ||||. | | 
Sbjct:  77 VSAESGELLVSSRLDREEICGKKPA--CALEFEAVAENPLNFYHVNVEIEDINDHTPKFT 134

Query: 137 RGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADL 196
           . .  | ||||.  | || |  | | |.| ||.. | || .  ||. |.  .||.|. .|
Sbjct: 135 QNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPEL 194

Query: 197 ILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMEN 256
            | | |||| |. | |.|||.||| |  .||  . ..| | ||| | | .| | | . ||
Sbjct: 195 ALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLREN 254

Query: 257 SPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLK 316
            | |. |....||| ||| ||.. ||.      || |||.||...|||  .. ...|. |
Sbjct: 255 VPPGTTVLQVSATDQDEGINSEITYSF-----YRTGQIFSLNSKSGEITTQKKLDFEETK 309

Query: 317 LYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSV 376
            | | .   | |   |  || | | . | ||| ||..  |    . ||    |.||.. .
Sbjct: 310 EYSMVVEGRDGGG--LVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKI 367

Query: 377 SDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPP 436
            |.|||.|| |.  .   .|||.  || | |.||    ||||. |||..| | |||| ||
Sbjct: 368 HDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPP 427

Query: 437 LSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFI 496
           || . .. | . |.||| | | |. | . | ||| ||| .. . | | ||  |  . | |
Sbjct: 428 LSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSI 487

Query: 497 LEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHII 556
           .  ..   ...   |.. ..| ..| . ||||  . |   ..||| ||| ||.|||. ..
Sbjct: 488 MASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVL 547

Query: 557 IVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
           . |.||||| .. |     || . . .||. . | || ||.|    |  |. ..   | .
Sbjct: 548 VGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQA 607

Query: 616 NDAYWYSLFL 625
           ..   .|| |
Sbjct: 608 SEPGLFSLGL 617

>hg18||uc003ljh
        |5|NM_031993|Q9Y5H4-2|Q9Y5H4-2|PCDHGA1|NM_031993|NP_114382|protocadheri
        n gamma subfamily A, 1 isoform 2

          Length = 823

 Score =  473 bits (1217), Expect = 3e-133
 Identities = 264/644 (40%), Positives = 387/644 (60%), Gaps = 8/644 (1%)

Query:   3 LQVRLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGR 62
           .| .|.   |   | |   ..  |     |||.||| ..|| | |.| ||||  . |   
Sbjct:   3 IQKKLTGCSRLMLLCLSLELLLEAGAGNIHYSVPEETDKGSFVGNIAKDLGLQPQELADG 62

Query:  63 KMRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIE 122
            .|.   |      .|  .| |    ||||| ||    .  | .  .  .|. ...| .|
Sbjct:  63 GVRIVSRGRMPLFALNPRSGSLITARRIDREELC--AQSMPCLVSFNILVEDKMKLFPVE 120

Query: 123 VEIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSI 182
           |||.||||| | |.   .   ..| .. | | ||    | ||| ||.. | ||.. |||.
Sbjct: 121 VEIIDINDNTPQFQLEELEFKMNEITTPGTRVSLPFGQDLDVGMNSLQSYQLSSNPHFSL 180

Query: 183 NIQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAP 242
           ..| | || .  ...|   |||| .|||.||||| ||| | |.||  | ..|.| ||| |
Sbjct: 181 DVQQGADGPQHPEMVLQSPLDREEEAVHHLILTASDGGEPVRSGTLRIYIQVVDANDNPP 240

Query: 243 SFGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENG 302
           .| . .| ..| || |.|. .. .|||| |||.| .| ||.      |  ||| |..  |
Sbjct: 241 AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFH-NVDHRVAQIFRLDSYTG 299

Query: 303 EIRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLN 362
           ||  .| ...|. |.| ||. | | |  |.  . || |.| |.||| ||..| |  | . 
Sbjct: 300 EISNKEPLDFEEYKMYSMEVQAQD-GAGLM-AKVKVLIKVLDVNDNAPEVTITSVTTAVP 357

Query: 363 ENIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPE 422
           ||    |.||..|| |.||||||     || |.|||| .  |||| ||    |||| .  
Sbjct: 358 ENFPPGTIIALISVHDQDSGDNGYTTCFIPGNLPFKLEKLVDNYYRLVTERTLDRELISG 417

Query: 423 YDITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAF 482
           |.|| |  |.|.| ||    ..| . ||||| | | |  |.  . |||  || . |. | 
Sbjct: 418 YNITITAIDQGTPALSTETHISLLVTDINDNSPVFHQDSYSAYIPENNPRGASIFSVRAH 477

Query: 483 DPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDS 542
           | | .||  . | ..|  |    .|   ||| . | ||||..||||  ..    . ||||
Sbjct: 478 DLDSNENAQITYSLIEDTIQGAPLSAYLSINSDTGVLYALRSFDYEQFRDMQLKVMARDS 537

Query: 543 GSPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVI 601
           | ||||||||. . ..||||||| |. |     ||   |  | | . | || ||.|    
Sbjct: 538 GDPPLSSNVSLSLFLLDQNDNAPEILYPALPTDGSTGVELAPLSAEPGYLVTKVVAVDRD 597

Query: 602 SERNSTIADSTLVSNDAYWYS--LFLAETRKGKLVVRQPVPKGS 643
           | .|. ..   | ...   .|  |   | |  . .. .   | |
Sbjct: 598 SGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003lji
        |5|NM_018912|Q9Y5H4|PCDG1_HUMAN|PCDHGA1|NM_018912|NP_061735|protocadher
        in gamma subfamily A, 1 isoform 1

          Length = 931

 Score =  473 bits (1217), Expect = 3e-133
 Identities = 264/644 (40%), Positives = 387/644 (60%), Gaps = 8/644 (1%)

Query:   3 LQVRLSCGGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGR 62
           .| .|.   |   | |   ..  |     |||.||| ..|| | |.| ||||  . |   
Sbjct:   3 IQKKLTGCSRLMLLCLSLELLLEAGAGNIHYSVPEETDKGSFVGNIAKDLGLQPQELADG 62

Query:  63 KMRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIE 122
            .|.   |      .|  .| |    ||||| ||    .  | .  .  .|. ...| .|
Sbjct:  63 GVRIVSRGRMPLFALNPRSGSLITARRIDREELC--AQSMPCLVSFNILVEDKMKLFPVE 120

Query: 123 VEIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSI 182
           |||.||||| | |.   .   ..| .. | | ||    | ||| ||.. | ||.. |||.
Sbjct: 121 VEIIDINDNTPQFQLEELEFKMNEITTPGTRVSLPFGQDLDVGMNSLQSYQLSSNPHFSL 180

Query: 183 NIQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAP 242
           ..| | || .  ...|   |||| .|||.||||| ||| | |.||  | ..|.| ||| |
Sbjct: 181 DVQQGADGPQHPEMVLQSPLDREEEAVHHLILTASDGGEPVRSGTLRIYIQVVDANDNPP 240

Query: 243 SFGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENG 302
           .| . .| ..| || |.|. .. .|||| |||.| .| ||.      |  ||| |..  |
Sbjct: 241 AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFH-NVDHRVAQIFRLDSYTG 299

Query: 303 EIRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLN 362
           ||  .| ...|. |.| ||. | | |  |.  . || |.| |.||| ||..| |  | . 
Sbjct: 300 EISNKEPLDFEEYKMYSMEVQAQD-GAGLM-AKVKVLIKVLDVNDNAPEVTITSVTTAVP 357

Query: 363 ENIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPE 422
           ||    |.||..|| |.||||||     || |.|||| .  |||| ||    |||| .  
Sbjct: 358 ENFPPGTIIALISVHDQDSGDNGYTTCFIPGNLPFKLEKLVDNYYRLVTERTLDRELISG 417

Query: 423 YDITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAF 482
           |.|| |  |.|.| ||    ..| . ||||| | | |  |.  . |||  || . |. | 
Sbjct: 418 YNITITAIDQGTPALSTETHISLLVTDINDNSPVFHQDSYSAYIPENNPRGASIFSVRAH 477

Query: 483 DPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDS 542
           | | .||  . | ..|  |    .|   ||| . | ||||..||||  ..    . ||||
Sbjct: 478 DLDSNENAQITYSLIEDTIQGAPLSAYLSINSDTGVLYALRSFDYEQFRDMQLKVMARDS 537

Query: 543 GSPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVI 601
           | ||||||||. . ..||||||| |. |     ||   |  | | . | || ||.|    
Sbjct: 538 GDPPLSSNVSLSLFLLDQNDNAPEILYPALPTDGSTGVELAPLSAEPGYLVTKVVAVDRD 597

Query: 602 SERNSTIADSTLVSNDAYWYS--LFLAETRKGKLVVRQPVPKGS 643
           | .|. ..   | ...   .|  |   | |  . .. .   | |
Sbjct: 598 SGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003ljv
        |5|NM_032097|Q9Y5G1-2|Q9Y5G1-2|PCDHGB3|NM_032097|NP_115268|protocadheri
        n gamma subfamily B, 3 isoform 2

          Length = 814

 Score =  473 bits (1216), Expect = 4e-133
 Identities = 248/617 (40%), Positives = 384/617 (62%), Gaps = 8/617 (1%)

Query:  10 GGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVV 69
           | |    | | |..   .     |.||||.. ||.| ||| |||  |  |  | .|  |.
Sbjct:  12 GQRRMLFLFLLSLLDQVLSEPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLR--VI 69

Query:  70 GNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIN 129
             ||.  .. | | | . .||||| .|  |.|  | |. .   | |.  |.. | | |||
Sbjct:  70 AEKKFFTVSPENGNLLVSDRIDREEICGKKST--CVLEFEMVAEKPLNFFHVTVLIQDIN 127

Query: 130 DNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRD 189
           || | | .    |.||| .  |  |.| .| ||||| ||.. |.||   |||.  .   |
Sbjct: 128 DNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLD 187

Query: 190 GTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKY 249
           |... .|.|   |||| |  |.|.||||||| |.|. |  | | | | ||| | | .| |
Sbjct: 188 GSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMY 247

Query: 250 VVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREM 309
            |.| || | || |.|. | |.||| |....|.. .   .  .|.| |... ||.     
Sbjct: 248 RVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAF-INIGKEVRQLFKLDSKTGELTTIGE 306

Query: 310 INYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDT 369
           ...|.   | . . | | | .  |  ||| | ..| ||| |||.. |    . |. .. |
Sbjct: 307 LDFEERDSYTIGVEAKDGGHH--TAYCKVQIDISDENDNAPEITLASESQHIQEDAELGT 364

Query: 370 VIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTV 429
            .|..   | ||| || .   .  | |||. | . | | ||    ||||..|||..| | 
Sbjct: 365 AVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITA 424

Query: 430 TDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHEN 489
           ||.|.|||| ..|.|| .||.||||| | |. ||. | ||| ||| .. . | ||||  |
Sbjct: 425 TDKGNPPLSSSKTITLHILDVNDNVPVFHQASYTVHVAENNPPGASIAHVRASDPDLGPN 484

Query: 490 QYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSS 549
             . |.|.  ..    .|   |..  .| ..| . ||.|  . |   ..||| ||| ||.
Sbjct: 485 GLVSYYIVASDLEPRELSSYVSVSARSGVVFAQRAFDHEQLRAFELTLQARDQGSPTLSA 544

Query: 550 NVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTI 608
           |||. ... |.|||||... |    .|| . . .||| . | || ||.|    |  |. .
Sbjct: 545 NVSLRVLVDDRNDNAPLVLYPALGPEGSALFDMVPRSAEPGYLVTKVVAVDADSGYNAWL 604

Query: 609 ADSTLVSNDAYWYSLFL 625
           .   . ...   .|| |
Sbjct: 605 SYHIVQASEPGLFSLGL 621

>hg18||uc003ljw
        |5|NM_018924|Q9Y5G1|PCDGF_HUMAN|PCDHGB3|NM_018924|NP_061747|protocadher
        in gamma subfamily B, 3 isoform 1

          Length = 929

 Score =  473 bits (1216), Expect = 4e-133
 Identities = 248/617 (40%), Positives = 384/617 (62%), Gaps = 8/617 (1%)

Query:  10 GGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVV 69
           | |    | | |..   .     |.||||.. ||.| ||| |||  |  |  | .|  |.
Sbjct:  12 GQRRMLFLFLLSLLDQVLSEPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLR--VI 69

Query:  70 GNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIN 129
             ||.  .. | | | . .||||| .|  |.|  | |. .   | |.  |.. | | |||
Sbjct:  70 AEKKFFTVSPENGNLLVSDRIDREEICGKKST--CVLEFEMVAEKPLNFFHVTVLIQDIN 127

Query: 130 DNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRD 189
           || | | .    |.||| .  |  |.| .| ||||| ||.. |.||   |||.  .   |
Sbjct: 128 DNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLD 187

Query: 190 GTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKY 249
           |... .|.|   |||| |  |.|.||||||| |.|. |  | | | | ||| | | .| |
Sbjct: 188 GSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMY 247

Query: 250 VVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREM 309
            |.| || | || |.|. | |.||| |....|.. .   .  .|.| |... ||.     
Sbjct: 248 RVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAF-INIGKEVRQLFKLDSKTGELTTIGE 306

Query: 310 INYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDT 369
           ...|.   | . . | | | .  |  ||| | ..| ||| |||.. |    . |. .. |
Sbjct: 307 LDFEERDSYTIGVEAKDGGHH--TAYCKVQIDISDENDNAPEITLASESQHIQEDAELGT 364

Query: 370 VIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTV 429
            .|..   | ||| || .   .  | |||. | . | | ||    ||||..|||..| | 
Sbjct: 365 AVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITA 424

Query: 430 TDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHEN 489
           ||.|.|||| ..|.|| .||.||||| | |. ||. | ||| ||| .. . | ||||  |
Sbjct: 425 TDKGNPPLSSSKTITLHILDVNDNVPVFHQASYTVHVAENNPPGASIAHVRASDPDLGPN 484

Query: 490 QYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSS 549
             . |.|.  ..    .|   |..  .| ..| . ||.|  . |   ..||| ||| ||.
Sbjct: 485 GLVSYYIVASDLEPRELSSYVSVSARSGVVFAQRAFDHEQLRAFELTLQARDQGSPTLSA 544

Query: 550 NVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTI 608
           |||. ... |.|||||... |    .|| . . .||| . | || ||.|    |  |. .
Sbjct: 545 NVSLRVLVDDRNDNAPLVLYPALGPEGSALFDMVPRSAEPGYLVTKVVAVDADSGYNAWL 604

Query: 609 ADSTLVSNDAYWYSLFL 625
           .   . ...   .|| |
Sbjct: 605 SYHIVQASEPGLFSLGL 621

>hg18||uc003lkg
        |5|NM_032089|Q9Y5G4-2|Q9Y5G4-2|PCDHGA9|NM_032089|NP_114478|protocadheri
        n gamma subfamily A, 9 isoform 2

          Length = 828

 Score =  473 bits (1216), Expect = 4e-133
 Identities = 262/636 (41%), Positives = 380/636 (59%), Gaps = 8/636 (1%)

Query:  11 GRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG 70
           ||   |  |  ..  |  .   ||.||| |.| .| |.. || |. . |  |..|.   |
Sbjct:  11 GRLVLLCSLLGMLWEARASQIRYSVPEETEKGYIVGNISKDLALEPRELAERRVRIVSRG 70

Query:  71 NKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIND 130
             .   .|  .| |    ||||| ||    .  | .     .|. .... ||.|. ||||
Sbjct:  71 RTQLFSLNPRSGTLVTAGRIDREELC--AQSPRCLVNFKVLVEDRVKLYGIEIEVTDIND 128

Query: 131 NAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDG 190
           .|| |.  .. . |.| .  | |. |  | ||||| ||.. | || . |||.|.||| .|
Sbjct: 129 SAPKFQAESLEVKINEIAVPGARYPLPEAIDPDVGVNSLQSYQLSPNHHFSLNVQTGDNG 188

Query: 191 TKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYV 250
               .|.| .|||||    |.|.||| ||| | |. |  | | ||| ||||| | .  | 
Sbjct: 189 AINPELVLERALDREEATAHHLVLTASDGGEPRRSSTVRIHVTVLDTNDNAPVFAQRIYR 248

Query: 251 VDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMI 310
           | |.|| | |. ..   |.||||| |  | | .    .|.   .| ||   |||   . .
Sbjct: 249 VKVLENVPPGTWLLTATASDLDEGINGKVAYKF-WKINEKQSLLFQLNENTGEISTAKSL 307

Query: 311 NYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTV 370
           .||.   ||||| | | |   | |  || | | |.||| ||..| |  .|. |.    ||
Sbjct: 308 DYEECSFYEMEIQAEDGGG--LKGWTKVLISVEDVNDNRPEVTITSLFSPVREDAPQGTV 365

Query: 371 IAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVT 430
           | . .  |.||| || |   | .|. | |  | ..|| |. .. |||||  ||.|| | |
Sbjct: 366 ILLFNAHDRDSGKNGQVVCSIQENLSFTLENSEEDYYRLLTAQILDREKASEYNITVTAT 425

Query: 431 DRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQ 490
           |||.||||    .||.. ||||| | | |. |.. . |||| |  . |. |.||| .|| 
Sbjct: 426 DRGTPPLSTEIHITLQVTDINDNPPAFSQASYSVYLPENNARGTSIFSVIAYDPDSNENS 485

Query: 491 YLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSN 550
            ..| . |  |  . .|   ||| . | |||| .||||  ..    . | ||||||||||
Sbjct: 486 RVIYSLAEDTIQGSPLSTYVSINSDTGVLYALCSFDYEQFRDLQMQVTASDSGSPPLSSN 545

Query: 551 VSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIA 609
           ||. . ..||||||| |. |     ||   |  ||| . | || ||.|    | .|. ..
Sbjct: 546 VSLRLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLS 605

Query: 610 DSTLVSNDAYWYS--LFLAETRKGKLVVRQPVPKGS 643
                ...   .|  |   | |  . .. .   | |
Sbjct: 606 YRLFKASEPGLFSVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003lkh
        |5|NM_018921|Q9Y5G4|PCDG9_HUMAN|PCDHGA9|NM_018921|NP_061744|protocadher
        in gamma subfamily A, 9 isoform 1

          Length = 932

 Score =  473 bits (1216), Expect = 4e-133
 Identities = 262/636 (41%), Positives = 380/636 (59%), Gaps = 8/636 (1%)

Query:  11 GRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVG 70
           ||   |  |  ..  |  .   ||.||| |.| .| |.. || |. . |  |..|.   |
Sbjct:  11 GRLVLLCSLLGMLWEARASQIRYSVPEETEKGYIVGNISKDLALEPRELAERRVRIVSRG 70

Query:  71 NKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIND 130
             .   .|  .| |    ||||| ||    .  | .     .|. .... ||.|. ||||
Sbjct:  71 RTQLFSLNPRSGTLVTAGRIDREELC--AQSPRCLVNFKVLVEDRVKLYGIEIEVTDIND 128

Query: 131 NAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDG 190
           .|| |.  .. . |.| .  | |. |  | ||||| ||.. | || . |||.|.||| .|
Sbjct: 129 SAPKFQAESLEVKINEIAVPGARYPLPEAIDPDVGVNSLQSYQLSPNHHFSLNVQTGDNG 188

Query: 191 TKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYV 250
               .|.| .|||||    |.|.||| ||| | |. |  | | ||| ||||| | .  | 
Sbjct: 189 AINPELVLERALDREEATAHHLVLTASDGGEPRRSSTVRIHVTVLDTNDNAPVFAQRIYR 248

Query: 251 VDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMI 310
           | |.|| | |. ..   |.||||| |  | | .    .|.   .| ||   |||   . .
Sbjct: 249 VKVLENVPPGTWLLTATASDLDEGINGKVAYKF-WKINEKQSLLFQLNENTGEISTAKSL 307

Query: 311 NYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTV 370
           .||.   ||||| | | |   | |  || | | |.||| ||..| |  .|. |.    ||
Sbjct: 308 DYEECSFYEMEIQAEDGGG--LKGWTKVLISVEDVNDNRPEVTITSLFSPVREDAPQGTV 365

Query: 371 IAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVT 430
           | . .  |.||| || |   | .|. | |  | ..|| |. .. |||||  ||.|| | |
Sbjct: 366 ILLFNAHDRDSGKNGQVVCSIQENLSFTLENSEEDYYRLLTAQILDREKASEYNITVTAT 425

Query: 431 DRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQ 490
           |||.||||    .||.. ||||| | | |. |.. . |||| |  . |. |.||| .|| 
Sbjct: 426 DRGTPPLSTEIHITLQVTDINDNPPAFSQASYSVYLPENNARGTSIFSVIAYDPDSNENS 485

Query: 491 YLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSN 550
            ..| . |  |  . .|   ||| . | |||| .||||  ..    . | ||||||||||
Sbjct: 486 RVIYSLAEDTIQGSPLSTYVSINSDTGVLYALCSFDYEQFRDLQMQVTASDSGSPPLSSN 545

Query: 551 VSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIA 609
           ||. . ..||||||| |. |     ||   |  ||| . | || ||.|    | .|. ..
Sbjct: 546 VSLRLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLS 605

Query: 610 DSTLVSNDAYWYS--LFLAETRKGKLVVRQPVPKGS 643
                ...   .|  |   | |  . .. .   | |
Sbjct: 606 YRLFKASEPGLFSVGLHTGEVRTARALLDRDALKQS 641

>hg18||uc003lhe
        |5|NM_031497|Q9Y5H8-2|Q9Y5H8-2|PCDHA3|NM_031497|NP_113685|protocadherin
        alpha 3 isoform 2 precursor

          Length = 824

 Score =  470 bits (1209), Expect = 3e-132
 Identities = 245/601 (40%), Positives = 373/601 (62%), Gaps = 3/601 (0%)

Query:  10 GGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVV 69
           | .|  | ||    .       |||. || . |. |  .| ||||..  |  |  ||   
Sbjct:  10 GAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELVPRLFRVASK 69

Query:  70 GNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIN 129
            .   |..| . | ||.  ||||| ||    .  | . |.  .. |...|..|||. |||
Sbjct:  70 RHGDLLEVNLQNGILFVNSRIDREELC--GRSAECSIHLEVIVDRPLQVFHVEVEVKDIN 127

Query: 130 DNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRD 189
           |||| |     .| ||||   | ||||  |.| |.|.||.  | | ..|.|.....   .
Sbjct: 128 DNAPVFPMAVKNLFISESRQPGSRFSLEGASDADIGTNSLLTYSLDSTEYFTLDVKRNDE 187

Query: 190 GTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKY 249
             |   |.| | |.||    | |..||.||| |  |||  . . |||||||||.| .  |
Sbjct: 188 EIKSLGLVLKKNLNREDTPKHYLLITAIDGGKPELTGTTQLKITVLDVNDNAPAFERTIY 247

Query: 250 VVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREM 309
            | ..||.| |.||. .|||||||| | |. ||..   |      |.|.  ||.| |.  
Sbjct: 248 KVRLLENAPNGTLVVTVNATDLDEGVNKDIAYSFNTDMSADILSKFHLDPVNGQISVKGN 307

Query: 310 INYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDT 369
           |..|. | ||... |.|||   ..  | | ... |.||| ||. |.|   |. |.  . |
Sbjct: 308 IDFEESKSYEIQVEATDKGNPPMSDHCTVLLEIVDINDNVPELVIQSLSLPVLEDSPLST 367

Query: 370 VIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTV 429
           |||..||||.||| || |   .  ..||||  .  ||| ||.  ||||| |  |..  | 
Sbjct: 368 VIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSPLDRESVSAYELVVTA 427

Query: 430 TDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHEN 489
            | ||| |    ....|. |.||| | | || ||. | ||| ||  . ...| | |  ||
Sbjct: 428 RDGGSPSLWATASVSVEVADVNDNAPAFSQSEYTVFVKENNPPGCHIFTVSARDADAQEN 487

Query: 490 QYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSS 549
             . | ..|. .   ..|   |.. |.| .|||.  |.|  .   | . |||.| ||| |
Sbjct: 488 ALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGS 547

Query: 550 NVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTI 608
           ||.. . ..|.||||| .. |     |  | | .|||   | .|||| |    |  |. .
Sbjct: 548 NVTLQVFVLDENDNAPALLMPRVGGIGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWL 607

Query: 609 A 609
           .
Sbjct: 608 S 608

>hg18||uc003lhf
        |5|NM_018906|Q9Y5H8|PCDA3_HUMAN|PCDHA3|NM_018906|NP_061729|protocadheri
        n alpha 3 isoform 1 precursor

          Length = 950

 Score =  470 bits (1209), Expect = 3e-132
 Identities = 245/601 (40%), Positives = 373/601 (62%), Gaps = 3/601 (0%)

Query:  10 GGRCNCLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVV 69
           | .|  | ||    .       |||. || . |. |  .| ||||..  |  |  ||   
Sbjct:  10 GAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELVPRLFRVASK 69

Query:  70 GNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDIN 129
            .   |..| . | ||.  ||||| ||    .  | . |.  .. |...|..|||. |||
Sbjct:  70 RHGDLLEVNLQNGILFVNSRIDREELC--GRSAECSIHLEVIVDRPLQVFHVEVEVKDIN 127

Query: 130 DNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRD 189
           |||| |     .| ||||   | ||||  |.| |.|.||.  | | ..|.|.....   .
Sbjct: 128 DNAPVFPMAVKNLFISESRQPGSRFSLEGASDADIGTNSLLTYSLDSTEYFTLDVKRNDE 187

Query: 190 GTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKY 249
             |   |.| | |.||    | |..||.||| |  |||  . . |||||||||.| .  |
Sbjct: 188 EIKSLGLVLKKNLNREDTPKHYLLITAIDGGKPELTGTTQLKITVLDVNDNAPAFERTIY 247

Query: 250 VVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREM 309
            | ..||.| |.||. .|||||||| | |. ||..   |      |.|.  ||.| |.  
Sbjct: 248 KVRLLENAPNGTLVVTVNATDLDEGVNKDIAYSFNTDMSADILSKFHLDPVNGQISVKGN 307

Query: 310 INYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDT 369
           |..|. | ||... |.|||   ..  | | ... |.||| ||. |.|   |. |.  . |
Sbjct: 308 IDFEESKSYEIQVEATDKGNPPMSDHCTVLLEIVDINDNVPELVIQSLSLPVLEDSPLST 367

Query: 370 VIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTV 429
           |||..||||.||| || |   .  ..||||  .  ||| ||.  ||||| |  |..  | 
Sbjct: 368 VIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSPLDRESVSAYELVVTA 427

Query: 430 TDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHEN 489
            | ||| |    ....|. |.||| | | || ||. | ||| ||  . ...| | |  ||
Sbjct: 428 RDGGSPSLWATASVSVEVADVNDNAPAFSQSEYTVFVKENNPPGCHIFTVSARDADAQEN 487

Query: 490 QYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSS 549
             . | ..|. .   ..|   |.. |.| .|||.  |.|  .   | . |||.| ||| |
Sbjct: 488 ALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGS 547

Query: 550 NVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTI 608
           ||.. . ..|.||||| .. |     |  | | .|||   | .|||| |    |  |. .
Sbjct: 548 NVTLQVFVLDENDNAPALLMPRVGGIGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWL 607

Query: 609 A 609
           .
Sbjct: 608 S 608

>hg18||uc003lhj
        |5|NM_031501|Q9Y5H7-2|Q9Y5H7-2|PCDHA5|NM_031501|NP_113689|protocadherin
        alpha 5 isoform 2 precursor

          Length = 816

 Score =  470 bits (1207), Expect = 5e-132
 Identities = 249/595 (41%), Positives = 365/595 (61%), Gaps = 8/595 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIA--TAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRK 63
           | | | |   ||||. ..|   |     ||||||| . |. |  .| ||||..  |  | 
Sbjct:   6 RGSLGSR---LLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELAELVPRL 62

Query:  64 MRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEV 123
            ||   |    |..| . | ||.  ||||| ||  .    | . |.  .. |...|..||
Sbjct:  63 FRVASKGRGDLLEVNLQNGILFVNSRIDREELC--RRRAECSIHLEVIVDRPLQVFHVEV 120

Query: 124 EIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSIN 183
            . ||||| | | |    | | ||     || |  |.| |.|.|.   | |. .|.| ..
Sbjct: 121 AVKDINDNPPRFSRQEQRLFILESRMPDSRFPLEGASDLDIGANAQLRYRLNPNEYFDLD 180

Query: 184 IQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPS 243
           ..|  . | | .|.| |.||||    | |.. | ||| |  |||  ... ||| ||||| 
Sbjct: 181 VKTNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPE 240

Query: 244 FGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGE 303
           | |  | | ..||.| |.|||||||.| ||| | ..|| .|    .  .  | .|.  ||
Sbjct: 241 FDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVKSKFIINSNTGE 300

Query: 304 IRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNE 363
           |.|   ..|||   ||. | | || |  |.| ||| ... |.||| ||..| .   |. |
Sbjct: 301 IKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTPEMAITTLFLPVKE 360

Query: 364 NIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEY 423
           .  . ||||..||||.||| || |   .  ..||||  .  ||| ||.   |||| |  |
Sbjct: 361 DAPLSTVIALISVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESVSVY 420

Query: 424 DITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFD 483
           ..  |  | ||| |    ....|. |.||| | | |  ||. | ||| ||  . ...| |
Sbjct: 421 ELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPQYTVFVKENNPPGCHIFTVSARD 480

Query: 484 PDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSG 543
            |  ||  . | ..|. .    .|   |.. |.| .|||.  |.|  .   | . |||.|
Sbjct: 481 ADAQENALVSYSLVERRVGERPLSSYVSVHAESGKVYALQPLDHEEVELLQFQVSARDAG 540

Query: 544 SPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIA 597
            ||| |||.. . ..|.||||| .. |     |  | | .|||   | .|||| |
Sbjct: 541 VPPLGSNVTLQVFVLDENDNAPALLVPRVGGTGGAVSELVPRSVGAGHVVAKVRA 595

>hg18||uc003lhk
        |5|BC033735|Q9Y5H7-3|Q9Y5H7-3|PCDHA5|NM_018908|NP_061731|protocadherin
        alpha 5 isoform 1 precursor

          Length = 890

 Score =  470 bits (1207), Expect = 5e-132
 Identities = 249/595 (41%), Positives = 365/595 (61%), Gaps = 8/595 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIA--TAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRK 63
           | | | |   ||||. ..|   |     ||||||| . |. |  .| ||||..  |  | 
Sbjct:   6 RGSLGSR---LLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELAELVPRL 62

Query:  64 MRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEV 123
            ||   |    |..| . | ||.  ||||| ||  .    | . |.  .. |...|..||
Sbjct:  63 FRVASKGRGDLLEVNLQNGILFVNSRIDREELC--RRRAECSIHLEVIVDRPLQVFHVEV 120

Query: 124 EIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSIN 183
            . ||||| | | |    | | ||     || |  |.| |.|.|.   | |. .|.| ..
Sbjct: 121 AVKDINDNPPRFSRQEQRLFILESRMPDSRFPLEGASDLDIGANAQLRYRLNPNEYFDLD 180

Query: 184 IQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPS 243
           ..|  . | | .|.| |.||||    | |.. | ||| |  |||  ... ||| ||||| 
Sbjct: 181 VKTNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPE 240

Query: 244 FGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGE 303
           | |  | | ..||.| |.|||||||.| ||| | ..|| .|    .  .  | .|.  ||
Sbjct: 241 FDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVKSKFIINSNTGE 300

Query: 304 IRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNE 363
           |.|   ..|||   ||. | | || |  |.| ||| ... |.||| ||..| .   |. |
Sbjct: 301 IKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTPEMAITTLFLPVKE 360

Query: 364 NIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEY 423
           .  . ||||..||||.||| || |   .  ..||||  .  ||| ||.   |||| |  |
Sbjct: 361 DAPLSTVIALISVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESVSVY 420

Query: 424 DITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFD 483
           ..  |  | ||| |    ....|. |.||| | | |  ||. | ||| ||  . ...| |
Sbjct: 421 ELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPQYTVFVKENNPPGCHIFTVSARD 480

Query: 484 PDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSG 543
            |  ||  . | ..|. .    .|   |.. |.| .|||.  |.|  .   | . |||.|
Sbjct: 481 ADAQENALVSYSLVERRVGERPLSSYVSVHAESGKVYALQPLDHEEVELLQFQVSARDAG 540

Query: 544 SPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIA 597
            ||| |||.. . ..|.||||| .. |     |  | | .|||   | .|||| |
Sbjct: 541 VPPLGSNVTLQVFVLDENDNAPALLVPRVGGTGGAVSELVPRSVGAGHVVAKVRA 595

>hg18||uc003lhl
        |5|NM_018908|Q9Y5H7|PCDA5_HUMAN|PCDHA5|NM_018908|NP_061731|protocadheri
        n alpha 5 isoform 1 precursor

          Length = 936

 Score =  470 bits (1207), Expect = 5e-132
 Identities = 249/595 (41%), Positives = 365/595 (61%), Gaps = 8/595 (1%)

Query:   6 RLSCGGRCNCLLLLFSVIA--TAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRK 63
           | | | |   ||||. ..|   |     ||||||| . |. |  .| ||||..  |  | 
Sbjct:   6 RGSLGSR---LLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELAELVPRL 62

Query:  64 MRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEV 123
            ||   |    |..| . | ||.  ||||| ||  .    | . |.  .. |...|..||
Sbjct:  63 FRVASKGRGDLLEVNLQNGILFVNSRIDREELC--RRRAECSIHLEVIVDRPLQVFHVEV 120

Query: 124 EIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSIN 183
            . ||||| | | |    | | ||     || |  |.| |.|.|.   | |. .|.| ..
Sbjct: 121 AVKDINDNPPRFSRQEQRLFILESRMPDSRFPLEGASDLDIGANAQLRYRLNPNEYFDLD 180

Query: 184 IQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPS 243
           ..|  . | | .|.| |.||||    | |.. | ||| |  |||  ... ||| ||||| 
Sbjct: 181 VKTNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPE 240

Query: 244 FGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGE 303
           | |  | | ..||.| |.|||||||.| ||| | ..|| .|    .  .  | .|.  ||
Sbjct: 241 FDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVKSKFIINSNTGE 300

Query: 304 IRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNE 363
           |.|   ..|||   ||. | | || |  |.| ||| ... |.||| ||..| .   |. |
Sbjct: 301 IKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTPEMAITTLFLPVKE 360

Query: 364 NIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEY 423
           .  . ||||..||||.||| || |   .  ..||||  .  ||| ||.   |||| |  |
Sbjct: 361 DAPLSTVIALISVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESVSVY 420

Query: 424 DITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFD 483
           ..  |  | ||| |    ....|. |.||| | | |  ||. | ||| ||  . ...| |
Sbjct: 421 ELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPQYTVFVKENNPPGCHIFTVSARD 480

Query: 484 PDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSG 543
            |  ||  . | ..|. .    .|   |.. |.| .|||.  |.|  .   | . |||.|
Sbjct: 481 ADAQENALVSYSLVERRVGERPLSSYVSVHAESGKVYALQPLDHEEVELLQFQVSARDAG 540

Query: 544 SPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIA 597
            ||| |||.. . ..|.||||| .. |     |  | | .|||   | .|||| |
Sbjct: 541 VPPLGSNVTLQVFVLDENDNAPALLVPRVGGTGGAVSELVPRSVGAGHVVAKVRA 595

>hg18||uc003lkb
        |5|NM_014004|Q9Y5G5-2|Q9Y5G5-2|PCDHGA8|NM_014004|NP_054723|protocadheri
        n gamma subfamily A, 8 isoform 2

          Length = 820

 Score =  467 bits (1201), Expect = 2e-131
 Identities = 260/614 (42%), Positives = 369/614 (60%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.||| ..|| | |.. ||||| . |    .|.   |  .   .|  .| |    ||||
Sbjct:  33 YSVPEETDKGSFVGNISKDLGLDPRKLAKHGVRIVSRGRTQLFALNPRSGSLITAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .  | . ..  .|.  ..| .|.||.||||| | |.   . . |.| .  | 
Sbjct:  93 EELC--AQSPRCLININTLVEDKGKLFGVEIEIIDINDNNPKFQVEDLEVKINEIAVPGA 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           |. |  | ||||| ||.. | || . |||...||| .|    .|.| .||||| .| |.|
Sbjct: 151 RYPLPEAVDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | |. |  | | ||| ||||| |    | | |.|| | |. .. . |.| |
Sbjct: 211 VLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || |  | | .     ..|  .| ||   ||| . . ..||.   ||||| | | |   |
Sbjct: 271 EGINGKVAYKFRKINEKQT-PLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGA--L 327

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
            |. |. | | |.||| ||. | |  .|. ||    |||| .|| |.||| || |  .  
Sbjct: 328 LGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCYTR 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
           ||.|||| .|  ||| ||  . |||| |  |.||   .| |.||||    . | . ||||
Sbjct: 388 DNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADIND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | || . |.  . |||  || . |||| |||  ||  . | . |  .    .|   ||
Sbjct: 448 NPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | ||||..||||  ..    . | ||| ||||||.|. . ..||||||| |. |  
Sbjct: 508 NSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNMSLSLFVLDQNDNAPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLAETR 629
              ||   |  ||| ..| || ||.|    | .|. ..   | ...   .|  |   | |
Sbjct: 568 PTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003lkd
        |5|NM_032088|Q9Y5G5|PCDG8_HUMAN|PCDHGA8|NM_032088|NP_114477|protocadher
        in gamma subfamily A, 8 isoform 1

          Length = 932

 Score =  467 bits (1201), Expect = 2e-131
 Identities = 260/614 (42%), Positives = 369/614 (60%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.||| ..|| | |.. ||||| . |    .|.   |  .   .|  .| |    ||||
Sbjct:  33 YSVPEETDKGSFVGNISKDLGLDPRKLAKHGVRIVSRGRTQLFALNPRSGSLITAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .  | . ..  .|.  ..| .|.||.||||| | |.   . . |.| .  | 
Sbjct:  93 EELC--AQSPRCLININTLVEDKGKLFGVEIEIIDINDNNPKFQVEDLEVKINEIAVPGA 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           |. |  | ||||| ||.. | || . |||...||| .|    .|.| .||||| .| |.|
Sbjct: 151 RYPLPEAVDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | |. |  | | ||| ||||| |    | | |.|| | |. .. . |.| |
Sbjct: 211 VLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || |  | | .     ..|  .| ||   ||| . . ..||.   ||||| | | |   |
Sbjct: 271 EGINGKVAYKFRKINEKQT-PLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGA--L 327

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
            |. |. | | |.||| ||. | |  .|. ||    |||| .|| |.||| || |  .  
Sbjct: 328 LGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCYTR 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
           ||.|||| .|  ||| ||  . |||| |  |.||   .| |.||||    . | . ||||
Sbjct: 388 DNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVADIND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | || . |.  . |||  || . |||| |||  ||  . | . |  .    .|   ||
Sbjct: 448 NPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | ||||..||||  ..    . | ||| ||||||.|. . ..||||||| |. |  
Sbjct: 508 NSDTGVLYALQSFDYEQIRDLQLLVTASDSGDPPLSSNMSLSLFVLDQNDNAPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLAETR 629
              ||   |  ||| ..| || ||.|    | .|. ..   | ...   .|  |   | |
Sbjct: 568 PTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003lje
        |5|NM_018935|Q9Y5E8|PCDBF_HUMAN|PCDHB15|NM_018935|NP_061758|protocadher
        in beta 15 precursor

          Length = 787

 Score =  465 bits (1196), Expect = 9e-131
 Identities = 262/655 (40%), Positives = 399/655 (60%), Gaps = 13/655 (1%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           .|||   .  |      ||. || | || ||||| |||| |  |  |  ||    |.. |
Sbjct:  16 ILLLLLEVTLAGWEPRRYSVMEETERGSFVANLANDLGLGVGELAERGARVVSEDNEQGL 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .. .||.| . |..||| ||    |  | .     .. |. .|  |. . ||||..| |
Sbjct:  76 QLDLQTGQLILNEKLDREKLC--GPTEPCIMHFQVLLKKPLEVFRAELLVTDINDHSPEF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
               | | | |.||.|  | |  | | |||||.|..|..| . || .. .|  || |. .
Sbjct: 134 PEREMTLKIPETSSLGTVFPLKKARDLDVGSNNVQNYNISPNSHFHVSTRTRGDGRKYPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.|   |||| ||   | ||||||| | |.||  |.. ||| ||||| | .  | | | |
Sbjct: 194 LVLDTELDREEQAELRLTLTAVDGGSPPRSGTVQILILVLDANDNAPEFVQALYEVQVPE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           |||.||||.|..| ||| |.| .. ||   |.|.   . | |.. .||||. . ...| .
Sbjct: 254 NSPVGSLVVKVSARDLDTGTNGEISYSL-YYSSQEIDKPFELSSLSGEIRLIKKLDFETM 312

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             |...| ||| |   |.|.| |...| |.||| ||.|| |  .|. ||   .| .|.  
Sbjct: 313 SSYDLDIEASDGGG--LSGKCSVSVKVLDVNDNFPELSISSLTSPIPEN-SPETEVALFR 369

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           . |.|||.|| .   | |..||||. | .|.| ||    ||||   ||.|| |.|| |.|
Sbjct: 370 IRDRDSGENGKMICSIQDDVPFKLKPSVENFYRLVTEGALDRETRAEYNITITITDLGTP 429

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
            |   ...|. . |.||| | | |. ||. | |||.|   . |..| | |   |  . | 
Sbjct: 430 RLKTEQSITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYS 489

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           .|     .  .. | ||| .||.|.||.. |||  . | | . | | | | |||   | .
Sbjct: 490 LLPPRDPHLPLTSLVSINTDNGHLFALQSLDYEALQAFEFRVGATDRGFPALSSEALVRV 549

Query: 556 IIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
           ...| |||.| .. | .   .   | .||. . | || ||.|    | .|. ..   | .
Sbjct: 550 LVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKA 609

Query: 616 NDAYWYSLFL--AETRKGKLVVRQPVPKGSRYIVSSIPRGTGMTDTSGSAPSTLQ 668
            .   . ..    | |  .|.  . | |  | .|     |    .   || .|||
Sbjct: 610 TEPGLFGVWAHNGEVRTARLLSERDVAK-HRLVVLVKDNG----EPPRSATATLQ 659

>hg18||uc003lkc
        |5|NM_003736|Q9UN71|PCDGG_HUMAN|PCDHGB4|NM_003736|NP_003727|protocadher
        in gamma subfamily B, 4 isoform 1

          Length = 923

 Score =  465 bits (1196), Expect = 9e-131
 Identities = 256/610 (41%), Positives = 377/610 (61%), Gaps = 10/610 (1%)

Query:  17 LLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLD 76
           | | |.   |.     | ||||| .|||| |||||||  |. |  ||.||     | |  
Sbjct:  19 LFLLSLFCPALCEQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVS--SEKPYFT 76

Query:  77 INKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFR 136
           .. |.||| .  |.||| .|  |    | |. .|  |||.  ... ||| ||||. | | 
Sbjct:  77 VSAESGELLVSSRLDREEICGKKPA--CALEFEAVAENPLNFYHVNVEIEDINDHTPKFT 134

Query: 137 RGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADL 196
           . .  | ||||.  | || | .| | |.|||....| || |.|||.  .   ||.|. ..
Sbjct: 135 QNSFELQISESAQPGTRFILGSAHDADIGSNTLQNYQLSPSDHFSLINKEKSDGSKYPEM 194

Query: 197 ILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMEN 256
           .|   |||| |  ..| |||.| | |  . || | | | | ||||| | .| | | . ||
Sbjct: 195 VLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSEN 254

Query: 257 SPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLK 316
              |. |... ||| ||| |... .|.|   |. ||  |.||.  ||| |   ...|..|
Sbjct: 255 VYPGTTVLQVTATDQDEGVNAEITFSFS-EASQITQ--FDLNSNTGEITVLNTLDFEEVK 311

Query: 317 LYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSV 376
            | . . | | |   .  || | ..| | ||| ||.  .|    . |. .. | ||.. |
Sbjct: 312 EYSIVLEARDGGG--MIAQCTVEVEVIDENDNAPEVIFQSLPNLIMEDAELGTHIALLKV 369

Query: 377 SDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPP 436
            ||||  || |   .  ..|||.  || | |.||    ||||. |||.|| | |||| ||
Sbjct: 370 RDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPP 429

Query: 437 LSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFI 496
           || . ..|| . |.||| | | || | . | ||| ||| .| . | ||||  |  . | |
Sbjct: 430 LSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCI 489

Query: 497 LEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHII 556
           .  ..    .|   ||. |.| ..| . ||.|  . |   ..||| ||| ||.|||. ..
Sbjct: 490 MASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVL 549

Query: 557 IVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVS 615
           . |.||||| .. |     || . . .| . . | || ||.|    |  |. ..   | .
Sbjct: 550 VDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQA 609

Query: 616 NDAYWYSLFL 625
           ..   .|| |
Sbjct: 610 SEPGLFSLGL 619

>hg18||uc003lhc
        |5|NM_031495|Q9Y5H9-2|Q9Y5H9-2|PCDHA2|NM_031495|NP_113683|protocadherin
        alpha 2 isoform 2 precursor

          Length = 824

 Score =  465 bits (1195), Expect = 1e-130
 Identities = 236/578 (40%), Positives = 365/578 (63%), Gaps = 3/578 (0%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.||| . |. |  .| ||||... |  |  ||    .   |..| . | ||.  ||||
Sbjct:  33 YSVPEEAKHGTFVGRIAQDLGLELEELVPRLFRVASKRHGDLLEVNLQNGILFVNSRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .  | . ..  .. |...|..|||. ||||| | |      .   ||  .  
Sbjct:  93 EELC--GRSAECSIHVEVIVDRPLQVFHVEVEVKDINDNPPIFPMTVKTIRFPESRLLDS 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |  |.| |.| |..  | ||.|| | ..||   . ..   |.| |.||||  |  ||
Sbjct: 151 RFPLEGASDADIGVNALLSYKLSSSEFFFLDIQANDELSESLSLVLGKSLDREETAEVNL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .| | ||| |  |||  |...||||||| |.| .  | | ..||.  |.||.||||.| |
Sbjct: 211 LLVATDGGKPELTGTVQILIKVLDVNDNEPTFAQSVYKVKLLENTANGTLVVKLNASDAD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || ||..|||     |   |  | ..  .|||| .  ..||. | ||... |.||||  .
Sbjct: 271 EGPNSEIVYSLGSDVSSTIQTKFTIDPISGEIRTKGKLDYEEAKSYEIQVTATDKGTPSM 330

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           .| ||..... |.||| ||.|| |   |..||  . ||||...|||.||| || |   . 
Sbjct: 331 SGHCKISLKLVDINDNTPEVSITSLSLPISENASLGTVIALITVSDRDSGTNGHVTCSLT 390

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            ..||||  .  ||| ||.   |||| |  |..  |  | ||| |    ....|. |.||
Sbjct: 391 PHVPFKLVSTFKNYYSLVLDSALDRESVSAYELVVTARDGGSPSLWATTSVSIEVADVND 450

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | | |  ||. | ||| ||  . ...|.| |  ||  . | ..|. .   ..|   |.
Sbjct: 451 NAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQENALVSYSLVERRVGERALSSYVSV 510

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSPWR 572
           . |.| .|||.  |.|  .   | . |||.| ||| |||.. . ..|.||||| ...|  
Sbjct: 511 HAESGKVYALQPLDHEEVELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRA 570

Query: 573 AQGS-VVEEKIPRSTDKGSLVAKVIANSVISERNSTIA 609
              .  | | .| |   | .|||| |    |  |. ..
Sbjct: 571 GTAAGAVSELVPWSVGAGHVVAKVRAVDADSGYNAWLS 608

>hg18||uc003lhd
        |5|NM_018905|Q9Y5H9|PCDA2_HUMAN|PCDHA2|NM_018905|NP_061728|protocadheri
        n alpha 2 isoform 1 precursor

          Length = 948

 Score =  465 bits (1195), Expect = 1e-130
 Identities = 236/578 (40%), Positives = 365/578 (63%), Gaps = 3/578 (0%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||.||| . |. |  .| ||||... |  |  ||    .   |..| . | ||.  ||||
Sbjct:  33 YSVPEEAKHGTFVGRIAQDLGLELEELVPRLFRVASKRHGDLLEVNLQNGILFVNSRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    .  | . ..  .. |...|..|||. ||||| | |      .   ||  .  
Sbjct:  93 EELC--GRSAECSIHVEVIVDRPLQVFHVEVEVKDINDNPPIFPMTVKTIRFPESRLLDS 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |  |.| |.| |..  | ||.|| | ..||   . ..   |.| |.||||  |  ||
Sbjct: 151 RFPLEGASDADIGVNALLSYKLSSSEFFFLDIQANDELSESLSLVLGKSLDREETAEVNL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .| | ||| |  |||  |...||||||| |.| .  | | ..||.  |.||.||||.| |
Sbjct: 211 LLVATDGGKPELTGTVQILIKVLDVNDNEPTFAQSVYKVKLLENTANGTLVVKLNASDAD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || ||..|||     |   |  | ..  .|||| .  ..||. | ||... |.||||  .
Sbjct: 271 EGPNSEIVYSLGSDVSSTIQTKFTIDPISGEIRTKGKLDYEEAKSYEIQVTATDKGTPSM 330

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           .| ||..... |.||| ||.|| |   |..||  . ||||...|||.||| || |   . 
Sbjct: 331 SGHCKISLKLVDINDNTPEVSITSLSLPISENASLGTVIALITVSDRDSGTNGHVTCSLT 390

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
            ..||||  .  ||| ||.   |||| |  |..  |  | ||| |    ....|. |.||
Sbjct: 391 PHVPFKLVSTFKNYYSLVLDSALDRESVSAYELVVTARDGGSPSLWATTSVSIEVADVND 450

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | | |  ||. | ||| ||  . ...|.| |  ||  . | ..|. .   ..|   |.
Sbjct: 451 NAPAFAQPEYTVFVKENNPPGCHIFTVSAWDADAQENALVSYSLVERRVGERALSSYVSV 510

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSPWR 572
           . |.| .|||.  |.|  .   | . |||.| ||| |||.. . ..|.||||| ...|  
Sbjct: 511 HAESGKVYALQPLDHEEVELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRA 570

Query: 573 AQGS-VVEEKIPRSTDKGSLVAKVIANSVISERNSTIA 609
              .  | | .| |   | .|||| |    |  |. ..
Sbjct: 571 GTAAGAVSELVPWSVGAGHVVAKVRAVDADSGYNAWLS 608

>hg18||uc003liv
        |5|NM_020957|Q9NRJ7|PCDBG_HUMAN|PCDHB16|NM_020957|NP_066008|protocadher
        in beta 16 precursor

          Length = 776

 Score =  465 bits (1194), Expect = 1e-130
 Identities = 250/612 (40%), Positives = 378/612 (61%), Gaps = 10/612 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. || | || ||||  |||| .  .  || |.   |||..| .  .||.| | |..||
Sbjct:  33 YSVVEETERGSFVANLGKDLGLGLTEMSTRKARIISQGNKQHLQLKAQTGDLLINEKLDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | ||    |  | |     .|||. .|  |. ..||||..| |    | | | |.| .| 
Sbjct:  93 EELC--GPTEPCILHFQVLMENPLEIFQAELRVIDINDHSPMFTEKEMILKIPENSPLGT 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
            | ||.| | |||||.|..| .| | || . |   ||| |. .|.| | |||| .    |
Sbjct: 151 EFPLNHALDLDVGSNNVQNYKISPSSHFRVLIHEFRDGRKYPELVLDKELDREEEPQLRL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
            |||.||| | |.||| . . |.|.||||| | .  | | . ||||.||||  ..| |||
Sbjct: 211 TLTALDGGSPPRSGTAQVRIEVVDINDNAPEFEQPIYKVQIPENSPLGSLVATVSARDLD 270

Query: 273 EGSNSDVVYSYSLY-TSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNL 331
            |.|  .  ||.|.  ||   .   .|   ||.|.|. ...| .  ||. | |.| |   
Sbjct: 271 GGANGKI--SYTLFQPSEDISKTLEVNPMTGEVRLRKQVDFEMVTSYEVRIKATDGGG-- 326

Query: 332 LTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHI 391
           |.|.| . .|| |.||| |.... .  .|. ||   . |.|| |||| |||.||     |
Sbjct: 327 LSGKCTLLLQVVDVNDNPPQVTMSALTSPIPEN-SPEIVVAVFSVSDPDSGNNGKTISSI 385

Query: 392 PDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIN 451
            ...|| |. |  |.| ||    ||||   ||.|| |||| |.| |     .|... |.|
Sbjct: 386 QEDLPFLLKPSVKNFYTLVTERALDREARAEYNITLTVTDMGTPRLKTEHNITVQISDVN 445

Query: 452 DNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFS 511
           || | | |. ||. | |||.|   . |..| | |   |  . | .|  .  .  .. | |
Sbjct: 446 DNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVS 505

Query: 512 INPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSPW 571
           || .||.|.||.. |||  .|| | . | | ||| |||   | ....| |||.| .. | 
Sbjct: 506 INADNGHLFALRSLDYEALREFEFRVSATDRGSPALSSEALVRVLVLDANDNSPFVLYPL 565

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYSLFL--AETR 629
           .   .   | .||. . | || ||.|    | .|. ..   | . .   . ..    | |
Sbjct: 566 QNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVR 625

Query: 630 KGKLVVRQPVPK 641
             .|.  .   |
Sbjct: 626 TARLLSERDAAK 637

>hg18||uc003ljr
        |5|NM_032096|Q9Y5G2-2|Q9Y5G2-2|PCDHGB2|NM_032096|NP_115267|protocadheri
        n gamma subfamily B, 2 isoform 2

          Length = 811

 Score =  462 bits (1188), Expect = 7e-130
 Identities = 250/623 (40%), Positives = 374/623 (60%), Gaps = 15/623 (2%)

Query:  11 GRCN-------CLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRK 63
           |||         |  | |.   |.     ||||||. . ||| ||| |||| |. |  ||
Sbjct:   6 GRCGLVRWLQVLLPFLLSLFPGALPVQIRYSIPEELAKNSVVGNLAKDLGLSVRDLPARK 65

Query:  64 MRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEV 123
           .||     |.|  .| |.|.| . .||||| .|  .    | |  |   |||. .| | |
Sbjct:  66 LRVS--AEKEYFTVNPESGDLLVSDRIDREQICGKQPL--CVLDFDTVAENPLNIFYIAV 121

Query: 124 EIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSIN 183
            . ||||| | |..  ..| | ||.  |  | |. | | ||| ||.. |||. .|.| . 
Sbjct: 122 IVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLA 181

Query: 184 IQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPS 243
            .   || |. .|||  .||||  ..| |.||||||| | ..||  | ..| | ||| | 
Sbjct: 182 EKQTPDGRKYPELILKHSLDREEHSLHQLVLTAVDGGDPPQSGTTQIRIKVTDANDNPPV 241

Query: 244 FGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGE 303
           | .| | | . |. | |  |... ||| ||| |... ||.     |. .  |||| . ||
Sbjct: 242 FSQDVYRVTLREDVPPGFFVLQVTATDRDEGINAEITYSFH-NVDEQVKHFFNLNEKTGE 300

Query: 304 IRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNE 363
           |  .. ...|    | . | | | |   |   | . ... | ||  ||. . |  ||| |
Sbjct: 301 ITTKDDLDFEIASSYTLSIEAKDPGD--LAAHCSIQVEILDDNDCAPEVIVTSVSTPLPE 358

Query: 364 NIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEY 423
           .    ||||..   |.|||.|| |   .  |  | |. || |||.||    ||||..|||
Sbjct: 359 DSPPGTVIALIKTRDRDSGENGEVYCQVLGNAKFILKSSSKNYYKLVTDGALDREEIPEY 418

Query: 424 DITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFD 483
           ..| | || | |||| .  .|| . |.||| | | |. | . | ||| ||| .. ..| |
Sbjct: 419 NLTITATDGGKPPLSSSIIVTLHISDVNDNAPVFQQTSYMVHVAENNPPGASIAQISASD 478

Query: 484 PDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSG 543
           |||  .  . | |.  ..    .    |.. ..| ..| . ||.|  . |   ..||| |
Sbjct: 479 PDLGPSGQVSYSIVASDLKPREILSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQG 538

Query: 544 SPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVIS 602
           || ||.|||. ... | ||||| .. |     || . . .||. . | || ||.|    |
Sbjct: 539 SPALSANVSLRVLVGDLNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADS 598

Query: 603 ERNSTIADSTLVSNDAYWYSLFL 625
             |. ..   | ...   .|| |
Sbjct: 599 GHNAWLSYHVLQASEPGLFSLGL 621

>hg18||uc003ljs
        |5|NM_018923|Q9Y5G2|PCDGE_HUMAN|PCDHGB2|NM_018923|NP_061746|protocadher
        in gamma subfamily B, 2 isoform 1

          Length = 931

 Score =  462 bits (1188), Expect = 7e-130
 Identities = 250/623 (40%), Positives = 374/623 (60%), Gaps = 15/623 (2%)

Query:  11 GRCN-------CLLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRK 63
           |||         |  | |.   |.     ||||||. . ||| ||| |||| |. |  ||
Sbjct:   6 GRCGLVRWLQVLLPFLLSLFPGALPVQIRYSIPEELAKNSVVGNLAKDLGLSVRDLPARK 65

Query:  64 MRVDVVGNKKYLDINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEV 123
           .||     |.|  .| |.|.| . .||||| .|  .    | |  |   |||. .| | |
Sbjct:  66 LRVS--AEKEYFTVNPESGDLLVSDRIDREQICGKQPL--CVLDFDTVAENPLNIFYIAV 121

Query: 124 EIMDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSIN 183
            . ||||| | |..  ..| | ||.  |  | |. | | ||| ||.. |||. .|.| . 
Sbjct: 122 IVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLA 181

Query: 184 IQTGRDGTKFADLILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPS 243
            .   || |. .|||  .||||  ..| |.||||||| | ..||  | ..| | ||| | 
Sbjct: 182 EKQTPDGRKYPELILKHSLDREEHSLHQLVLTAVDGGDPPQSGTTQIRIKVTDANDNPPV 241

Query: 244 FGKDKYVVDVMENSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGE 303
           | .| | | . |. | |  |... ||| ||| |... ||.     |. .  |||| . ||
Sbjct: 242 FSQDVYRVTLREDVPPGFFVLQVTATDRDEGINAEITYSFH-NVDEQVKHFFNLNEKTGE 300

Query: 304 IRVREMINYEDLKLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNE 363
           |  .. ...|    | . | | | |   |   | . ... | ||  ||. . |  ||| |
Sbjct: 301 ITTKDDLDFEIASSYTLSIEAKDPGD--LAAHCSIQVEILDDNDCAPEVIVTSVSTPLPE 358

Query: 364 NIDVDTVIAVVSVSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEY 423
           .    ||||..   |.|||.|| |   .  |  | |. || |||.||    ||||..|||
Sbjct: 359 DSPPGTVIALIKTRDRDSGENGEVYCQVLGNAKFILKSSSKNYYKLVTDGALDREEIPEY 418

Query: 424 DITFTVTDRGSPPLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFD 483
           ..| | || | |||| .  .|| . |.||| | | |. | . | ||| ||| .. ..| |
Sbjct: 419 NLTITATDGGKPPLSSSIIVTLHISDVNDNAPVFQQTSYMVHVAENNPPGASIAQISASD 478

Query: 484 PDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSG 543
           |||  .  . | |.  ..    .    |.. ..| ..| . ||.|  . |   ..||| |
Sbjct: 479 PDLGPSGQVSYSIVASDLKPREILSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQG 538

Query: 544 SPPLSSNVSVHIIIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVIS 602
           || ||.|||. ... | ||||| .. |     || . . .||. . | || ||.|    |
Sbjct: 539 SPALSANVSLRVLVGDLNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADS 598

Query: 603 ERNSTIADSTLVSNDAYWYSLFL 625
             |. ..   | ...   .|| |
Sbjct: 599 GHNAWLSYHVLQASEPGLFSLGL 621

>hg18||uc003ljz
        |5|NM_032087|Q9Y5G6-2|Q9Y5G6-2|PCDHGA7|NM_032087|NP_114476|protocadheri
        n gamma subfamily A, 7 isoform 2

          Length = 817

 Score =  462 bits (1187), Expect = 1e-129
 Identities = 253/614 (41%), Positives = 378/614 (61%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. || ..|| | ..| ||||. . |  | .|.   |  .   .|. .| |    ||||
Sbjct:  33 YSVSEETDKGSFVGDIAKDLGLEPRELAERGVRIISRGRTQLFALNQRSGSLVTAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | .|    .  | .  .  .|. . .. |.|||.||||| | |    ... | |... | 
Sbjct:  93 EEIC--AQSARCLVNFNILMEDKMNLYPIDVEIIDINDNVPRFLTEEINVKIMENTAPGV 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |. | |||||.||.. | || . |||. .|.| | ||. .|.| . |||| . ||.|
Sbjct: 151 RFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDETKYPELVLERVLDREEERVHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | |. || | | |.||||. | |   .| | | || |.|. .. ..| |||
Sbjct: 211 VLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || | .| ||.   |  .  ..|.||.  |||   | ..||.   ||||. | | |   |
Sbjct: 271 EGVNGEVTYSFRKIT-PKLPKMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQD-GPGSL 328

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           | . || | | |.||| ||... |  . . |.  . ||||.  . |.||| || |   ||
Sbjct: 329 T-KAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIP 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
           .|.|||| .| |||| || .. |||| .  |.||   || |.||||    . ... | ||
Sbjct: 388 ENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | || | |.. . |||  || .  .|| | |  .|  . | . |  |    .|   ||
Sbjct: 448 NPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | ||||..||||  .|    . | ||| ||||||.|. . ..||||| | |. |  
Sbjct: 508 NSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSND--AYWYSLFLAETR 629
              ||   |  ||| . | || ||.|    | .|. ..   | ...   .   |.  | |
Sbjct: 568 PTDGSTGMELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003lka
        |5|NM_018920|Q9Y5G6|PCDG7_HUMAN|PCDHGA7|NM_018920|NP_061743|protocadher
        in gamma subfamily A, 7 isoform 1

          Length = 932

 Score =  462 bits (1187), Expect = 1e-129
 Identities = 253/614 (41%), Positives = 378/614 (61%), Gaps = 8/614 (1%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. || ..|| | ..| ||||. . |  | .|.   |  .   .|. .| |    ||||
Sbjct:  33 YSVSEETDKGSFVGDIAKDLGLEPRELAERGVRIISRGRTQLFALNQRSGSLVTAGRIDR 92

Query:  93 ELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSSVGE 152
           | .|    .  | .  .  .|. . .. |.|||.||||| | |    ... | |... | 
Sbjct:  93 EEIC--AQSARCLVNFNILMEDKMNLYPIDVEIIDINDNVPRFLTEEINVKIMENTAPGV 150

Query: 153 RFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAVHNL 212
           || |. | |||||.||.. | || . |||. .|.| | ||. .|.| . |||| . ||.|
Sbjct: 151 RFPLSEAGDPDVGTNSLQSYQLSPNRHFSLAVQSGDDETKYPELVLERVLDREEERVHHL 210

Query: 213 ILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNATDLD 272
           .||| ||| | |. || | | |.||||. | |   .| | | || |.|. .. ..| |||
Sbjct: 211 VLTASDGGDPPRSSTAHIQVTVVDVNDHTPVFSLPQYQVTVPENVPVGTRLLTVHAIDLD 270

Query: 273 EGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGTNLL 332
           || | .| ||.   |  .  ..|.||.  |||   | ..||.   ||||. | | |   |
Sbjct: 271 EGVNGEVTYSFRKIT-PKLPKMFHLNSLTGEISTLEGLDYEETAFYEMEVQAQD-GPGSL 328

Query: 333 TGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDLHIP 392
           | . || | | |.||| ||... |  . . |.  . ||||.  . |.||| || |   ||
Sbjct: 329 T-KAKVLITVLDVNDNAPEVTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIP 387

Query: 393 DNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDIND 452
           .|.|||| .| |||| || .. |||| .  |.||   || |.||||    . ... | ||
Sbjct: 388 ENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQVADTND 447

Query: 453 NVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSI 512
           | | || | |.. . |||  || .  .|| | |  .|  . | . |  |    .|   ||
Sbjct: 448 NPPTFPHSSYSVYIAENNPRGASIFLVTAQDHDSEDNAQITYSLAEDTIQGAPVSSYVSI 507

Query: 513 NPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVSP-W 571
           | . | ||||..||||  .|    . | ||| ||||||.|. . ..||||| | |. |  
Sbjct: 508 NSDTGVLYALQSFDYEQLRELQLRVTAHDSGDPPLSSNMSLSLFVLDQNDNPPEILYPAL 567

Query: 572 RAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSND--AYWYSLFLAETR 629
              ||   |  ||| . | || ||.|    | .|. ..   | ...   .   |.  | |
Sbjct: 568 PTDGSTGMELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYLLLKASEPGLFAVGLYTGEVR 627

Query: 630 KGKLVVRQPVPKGS 643
             . .. .   | |
Sbjct: 628 TARALLDRDALKQS 641

>hg18||uc003ljl
        |5|NM_032011|Q9Y5H0-2|Q9Y5H0-2|PCDHGA3|NM_032011|NP_114400|protocadheri
        n gamma subfamily A, 3 isoform 2

          Length = 829

 Score =  461 bits (1186), Expect = 1e-129
 Identities = 253/617 (41%), Positives = 379/617 (61%), Gaps = 14/617 (2%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. ||...|| | |.| ||||. . |  | .|.   |  .   .| ..| |   |||||
Sbjct:  33 YSVSEELDKGSFVGNIANDLGLEPRELAERGVRIVSRGRTQLFSLNPQSGSLVTAERIDR 92

Query:  93 ELLC---PLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSS 149
           | ||   ||     | .|..  .|. ...| .|.|| |||||||.|    . . | | . 
Sbjct:  93 EELCAQIPL-----CLVKINILVEDKLKIFEVEIEIKDINDNAPNFPTEELEIKIGELTV 147

Query: 150 VGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAV 209
            | || .  | ||||| ||...| || ...||. . .  .| |. .|.| .||||| . .
Sbjct: 148 PGTRFPIKTAFDPDVGINSLQNYKLSPNDYFSLAVNSVSEGAKYPELVLERALDREKKEI 207

Query: 210 HNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNAT 269
           | |.| | ||| |  .|   | | ||| ||| | | . .| | | || |.|. .. .|||
Sbjct: 208 HQLVLVASDGGDPVHSGNLHIQVIVLDANDNPPMFTQPEYRVSVWENVPVGTRLLTVNAT 267

Query: 270 DLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGT 329
           | ||| |. | |        .  .||.||. .||. . . ..|||   ||..| | | | 
Sbjct: 268 DPDEGFNAQVSYILDKMPG-KIAEIFHLNSVSGEVSILKSLDYEDAMFYEIKIEAQD-GP 325

Query: 330 NLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDL 389
            ||. . |. . | |.||| |||.| |  . . |   |   ||.. | |.||| || |..
Sbjct: 326 GLLS-RAKILVTVLDVNDNAPEITITSLTSSVPEEGTVGREIALIDVHDRDSGQNGQVEV 384

Query: 390 HIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLD 449
            .  |.|||| .| | || || .  ||||.. ||.|.   .| ||||||    .|| ..|
Sbjct: 385 FVLGNLPFKLEKSIDQYYRLVTATSLDREQISEYNISLRASDGGSPPLSTETHITLHVID 444

Query: 450 INDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSML 509
           |||| | ||   |.  . |||  || . |.|| ||| . |  . | . |  .    .|  
Sbjct: 445 INDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPDSNNNARITYALTEDTLQGAPLSSF 504

Query: 510 FSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVS 569
            |||   | ||||..||||  ..    . | |||.||||||||... ..||||||| |. 
Sbjct: 505 VSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNPPLSSNVSLNLFVLDQNDNAPEILY 564

Query: 570 P-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLA 626
           |     ||   |  ||| . | || ||.|    | .|. ..   | ...   .|  |   
Sbjct: 565 PALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTG 624

Query: 627 ETRKGKLVVRQPVPKGS 643
           | |  . .. .   | |
Sbjct: 625 EVRTARALLDRDALKQS 641

>hg18||uc003ljm
        |5|NM_018916|Q9Y5H0|PCDG3_HUMAN|PCDHGA3|NM_018916|NP_061739|protocadher
        in gamma subfamily A, 3 isoform 1

          Length = 932

 Score =  461 bits (1186), Expect = 1e-129
 Identities = 253/617 (41%), Positives = 379/617 (61%), Gaps = 14/617 (2%)

Query:  33 YSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYLDINKETGELFILERIDR 92
           ||. ||...|| | |.| ||||. . |  | .|.   |  .   .| ..| |   |||||
Sbjct:  33 YSVSEELDKGSFVGNIANDLGLEPRELAERGVRIVSRGRTQLFSLNPQSGSLVTAERIDR 92

Query:  93 ELLC---PLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHFRRGTMHLDISESSS 149
           | ||   ||     | .|..  .|. ...| .|.|| |||||||.|    . . | | . 
Sbjct:  93 EELCAQIPL-----CLVKINILVEDKLKIFEVEIEIKDINDNAPNFPTEELEIKIGELTV 147

Query: 150 VGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDRELQAV 209
            | || .  | ||||| ||...| || ...||. . .  .| |. .|.| .||||| . .
Sbjct: 148 PGTRFPIKTAFDPDVGINSLQNYKLSPNDYFSLAVNSVSEGAKYPELVLERALDREKKEI 207

Query: 210 HNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVMENSPIGSLVIKLNAT 269
           | |.| | ||| |  .|   | | ||| ||| | | . .| | | || |.|. .. .|||
Sbjct: 208 HQLVLVASDGGDPVHSGNLHIQVIVLDANDNPPMFTQPEYRVSVWENVPVGTRLLTVNAT 267

Query: 270 DLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDLKLYEMEIIASDKGT 329
           | ||| |. | |        .  .||.||. .||. . . ..|||   ||..| | | | 
Sbjct: 268 DPDEGFNAQVSYILDKMPG-KIAEIFHLNSVSGEVSILKSLDYEDAMFYEIKIEAQD-GP 325

Query: 330 NLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVSVSDKDSGDNGVVDL 389
            ||. . |. . | |.||| |||.| |  . . |   |   ||.. | |.||| || |..
Sbjct: 326 GLLS-RAKILVTVLDVNDNAPEITITSLTSSVPEEGTVGREIALIDVHDRDSGQNGQVEV 384

Query: 390 HIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLD 449
            .  |.|||| .| | || || .  ||||.. ||.|.   .| ||||||    .|| ..|
Sbjct: 385 FVLGNLPFKLEKSIDQYYRLVTATSLDREQISEYNISLRASDGGSPPLSTETHITLHVID 444

Query: 450 INDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSML 509
           |||| | ||   |.  . |||  || . |.|| ||| . |  . | . |  .    .|  
Sbjct: 445 INDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPDSNNNARITYALTEDTLQGAPLSSF 504

Query: 510 FSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNAPVIVS 569
            |||   | ||||..||||  ..    . | |||.||||||||... ..||||||| |. 
Sbjct: 505 VSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNPPLSSNVSLNLFVLDQNDNAPEILY 564

Query: 570 P-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLVSNDAYWYS--LFLA 626
           |     ||   |  ||| . | || ||.|    | .|. ..   | ...   .|  |   
Sbjct: 565 PALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTG 624

Query: 627 ETRKGKLVVRQPVPKGS 643
           | |  . .. .   | |
Sbjct: 625 EVRTARALLDRDALKQS 641

>hg18||uc003ljx
        |5|NM_032086|Q9Y5G7-2|Q9Y5G7-2|PCDHGA6|NM_032086|NP_114475|protocadheri
        n gamma subfamily A, 6 isoform 2

          Length = 818

 Score =  460 bits (1181), Expect = 5e-129
 Identities = 259/631 (41%), Positives = 372/631 (58%), Gaps = 8/631 (1%)

Query:  16 LLLLFSVIATAVVAVTHYSIPEEMEEGSVVANLATDLGLDVKTLRGRKMRVDVVGNKKYL 75
           || |   .  |  |   ||||||.|.|| | |.  ||||. . |    .|.   |  .  
Sbjct:  16 LLTLLGTLWGAAAAQIRYSIPEELEKGSFVGNIVKDLGLEPQELAEHGVRIVSRGRMQLF 75

Query:  76 DINKETGELFILERIDRELLCPLKTTTHCFLKLDATIENPIRMFNIEVEIMDINDNAPHF 135
            .|   | |    ||||| ||    .  | .  .  .|. . .. .||||.||||| | |
Sbjct:  76 SLNPRNGSLVTAGRIDREELC--AQSPRCLVSFNILVEDKLNLYPVEVEIVDINDNTPRF 133

Query: 136 RRGTMHLDISESSSVGERFSLNNAADPDVGSNSVKDYHLSASEHFSINIQTGRDGTKFAD 195
            .  . . | |...   || |    ||||| ||.. . || . |||...|.   | |. .
Sbjct: 134 LKEELEVKILENAAPSSRFPLMEVYDPDVGMNSLQGFKLSGNSHFSVDVQSEAHGPKYPE 193

Query: 196 LILTKALDRELQAVHNLILTAVDGGVPTRTGTASIVVRVLDVNDNAPSFGKDKYVVDVME 255
           |.|   |||| .||. |.|||.||| | |.  | |.| ||||||| | | .  | | | |
Sbjct: 194 LVLEGTLDREGEAVYRLVLTAMDGGDPVRSSVAQILVTVLDVNDNTPMFTQPVYRVSVPE 253

Query: 256 NSPIGSLVIKLNATDLDEGSNSDVVYSYSLYTSERTQQIFNLNAENGEIRVREMINYEDL 315
           | |.|. |. . ||| ||| . .| ||.   | |.  ||| ||   |||     ..||| 
Sbjct: 254 NLPVGTPVLAVTATDQDEGVHGEVTYSFVKIT-EKISQIFCLNVLTGEISTSANLDYEDS 312

Query: 316 KLYEMEIIASDKGTNLLTGQCKVTIQVTDMNDNHPEISIKSFQTPLNENIDVDTVIAVVS 375
             ||. . | |     |  . || | . |.||| ||. . |    . |.    ||||.  
Sbjct: 313 SFYELGVEARDGPG--LRDRAKVLITILDVNDNVPEVVVTSGSRTIAESAPPGTVIALFQ 370

Query: 376 VSDKDSGDNGVVDLHIPDNMPFKLRQSSDNYYELVVSEPLDREKVPEYDITFTVTDRGSP 435
           | |.||| ||.|   || ..||.| .|  ||| || .  ||||.|  |.|| | ||.|.|
Sbjct: 371 VFDRDSGLNGLVTCSIPRSLPFELEKSVGNYYRLVTNAALDREEVFLYNITVTATDKGTP 430

Query: 436 PLSDNETMTLELLDINDNVPHFPQSFYTIRVTENNAPGALLSSLTAFDPDLHENQYLVYF 495
           |||    ..| . | ||| | || | |.. | |||  || . |. | |||. .|  . | 
Sbjct: 431 PLSTETIISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPDVDQNAQVSYS 490

Query: 496 ILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHI 555
           . |  .    .|   ||| . | ||||..||||  ..    . | ||| ||||||||. .
Sbjct: 491 LAEDTLQGAPLSSYVSINSDTGILYALRSFDYEQLRDLQLWVTASDSGDPPLSSNVSLSL 550

Query: 556 IIVDQNDNAPVIVSP-WRAQGSVVEEKIPRSTDKGSLVAKVIANSVISERNSTIADSTLV 614
            ..||||||| |. |     ||   |  ||| . | || ||.|    | .|. ..   | 
Sbjct: 551 FVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLK 610

Query: 615 SNDAYWYS--LFLAETRKGKLVVRQPVPKGS 643
           ...   .|  |   | |  . .. .   | |
Sbjct: 611 ASEPGLFSVGLHTGEVRTARALLDRDALKQS 641

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,654,518
Number of Sequences: 45480
Number of Extensions: 191654518
Number of Successful Extensions: 10949811
Number of sequences better than 0.0: 0
BLASTP 7.6.0