BLASTP 7.6.0


Query=fugu4_740906 |jgi|Takru4|740906|fgh5_pg.C_scaffold_333000024
        (478 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003ibi |4|NM_001221|Q13557|KCC2D_HUMAN|CAMK2D|NM_001221|...    863   1e-250
hg18||uc003ibj |4|NM_172128|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172128...    863   1e-250
hg18||uc003ibk |4|NM_172127|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172127...    863   1e-250
hg18||uc003ibl |4|NM_172115|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172115...    863   1e-250
hg18||uc003tkv |7|NM_172083|Q13554-4|Q13554-4|CAMK2B|NM_172083|N...    816   2e-236
hg18||uc003lru |5|NM_171825|Q7LDD5|Q7LDD5_HUMAN|CAMK2A|NM_171825...    812   2e-235
hg18||uc003ibm |4|AB209288|Q59G21|Q59G21_HUMAN|CAMK2D|NM_172127|...    592   4e-169
hg18||uc003ibn |4|AY987011|Q52PK4|Q52PK4_HUMAN|CAMK2D|NM_172128|...    592   4e-169
hg18||uc003ibo |4|BC022558|Q4G1A8|Q4G1A8_HUMAN|CAMK2D|NM_172128|...    585   6e-167
hg18||uc003lrt |5|NM_015981|Q9UQM7-2|Q9UQM7-2|CAMK2A|NM_015981|N...    572   6e-163
hg18||uc001jvm |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171...    565   7e-161
hg18||uc001jvn |10|NM_172172|NA|NA|CAMK2G|NM_172172|NP_751912|ca...    565   7e-161
hg18||uc001jvo |10|NM_172169|Q5SQZ3|Q5SQZ3_HUMAN|CAMK2G|NM_17216...    565   7e-161
hg18||uc001jvp |10|NM_172170|Q13555-4|Q13555-4|CAMK2G|NM_172170|...    565   7e-161
hg18||uc001jvq |10|NM_172173|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_17217...    565   7e-161
hg18||uc001jvr |10|NM_001222|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_00122...    565   7e-161
hg18||uc001jvs |10|AK225771|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    565   7e-161
hg18||uc003tkp |7|NM_172078|Q13554-2|Q13554-2|CAMK2B|NM_172078|N...    564   1e-160
hg18||uc003tkq |7|NM_001220|Q13554-2|Q13554-2|CAMK2B|NM_001220|N...    564   1e-160
hg18||uc003tkr |7|NM_172079|Q13554-5|Q13554-5|CAMK2B|NM_172079|N...    564   1e-160
hg18||uc003tks |7|NM_172080|Q13554-5|Q13554-5|CAMK2B|NM_172080|N...    564   1e-160
hg18||uc003tkt |7|NM_172082|Q13554-6|Q13554-6|CAMK2B|NM_172082|N...    564   1e-160
hg18||uc003tku |7|NM_172081|Q13554-3|Q13554-3|CAMK2B|NM_172081|N...    564   1e-160
hg18||uc003tkw |7|NM_172084|Q13554-7|Q13554-7|CAMK2B|NM_172084|N...    564   1e-160
hg18||uc003tkx |7|CR622698|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP...    564   1e-160
hg18||uc001jvv |10|AK131199|NA|NA|CAMK2G|NA|NA|Homo sapiens mRNA...    537   1e-152
hg18||uc001jvu |10|CR613060|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    359   7e-099
hg18||uc003ibm |4|AB209288|Q59G21|Q59G21_HUMAN|CAMK2D|NM_172127|...    314   2e-085
hg18||uc003tkp |7|NM_172078|Q13554-2|Q13554-2|CAMK2B|NM_172078|N...    290   4e-078
hg18||uc003tkr |7|NM_172079|Q13554-5|Q13554-5|CAMK2B|NM_172079|N...    290   4e-078
hg18||uc003tks |7|NM_172080|Q13554-5|Q13554-5|CAMK2B|NM_172080|N...    290   4e-078
hg18||uc001jvr |10|NM_001222|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_00122...    282   9e-076
hg18||uc003ibn |4|AY987011|Q52PK4|Q52PK4_HUMAN|CAMK2D|NM_172128|...    280   3e-075
hg18||uc001jvo |10|NM_172169|Q5SQZ3|Q5SQZ3_HUMAN|CAMK2G|NM_17216...    276   5e-074
hg18||uc001jvp |10|NM_172170|Q13555-4|Q13555-4|CAMK2G|NM_172170|...    276   5e-074
hg18||uc001jvq |10|NM_172173|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_17217...    276   5e-074
hg18||uc001jvs |10|AK225771|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    276   5e-074
hg18||uc001jvu |10|CR613060|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    276   5e-074
hg18||uc003tku |7|NM_172081|Q13554-3|Q13554-3|CAMK2B|NM_172081|N...    261   2e-069
hg18||uc003tkx |7|CR622698|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP...    261   2e-069
hg18||uc003lrs |5|CR612614|NA|NA|KIAA0968|NA|NA|Homo sapiens mRN...    260   5e-069
hg18||uc003lrt |5|NM_015981|Q9UQM7-2|Q9UQM7-2|CAMK2A|NM_015981|N...    254   2e-067
hg18||uc003tkw |7|NM_172084|Q13554-7|Q13554-7|CAMK2B|NM_172084|N...    238   1e-062
hg18||uc001ilo |10|NM_153498|Q8IU85|KCC1D_HUMAN|CAMK1D|NM_153498...    236   4e-062
hg18||uc001iln |10|NM_020397|Q8IU85-2|Q8IU85-2|CAMK1D|NM_020397|...    236   6e-062
hg18||uc003tko |7|AX747297|NA|NA|CAMKB|NA|NA|Homo sapiens calciu...    235   1e-061
hg18||uc003tkq |7|NM_001220|Q13554-2|Q13554-2|CAMK2B|NM_001220|N...    235   1e-061
hg18||uc001jvm |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171...    232   8e-061
hg18||uc003kpe |5|L24959|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP_00...    231   1e-060
hg18||uc003kpf |5|NM_001744|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP...    231   1e-060
hg18||uc001hhd |1|NM_020439|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|...    226   8e-059
hg18||uc001hhe |1|AK095713|Q96NX5|KCC1G_HUMAN|CAMK1G|NM_020439|N...    226   8e-059
hg18||uc001hhf |1|AY212935|Q96NX5-2|Q96NX5-2|CAMK1G|NM_020439|NP...    226   8e-059
hg18||uc003bst |3|NM_003656|Q14012|KCC1A_HUMAN|CAMK1|NM_003656|N...    224   2e-058
hg18||uc002euv |16|NM_006742|P11801|KPSH1_HUMAN|PSKH1|NM_006742|...    220   5e-057
hg18||uc002lzc |19|NM_001348|O43293|DAPK3_HUMAN|DAPK3|NM_001348|...    205   1e-052
hg18||uc002lzd |19|AK027590|O43293|DAPK3_HUMAN|DAPK3|NM_001348|N...    205   1e-052
hg18||uc002amr |15|NM_014326|Q9UIK4|DAPK2_HUMAN|DAPK2|NM_014326|...    202   1e-051
hg18||uc002dzi |16|CR598568|P15735|PHKG2_HUMAN|PHKG2|NM_000294|N...    201   2e-051
hg18||uc004apc |9|AB208871|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|N...    193   4e-049
hg18||uc004apd |9|NM_004938|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|...    193   4e-049
hg18||uc003cxt |3|NM_024046|Q8NCB2|CAMKV_HUMAN|CAMKV|NM_024046|N...    190   6e-048
hg18||uc003cxu |3|AK075294|Q8NCB2-3|Q8NCB2-3|CAMKV|NM_024046|NP_...    190   6e-048
hg18||uc002qkf |19|AF479826|Q8TDC3|BRSK1_HUMAN|BRSK1|NM_032430|N...    188   2e-047
hg18||uc002qkg |19|NM_032430|Q8TDC3-2|Q8TDC3-2|BRSK1|NM_032430|N...    188   2e-047
hg18||uc003ydo |8|NM_033126|Q96QS6|KPSH2_HUMAN|PSKH2|NM_033126|N...    184   3e-046
hg18||uc002dzk |16|NM_000294|P15735|PHKG2_HUMAN|PHKG2|NM_000294|...    184   3e-046
hg18||uc003tih |7|NM_004760|Q9UEE5|ST17A_HUMAN|STK17A|NM_004760|...    183   7e-046
hg18||uc001xys |14|NM_004755|O75582|KS6A5_HUMAN|RPS6KA5|NM_00475...    182   1e-045
hg18||uc001lth |11|AF533878|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NA|NA|BR ser...    179   6e-045
hg18||uc001lti |11|AF533879|Q8IWQ3|BRSK2_HUMAN|BRSK2|NM_003957|N...    179   6e-045
hg18||uc001ltj |11|NM_003957|Q8IWQ3-3|Q8IWQ3-3|BRSK2|NM_003957|N...    179   6e-045
hg18||uc001ltl |11|AF533877|Q8IWQ3-2|Q8IWQ3-2|BRSK2|NM_003957|NP...    179   6e-045
hg18||uc003mty |6|NM_001012418|Q86YV6|SGK85_HUMAN|LOC340156|NM_0...    173   8e-043
hg18||uc004fhz |X|BC064422|Q6P2M8-3|Q6P2M8-3|PNCK|NA|NA|Calcium/...    172   1e-042
hg18||uc001nxv |11|NM_001039468|Q7KZI7-4|Q7KZI7-4|MARK2|NM_00103...    171   2e-042
hg18||uc001nxw |11|BC008771|Q7KZI7|MARK2_HUMAN|MARK2|NM_00103946...    171   2e-042
hg18||uc001nxx |11|AB188493|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468...    171   2e-042
hg18||uc001nxy |11|AK225766|Q7KZI7-5|Q7KZI7-5|MARK2|NM_001039468...    171   2e-042
hg18||uc001nxz |11|NM_017490|Q7KZI7-3|Q7KZI7-3|MARK2|NM_017490|N...    171   2e-042
hg18||uc001nya |11|NM_004954|Q7KZI7-7|Q7KZI7-7|MARK2|NM_004954|N...    171   2e-042
hg18||uc001nyb |11|NM_001039469|Q7KZI7-6|Q7KZI7-6|MARK2|NM_00103...    171   2e-042
hg18||uc001ymw |14|NM_002376|P27448-3|P27448-3|MARK3|NM_002376|N...    169   6e-042
hg18||uc001ymx |14|AF387637|P27448-4|P27448-4|MARK3|NM_002376|NP...    169   6e-042
hg18||uc003trz |7|NM_006213|Q16816|PHKG1_HUMAN|PHKG1|NM_006213|N...    169   6e-042
hg18||uc001jvu |10|CR613060|Q13555-4|Q13555-4|CAMK2G|NM_172170|N...    169   8e-042
hg18||uc001ltm |11|AK131534|Q8IWQ3-5|Q8IWQ3-5|BRSK2|NA|NA|BR ser...    168   1e-041
hg18||uc002dzj |16|CR593394|P15735|PHKG2_HUMAN|PHKG2|NM_000294|N...    168   1e-041
hg18||uc002pba |19|NM_031417|Q96L34-2|Q96L34-2|MARK4|NM_031417|N...    168   2e-041
hg18||uc002pbb |19|AY120867|Q96L34|MARK4_HUMAN|MARK4|NA|NA|MAP/m...    168   2e-041
hg18||uc001hmn |1|BC114478|Q9P0L2|MARK1_HUMAN|MARK1|NM_018650|NP...    167   4e-041
hg18||uc001mgi |11|AJ303380|Q9BYT3|STK33_HUMAN|STK33|NM_030906|N...    164   4e-040
hg18||uc001mgj |11|NM_030906|Q9BYT3|STK33_HUMAN|STK33|NM_030906|...    164   4e-040
hg18||uc001mgk |11|AX748014|Q9BYT3|STK33_HUMAN|STK33|NM_030906|N...    164   4e-040
hg18||uc001ppy |11|NM_025164|Q9Y2K2|QSK_HUMAN|KIAA0999|NM_025164...    164   4e-040
hg18||uc001pqa |11|BC128510|A1A5A8|A1A5A8_HUMAN|KIAA0999|NM_0251...    164   4e-040
hg18||uc002wwq |20|BC092413|Q9H1R3|MYLK2_HUMAN|MYLK2|NM_033118|N...    159   9e-039
hg18||uc002wwr |20|NM_033118|Q9H1R3|MYLK2_HUMAN|MYLK2|NM_033118|...    159   9e-039
hg18||uc002zdf |21|NM_173354|P57059|SN1L1_HUMAN|SNF1LK|NM_173354...    153   6e-037
hg18||uc001plt |11|NM_015191|Q9H0K1|SN1L2_HUMAN|SNF1LK2|NM_01519...    149   7e-036

>hg18||uc003ibi
        |4|NM_001221|Q13557|KCC2D_HUMAN|CAMK2D|NM_001221|NP_001212|calcium/calm
        odulin-dependent protein kinase II

          Length = 499

 Score =  863 bits (2228), Expect = 1e-250
 Identities = 415/472 (87%), Positives = 436/472 (92%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXX 303
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||      
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAI 304

Query: 304 XXXXTDGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNG 363
                          .    || ||| ||.|||||||||||||||||||||||||.||||
Sbjct: 305 LTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNG 364

Query: 364 DFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGE 423
           ||| | ||||||||.|||||||||||| ||||||||||||| |||.|||.|||||||.|.
Sbjct: 365 DFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGD 424

Query: 424 NAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIP 475
           .||||||||||||||  |||.|||||||||||||.|.|||.||||||||..|
Sbjct: 425 DAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVP 476

>hg18||uc003ibj
        |4|NM_172128|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172128|NP_742126|calcium/cal
        modulin-dependent protein kinase II

          Length = 478

 Score =  863 bits (2228), Expect = 1e-250
 Identities = 415/472 (87%), Positives = 436/472 (92%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXX 303
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||      
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAI 304

Query: 304 XXXXTDGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNG 363
                          .    || ||| ||.|||||||||||||||||||||||||.||||
Sbjct: 305 LTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNG 364

Query: 364 DFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGE 423
           ||| | ||||||||.|||||||||||| ||||||||||||| |||.|||.|||||||.|.
Sbjct: 365 DFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGD 424

Query: 424 NAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIP 475
           .||||||||||||||  |||.|||||||||||||.|.|||.||||||||..|
Sbjct: 425 DAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVP 476

>hg18||uc003ibk
        |4|NM_172127|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172127|NP_742125|calcium/cal
        modulin-dependent protein kinase II

          Length = 478

 Score =  863 bits (2228), Expect = 1e-250
 Identities = 415/472 (87%), Positives = 436/472 (92%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXX 303
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||      
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAI 304

Query: 304 XXXXTDGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNG 363
                          .    || ||| ||.|||||||||||||||||||||||||.||||
Sbjct: 305 LTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNG 364

Query: 364 DFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGE 423
           ||| | ||||||||.|||||||||||| ||||||||||||| |||.|||.|||||||.|.
Sbjct: 365 DFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGD 424

Query: 424 NAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIP 475
           .||||||||||||||  |||.|||||||||||||.|.|||.||||||||..|
Sbjct: 425 DAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVP 476

>hg18||uc003ibl
        |4|NM_172115|Q8N553|Q8N553_HUMAN|CAMK2D|NM_172115|NP_742113|calcium/cal
        modulin-dependent protein kinase II

          Length = 478

 Score =  863 bits (2228), Expect = 1e-250
 Identities = 415/472 (87%), Positives = 436/472 (92%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXX 303
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||      
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAI 304

Query: 304 XXXXTDGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNG 363
                          .    || ||| ||.|||||||||||||||||||||||||.||||
Sbjct: 305 LTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNG 364

Query: 364 DFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGE 423
           ||| | ||||||||.|||||||||||| ||||||||||||| |||.|||.|||||||.|.
Sbjct: 365 DFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGD 424

Query: 424 NAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIP 475
           .||||||||||||||  |||.|||||||||||||.|.|||.||||||||..|
Sbjct: 425 DAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVP 476

>hg18||uc003tkv
        |7|NM_172083|Q13554-4|Q13554-4|CAMK2B|NM_172083|NP_742080|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 479

 Score =  816 bits (2106), Expect = 2e-236
 Identities = 392/473 (82%), Positives = 424/473 (89%), Gaps = 1/473 (0%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXXXX 305
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||        
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILT 306

Query: 306 XXTDGVK-EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGD 364
                       ....   || ||| .|||||||||| ||||||||| ||||||..||||
Sbjct: 307 TMLATRNFSAAKSLLNKKADGVKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGD 366

Query: 365 FETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGEN 424
           || ||||||||||||||||||||||| ||||||||| |.| .||.|| .||||||.|||.
Sbjct: 367 FEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGED 426

Query: 425 AACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||||||||||.|  | ||| |||||||||||.|.|||.||| ||.|  | |
Sbjct: 427 AACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 479

>hg18||uc003lru
        |5|NM_171825|Q7LDD5|Q7LDD5_HUMAN|CAMK2A|NM_171825|NP_741960|calcium/cal
        modulin-dependent protein kinase IIA

          Length = 478

 Score =  812 bits (2097), Expect = 2e-235
 Identities = 393/479 (82%), Positives = 426/479 (88%), Gaps = 9/479 (1%)

Query:   1 MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLERE 60
           ||   |||||.|||||||||||||||||||||. .|||||||||||||||||||||||||
Sbjct:   1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE 60

Query:  61 ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL 120
           ||||||||||||||||||||||| |||.||||||||||||||||||||||||||||||||
Sbjct:  61 ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL 120

Query: 121 ESVHHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL 180
           |.| |||  |.||||||||||||||||||||||||||||||||.|.||||||||||||||
Sbjct: 121 EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL 180

Query: 181 SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV 240
           |||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV 240

Query: 241 TPEAKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR--- 297
           ||||||||||||||||||||||.||||||||  |||||| |||||||.|||||||||   
Sbjct: 241 TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK 300

Query: 298 --XXXXXXXXXXTDGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQ 355
                         | |       .   || ||| || |||||||| | |||||||||||
Sbjct: 301 GAILTTMLATRNFSGGKSGG----NKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQ 356

Query: 356 LIESINNGDFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLN 415
           |||.|.|||||.| |.||||.|.|||||||||||| |||||||||  |. .||||| .||
Sbjct: 357 LIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILN 416

Query: 416 PHVHLIGENAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSI 474
           ||.||.|. .|||||||.|||.||||.||| |||||||||||.|.|| .||||||.||.
Sbjct: 417 PHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSV 475

>hg18||uc003ibm
        |4|AB209288|Q59G21|Q59G21_HUMAN|CAMK2D|NM_172127|NP_742125|calcium/calm
        odulin-dependent protein kinase II

          Length = 492

 Score =  592 bits (1525), Expect = 4e-169
 Identities = 285/294 (96%), Positives = 291/294 (98%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARR 298

>hg18||uc003ibn
        |4|AY987011|Q52PK4|Q52PK4_HUMAN|CAMK2D|NM_172128|NP_742126|calcium/calm
        odulin-dependent protein kinase II

          Length = 488

 Score =  592 bits (1525), Expect = 4e-169
 Identities = 285/294 (96%), Positives = 291/294 (98%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
           .|||.|||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 NHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARR 298

>hg18||uc003ibo
        |4|BC022558|Q4G1A8|Q4G1A8_HUMAN|CAMK2D|NM_172128|NP_742126|calcium/calm
        odulin-dependent protein kinase II

          Length = 339

 Score =  585 bits (1506), Expect = 6e-167
 Identities = 282/294 (95%), Positives = 288/294 (97%)

Query:   4 TICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARI 63
           | |||||||||||||||||||||||||.|| .||||||||||||||||||||||||||||
Sbjct:   5 TTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARI 64

Query:  64 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESV 123
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|
Sbjct:  65 CRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAV 124

Query: 124 HHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 183
            |||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 125 LHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPE 184

Query: 184 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 243
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 VLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPE 244

Query: 244 AKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           |||||||||||||.||||||||||||||||||||||||||||||.|||||||||
Sbjct: 245 AKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARR 298

>hg18||uc003lrt
        |5|NM_015981|Q9UQM7-2|Q9UQM7-2|CAMK2A|NM_015981|NP_057065|calcium/calmo
        dulin-dependent protein kinase IIA

          Length = 489

 Score =  572 bits (1472), Expect = 6e-163
 Identities = 275/297 (92%), Positives = 286/297 (96%)

Query:   1 MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLERE 60
           ||   |||||.|||||||||||||||||||||. .|||||||||||||||||||||||||
Sbjct:   1 MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE 60

Query:  61 ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL 120
           ||||||||||||||||||||||| |||.||||||||||||||||||||||||||||||||
Sbjct:  61 ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL 120

Query: 121 ESVHHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL 180
           |.| |||  |.||||||||||||||||||||||||||||||||.|.||||||||||||||
Sbjct: 121 EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL 180

Query: 181 SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV 240
           |||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV 240

Query: 241 TPEAKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           ||||||||||||||||||||||.||||||||  |||||| |||||||.|||||||||
Sbjct: 241 TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARR 297

>hg18||uc001jvm
        |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171|NP_751911|calcium/cal
        modulin-dependent protein kinase II

          Length = 556

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvn
        |10|NM_172172|NA|NA|CAMK2G|NM_172172|NP_751912|calcium/calmodulin-depen
        dent protein kinase II

          Length = 411

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvo
        |10|NM_172169|Q5SQZ3|Q5SQZ3_HUMAN|CAMK2G|NM_172169|NP_751909|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 527

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvp
        |10|NM_172170|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calm
        odulin-dependent protein kinase II

          Length = 518

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvq
        |10|NM_172173|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_172173|NP_751913|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 504

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvr
        |10|NM_001222|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_001222|NP_001213|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 495

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc001jvs
        |10|AK225771|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calmo
        dulin-dependent protein kinase II

          Length = 539

 Score =  565 bits (1454), Expect = 7e-161
 Identities = 271/292 (92%), Positives = 284/292 (97%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||.|||||||||||||||||||| .| |||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.|
Sbjct:  67 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
            | . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||
Sbjct: 127 IHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 247 NLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 298

>hg18||uc003tkp
        |7|NM_172078|Q13554-2|Q13554-2|CAMK2B|NM_172078|NP_742075|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 542

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tkq
        |7|NM_001220|Q13554-2|Q13554-2|CAMK2B|NM_001220|NP_001211|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 666

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tkr
        |7|NM_172079|Q13554-5|Q13554-5|CAMK2B|NM_172079|NP_742076|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 518

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tks
        |7|NM_172080|Q13554-5|Q13554-5|CAMK2B|NM_172080|NP_742077|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 517

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tkt
        |7|NM_172082|Q13554-6|Q13554-6|CAMK2B|NM_172082|NP_742079|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 492

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tku
        |7|NM_172081|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP_742078|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 503

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tkw
        |7|NM_172084|Q13554-7|Q13554-7|CAMK2B|NM_172084|NP_742081|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 449

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc003tkx
        |7|CR622698|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP_742078|calcium/calmod
        ulin-dependent protein kinase IIB

          Length = 502

 Score =  564 bits (1452), Expect = 1e-160
 Identities = 269/292 (92%), Positives = 283/292 (96%)

Query:   6 CTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICR 65
           ||||||||||.|..|||||||||||||. .| ||||||||||||||||||||||||||||
Sbjct:   7 CTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICR 66

Query:  66 LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHH 125
           |||| |||||||||||||||||||||||||||||||||||||||||||||||||||.| |
Sbjct:  67 LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

Query: 126 CHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 185
           ||  |.||||||||||||||| ||||||||||||||||||||||||||||||||||||||
Sbjct: 127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL 186

Query: 186 RKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAK 245
           ||. ||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||
Sbjct: 187 RKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAK 246

Query: 246 DLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           .|||.||||||.||||| |||||||.||||||||||||||||||||||||||
Sbjct: 247 NLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARR 298

>hg18||uc001jvv |10|AK131199|NA|NA|CAMK2G|NA|NA|Homo sapiens mRNA for
        calcium/calmodulin-dependent protein kinase II gamma isoform 6 variant
        protein

          Length = 575

 Score =  537 bits (1383), Expect = 1e-152
 Identities = 261/290 (90%), Positives = 274/290 (94%), Gaps = 8/290 (2%)

Query:   8 RFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLL 67
           ||||.|||||||||        ||| .| |||||||||||||||||||||||||||||||
Sbjct:   9 RFTDDYQLFEELGK--------CVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLL 60

Query:  68 KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCH 127
           ||||||||||||||||||||||||||||||||||||||||||||||||| ||||||.| |
Sbjct:  61 KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIH 120

Query: 128 VNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRK 187
            . |||||||||||||||| ||||||||||||||||||.|||||||||||||||||||||
Sbjct: 121 QHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRK 180

Query: 188 DPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDL 247
           ||||||||.|||||||||||||||||||||||.|||||||||||||||||||||||||.|
Sbjct: 181 DPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL 240

Query: 248 INKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           ||.||||||.||||| .||||||.|||||||||||||||||||.||||||
Sbjct: 241 INQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARR 290

>hg18||uc001jvu
        |10|CR613060|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calmo
        dulin-dependent protein kinase II

          Length = 496

 Score =  359 bits (919), Expect = 7e-099
 Identities = 167/184 (90%), Positives = 178/184 (96%)

Query: 114 HCIQQILESVHHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGF 173
           ||| ||||||.| | . |||||||||||||||| ||||||||||||||||||.|||||||
Sbjct:  93 HCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGF 152

Query: 174 AGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFP 233
           ||||||||||||||||||||||.|||||||||||||||||||||||.|||||||||||||
Sbjct: 153 AGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFP 212

Query: 234 SPEWDTVTPEAKDLINKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKF 293
           ||||||||||||.|||.||||||.||||| .||||||.|||||||||||||||||||.||
Sbjct: 213 SPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKF 272

Query: 294 NARR 297
           ||||
Sbjct: 273 NARR 276

>hg18||uc003ibm
        |4|AB209288|Q59G21|Q59G21_HUMAN|CAMK2D|NM_172127|NP_742125|calcium/calm
        odulin-dependent protein kinase II

          Length = 492

 Score =  314 bits (804), Expect = 2e-085
 Identities = 145/167 (86%), Positives = 159/167 (95%), Gaps = 1/167 (0%)

Query: 309 DGVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETY 368
           |||||||||||||| |||||| ||.|||||||||||||||||||||||||.||||||| |
Sbjct: 325 DGVKEPQTTVIHNP-DGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAY 383

Query: 369 AKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACI 428
            ||||||||.|||||||||||| ||||||||||||| |||.|||.|||||||.|..||||
Sbjct: 384 TKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACI 443

Query: 429 AYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIP 475
           ||||||||||  |||.|||||||||||||.|.|||.||||||||..|
Sbjct: 444 AYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVP 490

>hg18||uc003tkp
        |7|NM_172078|Q13554-2|Q13554-2|CAMK2B|NM_172078|NP_742075|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 542

 Score =  290 bits (740), Expect = 4e-078
 Identities = 134/165 (81%), Positives = 148/165 (89%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||||||||| ||| .|||||||||| ||||||||| ||||||..|||||| |||||
Sbjct: 378 EPQTTVIHNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKIC 437

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| ||||||||| |.| .||.|| .||||||.|||.||||||||
Sbjct: 438 DPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIR 497

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.|||.||| ||.|  | |
Sbjct: 498 LTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 542

>hg18||uc003tkr
        |7|NM_172079|Q13554-5|Q13554-5|CAMK2B|NM_172079|NP_742076|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 518

 Score =  290 bits (740), Expect = 4e-078
 Identities = 134/165 (81%), Positives = 148/165 (89%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||||||||| ||| .|||||||||| ||||||||| ||||||..|||||| |||||
Sbjct: 354 EPQTTVIHNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKIC 413

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| ||||||||| |.| .||.|| .||||||.|||.||||||||
Sbjct: 414 DPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIR 473

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.|||.||| ||.|  | |
Sbjct: 474 LTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 518

>hg18||uc003tks
        |7|NM_172080|Q13554-5|Q13554-5|CAMK2B|NM_172080|NP_742077|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 517

 Score =  290 bits (740), Expect = 4e-078
 Identities = 134/165 (81%), Positives = 148/165 (89%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||||||||| ||| .|||||||||| ||||||||| ||||||..|||||| |||||
Sbjct: 353 EPQTTVIHNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKIC 412

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| ||||||||| |.| .||.|| .||||||.|||.||||||||
Sbjct: 413 DPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIR 472

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.|||.||| ||.|  | |
Sbjct: 473 LTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 517

>hg18||uc001jvr
        |10|NM_001222|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_001222|NP_001213|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 495

 Score =  282 bits (720), Expect = 9e-076
 Identities = 129/168 (76%), Positives = 146/168 (86%)

Query: 310 GVKEPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYA 369
           |||||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | 
Sbjct: 328 GVKEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYT 387

Query: 370 KICDPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIA 429
           ||||||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.|||||
Sbjct: 388 KICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIA 447

Query: 430 YIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           |||||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 448 YIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 495

>hg18||uc003ibn
        |4|AY987011|Q52PK4|Q52PK4_HUMAN|CAMK2D|NM_172128|NP_742126|calcium/calm
        odulin-dependent protein kinase II

          Length = 488

 Score =  280 bits (716), Expect = 3e-075
 Identities = 127/148 (85%), Positives = 141/148 (95%)

Query: 328 ESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNL 387
           || ||.|||||||||||||||||||||||||.||||||| | ||||||||.|||||||||
Sbjct: 340 ESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNL 399

Query: 388 VEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQ 447
           ||| ||||||||||||| |||.|||.|||||||.|..||||||||||||||  |||.|||
Sbjct: 400 VEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQ 459

Query: 448 SEETRVWHRREGRWQNIHFHRSGSPSIP 475
           ||||||||||.|.|||.||||||||..|
Sbjct: 460 SEETRVWHRRDGKWQNVHFHRSGSPTVP 487

>hg18||uc001jvo
        |10|NM_172169|Q5SQZ3|Q5SQZ3_HUMAN|CAMK2G|NM_172169|NP_751909|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 527

 Score =  276 bits (705), Expect = 5e-074
 Identities = 126/165 (76%), Positives = 143/165 (86%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | |||
Sbjct: 363 EPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKIC 422

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.||||||||
Sbjct: 423 DPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIR 482

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 483 LTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 527

>hg18||uc001jvp
        |10|NM_172170|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calm
        odulin-dependent protein kinase II

          Length = 518

 Score =  276 bits (705), Expect = 5e-074
 Identities = 126/165 (76%), Positives = 143/165 (86%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | |||
Sbjct: 354 EPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKIC 413

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.||||||||
Sbjct: 414 DPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIR 473

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 474 LTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 518

>hg18||uc001jvq
        |10|NM_172173|Q5SWX4|Q5SWX4_HUMAN|CAMK2G|NM_172173|NP_751913|calcium/ca
        lmodulin-dependent protein kinase II

          Length = 504

 Score =  276 bits (705), Expect = 5e-074
 Identities = 126/165 (76%), Positives = 143/165 (86%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | |||
Sbjct: 340 EPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKIC 399

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.||||||||
Sbjct: 400 DPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIR 459

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 460 LTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 504

>hg18||uc001jvs
        |10|AK225771|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calmo
        dulin-dependent protein kinase II

          Length = 539

 Score =  276 bits (705), Expect = 5e-074
 Identities = 126/165 (76%), Positives = 143/165 (86%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | |||
Sbjct: 375 EPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKIC 434

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.||||||||
Sbjct: 435 DPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIR 494

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 495 LTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 539

>hg18||uc001jvu
        |10|CR613060|Q13555-4|Q13555-4|CAMK2G|NM_172170|NP_751910|calcium/calmo
        dulin-dependent protein kinase II

          Length = 496

 Score =  276 bits (705), Expect = 5e-074
 Identities = 126/165 (76%), Positives = 143/165 (86%)

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKIC 372
           ||||||.||  || | | || ||| ||||.| |||||||.||||||.||||||| | |||
Sbjct: 332 EPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKIC 391

Query: 373 DPGLTSFEPEALGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIR 432
           |||||||||||||||||| |||.||||| ||| .||.|| .||||||.|||.||||||||
Sbjct: 392 DPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIR 451

Query: 433 LTQYMDAGGMPRTMQSEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||.|  | ||| |||||||||||.|.| |.|.| ||.|. | |
Sbjct: 452 LTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ 496

>hg18||uc003tku
        |7|NM_172081|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP_742078|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 503

 Score =  261 bits (666), Expect = 2e-069
 Identities = 120/150 (80%), Positives = 134/150 (89%)

Query: 328 ESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNL 387
           || .|||||||||| ||||||||| ||||||..|||||| ||||||||||||||||||||
Sbjct: 354 ESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNL 413

Query: 388 VEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQ 447
           ||| ||||||||| |.| .||.|| .||||||.|||.||||||||||||.|  | ||| |
Sbjct: 414 VEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQ 473

Query: 448 SEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||||||||.|.|||.||| ||.|  | |
Sbjct: 474 SEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 503

>hg18||uc003tkx
        |7|CR622698|Q13554-3|Q13554-3|CAMK2B|NM_172081|NP_742078|calcium/calmod
        ulin-dependent protein kinase IIB

          Length = 502

 Score =  261 bits (666), Expect = 2e-069
 Identities = 120/150 (80%), Positives = 134/150 (89%)

Query: 328 ESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNL 387
           || .|||||||||| ||||||||| ||||||..|||||| ||||||||||||||||||||
Sbjct: 353 ESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNL 412

Query: 388 VEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQ 447
           ||| ||||||||| |.| .||.|| .||||||.|||.||||||||||||.|  | ||| |
Sbjct: 413 VEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQ 472

Query: 448 SEETRVWHRREGRWQNIHFHRSGSPSIPSQ 477
           ||||||||||.|.|||.||| ||.|  | |
Sbjct: 473 SEETRVWHRRDGKWQNVHFHCSGAPVAPLQ 502

>hg18||uc003lrs |5|CR612614|NA|NA|KIAA0968|NA|NA|Homo sapiens mRNA for KIAA0968
        protein, partial cds

          Length = 189

 Score =  260 bits (662), Expect = 5e-069
 Identities = 116/151 (76%), Positives = 137/151 (90%)

Query: 324 DGNKESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEA 383
           || ||| || |||||||| | ||||||||||||||.|.|||||.| |.||||.|.|||||
Sbjct:  36 DGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEA 95

Query: 384 LGNLVEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMP 443
           ||||||| |||||||||  |. .||||| .||||.||.|. .|||||||.|||.||||.|
Sbjct:  96 LGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIP 155

Query: 444 RTMQSEETRVWHRREGRWQNIHFHRSGSPSI 474
           || |||||||||||.|.|| .||||||.||.
Sbjct: 156 RTAQSEETRVWHRRDGKWQIVHFHRSGAPSV 186

>hg18||uc003lrt
        |5|NM_015981|Q9UQM7-2|Q9UQM7-2|CAMK2A|NM_015981|NP_057065|calcium/calmo
        dulin-dependent protein kinase IIA

          Length = 489

 Score =  254 bits (648), Expect = 2e-067
 Identities = 113/147 (76%), Positives = 134/147 (91%)

Query: 328 ESIESANTTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNL 387
           || || |||||||| | ||||||||||||||.|.|||||.| |.||||.|.|||||||||
Sbjct: 340 ESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNL 399

Query: 388 VEGHDFHRFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQ 447
           ||| |||||||||  |. .||||| .||||.||.|. .|||||||.|||.||||.||| |
Sbjct: 400 VEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQ 459

Query: 448 SEETRVWHRREGRWQNIHFHRSGSPSI 474
           ||||||||||.|.|| .||||||.||.
Sbjct: 460 SEETRVWHRRDGKWQIVHFHRSGAPSV 486

>hg18||uc003tkw
        |7|NM_172084|Q13554-7|Q13554-7|CAMK2B|NM_172084|NP_742081|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 449

 Score =  238 bits (606), Expect = 1e-062
 Identities = 108/143 (75%), Positives = 123/143 (86%)

Query: 335 TTIEDEDVKARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNLVEGHDFH 394
           | .   .  |||||||| ||||||..|||||| ||||||||||||||||||||||| |||
Sbjct: 307 TMLATRNFSARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFH 366

Query: 395 RFYFENALSKGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQSEETRVW 454
           |||||| |.| .||.|| .||||||.|||.||||||||||||.|  | ||| ||||||||
Sbjct: 367 RFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVW 426

Query: 455 HRREGRWQNIHFHRSGSPSIPSQ 477
           |||.|.|||.||| ||.|  | |
Sbjct: 427 HRRDGKWQNVHFHCSGAPVAPLQ 449

>hg18||uc001ilo
        |10|NM_153498|Q8IU85|KCC1D_HUMAN|CAMK1D|NM_153498|NP_705718|calcium/cal
        modulin-dependent protein kinase ID

          Length = 385

 Score =  236 bits (602), Expect = 4e-062
 Identities = 126/332 (37%), Positives = 193/332 (58%), Gaps = 5/332 (1%)

Query:  13 YQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNI 72
           ..  | || |||| |    . ..|. .| | |  | |  ..   .| |  . | .|| ||
Sbjct:  23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKE-SSIENEIAVLRKIKHENI 81

Query:  73 VRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVNGIV 132
           | | |        |||  ||.|||||. || . .|.| |||  |.|.|..|.. |  |||
Sbjct:  82 VALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIV 141

Query: 133 HRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGK 192
           ||||||||||  |. . . . ..||||. ...|         |||||..|||| . || |
Sbjct: 142 HRDLKPENLLYYSQDEESKIMISDFGLS-KMEGKGDVMSTACGTPGYVAPEVLAQKPYSK 200

Query: 193 PVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKML 252
            || |. ||| |||| |||||.||.  .|..||    |.| || || ..  ||| |  ..
Sbjct: 201 AVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLM 260

Query: 253 TINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARRXXXXXXXXXXTDGVK 312
             .|.|| |  .| .||||   . .   .|   . .  | |   .          |  |.
Sbjct: 261 EKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNFAKSK---WRQAFNATAVVR 317

Query: 313 EPQTTVIHNPVDGNKESIESANTTIEDEDVKA 344
             .   . . .| .  |. |. .    .|  |
Sbjct: 318 HMRKLHLGSSLDSSNASVSSSLSLASQKDCLA 349

>hg18||uc001iln
        |10|NM_020397|Q8IU85-2|Q8IU85-2|CAMK1D|NM_020397|NP_065130|calcium/calm
        odulin-dependent protein kinase ID

          Length = 357

 Score =  236 bits (601), Expect = 6e-062
 Identities = 119/281 (42%), Positives = 175/281 (62%), Gaps = 2/281 (0%)

Query:  13 YQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNI 72
           ..  | || |||| |    . ..|. .| | |  | |  ..   .| |  . | .|| ||
Sbjct:  23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKE-SSIENEIAVLRKIKHENI 81

Query:  73 VRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVNGIV 132
           | | |        |||  ||.|||||. || . .|.| |||  |.|.|..|.. |  |||
Sbjct:  82 VALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIV 141

Query: 133 HRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGK 192
           ||||||||||  |. . . . ..||||. ...|         |||||..|||| . || |
Sbjct: 142 HRDLKPENLLYYSQDEESKIMISDFGLS-KMEGKGDVMSTACGTPGYVAPEVLAQKPYSK 200

Query: 193 PVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKML 252
            || |. ||| |||| |||||.||.  .|..||    |.| || || ..  ||| |  ..
Sbjct: 201 AVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLM 260

Query: 253 TINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKF 293
             .|.|| |  .| .||||   . .   .|   . .  | |
Sbjct: 261 EKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNF 301

>hg18||uc003tko |7|AX747297|NA|NA|CAMKB|NA|NA|Homo sapiens
        calcium/calmodulin-dependent protein kinase II beta subunit mRNA,
        complete cds

          Length = 299

 Score =  235 bits (599), Expect = 1e-061
 Identities = 106/134 (79%), Positives = 120/134 (89%)

Query: 344 ARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALS 403
           .||||||| ||||||..|||||| ||||||||||||||||||||||| ||||||||| |.
Sbjct: 166 SRKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLA 225

Query: 404 KGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQN 463
           | .||.|| .||||||.|||.||||||||||||.|  | ||| |||||||||||.|.|||
Sbjct: 226 KNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQN 285

Query: 464 IHFHRSGSPSIPSQ 477
           .||| ||.|  | |
Sbjct: 286 VHFHCSGAPVAPLQ 299

>hg18||uc003tkq
        |7|NM_001220|Q13554-2|Q13554-2|CAMK2B|NM_001220|NP_001211|calcium/calmo
        dulin-dependent protein kinase IIB

          Length = 666

 Score =  235 bits (599), Expect = 1e-061
 Identities = 106/134 (79%), Positives = 120/134 (89%)

Query: 344 ARKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALS 403
           .||||||| ||||||..|||||| ||||||||||||||||||||||| ||||||||| |.
Sbjct: 533 SRKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLA 592

Query: 404 KGNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQN 463
           | .||.|| .||||||.|||.||||||||||||.|  | ||| |||||||||||.|.|||
Sbjct: 593 KNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQN 652

Query: 464 IHFHRSGSPSIPSQ 477
           .||| ||.|  | |
Sbjct: 653 VHFHCSGAPVAPLQ 666

>hg18||uc001jvm
        |10|NM_172171|Q13555|KCC2G_HUMAN|CAMK2G|NM_172171|NP_751911|calcium/cal
        modulin-dependent protein kinase II

          Length = 556

 Score =  232 bits (591), Expect = 8e-061
 Identities = 104/133 (78%), Positives = 119/133 (89%)

Query: 345 RKQEIIKVTEQLIESINNGDFETYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSK 404
           |||||||.||||||.||||||| | ||||||||||||||||||||| |||.||||| |||
Sbjct: 424 RKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSK 483

Query: 405 GNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDAGGMPRTMQSEETRVWHRREGRWQNI 464
            .||.|| .||||||.|||.||||||||||||.|  | ||| |||||||||||.|.| |.
Sbjct: 484 NSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNV 543

Query: 465 HFHRSGSPSIPSQ 477
           |.| ||.|. | |
Sbjct: 544 HYHCSGAPAAPLQ 556

>hg18||uc003kpe
        |5|L24959|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP_001735|calcium/calmoduli
        n-dependent protein kinase IV

          Length = 473

 Score =  231 bits (589), Expect = 1e-060
 Identities = 126/290 (43%), Positives = 184/290 (63%), Gaps = 10/290 (3%)

Query:  10 TDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKH 69
           .| ...  |||.|| |.| || .  . . || |..        | . .  |  .   | |
Sbjct:  43 SDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLK----KTVDKKIVRTEIGVLLRLSH 98

Query:  70 PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVN 129
           |||..| .         || .||||||||. || . |||| ||.  ..||||.| . | |
Sbjct:  99 PNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHEN 158

Query: 130 GIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDP 189
           ||||||||||||| |.    | .|.|||||. ..   |       ||||| .||.||   
Sbjct: 159 GIVHRDLKPENLLYATPAPDAPLKIADFGLS-KIVEHQVLMKTVCGTPGYCAPEILRGCA 217

Query: 190 YGKPVDMWACGVILYILLVGYPPFWDE--DQHRLYQQIKAGAYDFPSPEWDTVTPEAKDL 247
           ||  ||||. |.| |||| |. ||.||  ||  ....|    | | || || |.  ||||
Sbjct: 218 YGPEVDMWSVGIITYILLCGFEPFYDERGDQF-MFRRILNCEYYFISPWWDEVSLNAKDL 276

Query: 248 INKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           . |.. ..| ||.|  .||.|||.  ..  |. .|     . |..|||||
Sbjct: 277 VRKLIVLDPKKRLTTFQALQHPWVTGKA--ANFVHMDTAQKKLQEFNARR 324

>hg18||uc003kpf
        |5|NM_001744|Q16566|KCC4_HUMAN|CAMK4|NM_001744|NP_001735|calcium/calmod
        ulin-dependent protein kinase IV

          Length = 473

 Score =  231 bits (589), Expect = 1e-060
 Identities = 126/290 (43%), Positives = 184/290 (63%), Gaps = 10/290 (3%)

Query:  10 TDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLEREARICRLLKH 69
           .| ...  |||.|| |.| || .  . . || |..        | . .  |  .   | |
Sbjct:  43 SDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLK----KTVDKKIVRTEIGVLLRLSH 98

Query:  70 PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHVN 129
           |||..| .         || .||||||||. || . |||| ||.  ..||||.| . | |
Sbjct:  99 PNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHEN 158

Query: 130 GIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDP 189
           ||||||||||||| |.    | .|.|||||. ..   |       ||||| .||.||   
Sbjct: 159 GIVHRDLKPENLLYATPAPDAPLKIADFGLS-KIVEHQVLMKTVCGTPGYCAPEILRGCA 217

Query: 190 YGKPVDMWACGVILYILLVGYPPFWDE--DQHRLYQQIKAGAYDFPSPEWDTVTPEAKDL 247
           ||  ||||. |.| |||| |. ||.||  ||  ....|    | | || || |.  ||||
Sbjct: 218 YGPEVDMWSVGIITYILLCGFEPFYDERGDQF-MFRRILNCEYYFISPWWDEVSLNAKDL 276

Query: 248 INKMLTINPSKRITASEALKHPWICQRSTVASMMHRQETVECLKKFNARR 297
           . |.. ..| ||.|  .||.|||.  ..  |. .|     . |..|||||
Sbjct: 277 VRKLIVLDPKKRLTTFQALQHPWVTGKA--ANFVHMDTAQKKLQEFNARR 324

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,422,265
Number of Sequences: 45480
Number of Extensions: 193422265
Number of Successful Extensions: 11204551
Number of sequences better than 0.0: 0
BLASTP 7.6.0