BLASTP 7.6.0


Query=fugu4_740742 |jgi|Takru4|740742|fgh5_pg.C_scaffold_327000009
        (366 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001htl |1|NM_145257|Q96BM2|Q96BM2_HUMAN|C1orf96|NM_14525...     68   2e-011
hg18||uc001htl |1|NM_145257|Q96BM2|Q96BM2_HUMAN|C1orf96|NM_14525...     42   8e-004
hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|H...     29   7.369

>hg18||uc001htl
        |1|NM_145257|Q96BM2|Q96BM2_HUMAN|C1orf96|NM_145257|NP_660300|hypothetic
        al protein LOC126731

          Length = 270

 Score =  68 bits (164), Expect = 2e-011
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 19/150 (12%)

Query:  48 IRTEYMKKFRDPKWETFSKCYEDSLKYRLTRRVMEHSHKPWFWEXXXXXXXXXXXXTPRL 107
           ...||||....|.|| .  || . | ||| ||..| .| || |.            .   
Sbjct:   7 VKSEYMKRYQEPRWEEYGPCYGELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSES 66

Query: 108 S-SNKVVPLSLPPPTALETNQRSSGPGPELPPQDEENEKVA--VIDGGQAAVAENGADEV 164
           | .    |   ||          | | |  |   || |. |    .   |   .  |.. 
Sbjct:  67 SGAGGPAPRCAPP----------SPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDA 116

Query: 165 SGAATEAVP---DNCRPSDDT---ETDDGP 188
             ||  |.|      .|   |   |||  |
Sbjct: 117 EDAALPALPVKDVEDKPEQQTRTRETDKSP 146

>hg18||uc001htl
        |1|NM_145257|Q96BM2|Q96BM2_HUMAN|C1orf96|NM_145257|NP_660300|hypothetic
        al protein LOC126731

          Length = 270

 Score =  42 bits (98), Expect = 8e-004
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 260 QTHRGSSKRSSNLDRRRARSADLEKVVKQSQLNAVDDRWMTEYMRCFSAR 309
           .  |   ||     |.|| | |.||  .. . .. .. ||||||||.|||
Sbjct: 221 KNRRQVEKRKLVAQRQRAHSVDVEK-NRKMKASSSENPWMTEYMRCYSAR 269

>hg18||uc002oxb |19|BC034980|Q4G0Z0|Q4G0Z0_HUMAN|BC034980|NA|NA|Hypothetical
        protein (Fragment)

          Length = 715

 Score =  29 bits (64), Expect = 7.369
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 217 QNSSAGKPPRAKSQPAISNKEIQRSNRLDLTERN-TENTSDACVQTHRGSSKRSSNLDRR 275
           |. |. |    .   . | .  .| .|    ||. ... | .  . || |   |   |||
Sbjct: 511 QSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRSPSEEREHRQSRSPSKERDRR 570

Query: 276 RARSADLEKVVKQSQ 290
           | ||   |.  .||.
Sbjct: 571 RWRSPSKERERRQSR 585

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,504,799
Number of Sequences: 45480
Number of Extensions: 192504799
Number of Successful Extensions: 11219916
Number of sequences better than 0.0: 0
BLASTP 7.6.0