BLASTP 7.6.0


Query=fugu4_740566 |jgi|Takru4|740566|fgh5_pg.C_scaffold_316000013
        (175 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002joc |17|NM_020753|Q8WXE0|CSKI2_HUMAN|CASKIN2|NM_02075...    107   6e-024
hg18||uc002jod |17|BC032359|NA|NA|KIAA1139|NA|NA|Homo sapiens mR...    107   6e-024
hg18||uc002cox |16|NM_020764|Q8WXD9|CSKI1_HUMAN|CASKIN1|NM_02076...    101   5e-022
hg18||uc003ojx |6|NM_015245|Q92625|ANKS1_HUMAN|ANKS1A|NM_015245|...     57   1e-008
hg18||uc001tge |12|NM_152788|Q7Z6G8|Q7Z6G8_HUMAN|ANKS1B|NM_15278...     53   1e-007
hg18||uc003wss |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP...     39   0.003
hg18||uc002ntn |19|NM_032139|Q86UC3|Q86UC3_HUMAN|ANKRD27|NM_0321...     38   0.005
hg18||uc001khp |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|...     38   0.006
hg18||uc003ztc |9|NM_001013728|Q5W0G2|Q5W0G2_HUMAN|RP11-255A11.5...     38   0.006
hg18||uc003ojx |6|NM_015245|Q92625|ANKS1_HUMAN|ANKS1A|NM_015245|...     37   0.008
hg18||uc003pnf |6|AB023174|Q5JUJ5|Q5JUJ5_HUMAN|ANKRD6|NM_014942|...     35   0.041
hg18||uc003ysz |8|AB033075|Q9ULH1-2|Q9ULH1-2|DDEF1|NM_018482|NP_...     35   0.041
hg18||uc003yta |8|NM_018482|Q9ULH1|DDEF1_HUMAN|DDEF1|NM_018482|N...     35   0.041
hg18||uc001khp |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|...     35   0.053
hg18||uc001tge |12|NM_152788|Q7Z6G8|Q7Z6G8_HUMAN|ANKS1B|NM_15278...     35   0.053
hg18||uc001vuz |14|NM_001005356|Q6S5H5-3|Q6S5H5-3|ACTBL1|NM_0010...     35   0.053
hg18||uc003pne |6|NM_014942|Q8IUQ8|Q8IUQ8_HUMAN|ANKRD6|NM_014942...     35   0.053
hg18||uc003wss |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP...     35   0.053
hg18||uc001khp |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|...     34   0.070
hg18||uc001khp |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|...     34   0.091
hg18||uc003ibc |4|AK095596|NA|NA|ANK2|NM_020977|NP_066187|ankyri...     34   0.091
hg18||uc003ibc |4|AK095596|NA|NA|ANK2|NM_020977|NP_066187|ankyri...     34   0.091
hg18||uc003ibd |4|BX537758|Q7Z3L5|Q7Z3L5_HUMAN|ANK2|NM_020977|NP...     34   0.091
hg18||uc003ibd |4|BX537758|Q7Z3L5|Q7Z3L5_HUMAN|ANK2|NM_020977|NP...     34   0.091
hg18||uc003ibe |4|NM_001148|Q01484|ANK2_HUMAN|ANK2|NM_001148|NP_...     34   0.091
hg18||uc003ibe |4|NM_001148|Q01484|ANK2_HUMAN|ANK2|NM_001148|NP_...     34   0.091
hg18||uc003ibf |4|NM_020977|Q01484-2|Q01484-2|ANK2|NM_020977|NP_...     34   0.091
hg18||uc003ibf |4|NM_020977|Q01484-2|Q01484-2|ANK2|NM_020977|NP_...     34   0.091
hg18||uc001vwc |14|AY462874|Q6S5H5-3|Q6S5H5-3|ACTBL1|NM_00100535...     33   0.119
hg18||uc002zli |22|NM_001004053|Q6S545|POT22_HUMAN|ACTBL1|NM_001...     33   0.119
hg18||uc002zlj |22|BC127623|NA|NA|ACTBL1|NA|NA|Homo sapiens POTE...     33   0.119
hg18||uc003pne |6|NM_014942|Q8IUQ8|Q8IUQ8_HUMAN|ANKRD6|NM_014942...     33   0.119
hg18||uc003pnf |6|AB023174|Q5JUJ5|Q5JUJ5_HUMAN|ANKRD6|NM_014942|...     33   0.119
hg18||uc003xoi |8|NM_000037|P16157-3|P16157-3|ANK1|NM_000037|NP_...     33   0.119
hg18||uc003xoj |8|NM_020475|P16157-5|P16157-5|ANK1|NM_020475|NP_...     33   0.119
hg18||uc003xok |8|NM_020476|P16157|ANK1_HUMAN|ANK1|NM_020476|NP_...     33   0.119
hg18||uc003xol |8|NM_020477|P16157-4|P16157-4|ANK1|NM_020477|NP_...     33   0.119
hg18||uc003xom |8|AB209418|P16157-21|P16157-21|ANK1|NM_020475|NP...     33   0.119
hg18||uc001bgy |1|AK000206|Q8TDY4-2|Q8TDY4-2|DDEFL1|NM_017707|NP...     33   0.156
hg18||uc001bha |1|NM_017707|Q8TDY4|DDFL1_HUMAN|DDEFL1|NM_017707|...     33   0.156
hg18||uc001bhb |1|AK000253|Q9NXH7|Q9NXH7_HUMAN|DDEFL1|NM_017707|...     33   0.156
hg18||uc002tsk |2|NM_001005364|Q6S8J3-2|Q6S8J3-2|POTE2|NM_001005...     33   0.156
hg18||uc002tsl |2|NM_001004054|Q6S8J3-3|Q6S8J3-3|POTE2|NM_001004...     33   0.156
hg18||uc002tsm |2|NM_001005359|Q6S8J3-3|Q6S8J3-3|POTE2|NM_001005...     33   0.156
hg18||uc002tsn |2|AY462871|Q6S8J3|POTE2_HUMAN|POTE2|NA|NA|Prosta...     33   0.156
hg18||uc001agg |1|NM_080875|Q96AX9|MIB2_HUMAN|MIB2|NM_080875|NP_...     33   0.203
hg18||uc001agh |1|BC016490|Q96AX9-2|Q96AX9-2|MIB2|NM_080875|NP_5...     33   0.203
hg18||uc001agi |1|AB076693|Q96AX9-3|Q96AX9-3|MIB2|NM_080875|NP_5...     33   0.203
hg18||uc001agj |1|AK122751|NA|NA|DKFZp434A0311|NA|NA|Homo sapien...     33   0.203
hg18||uc001agk |1|AB076692|Q96AX9-4|Q96AX9-4|MIB2|NM_080875|NP_5...     33   0.203
hg18||uc001agl |1|AK098785|Q8N786|Q8N786_HUMAN|MIB2|NM_080875|NP...     33   0.203
hg18||uc001agm |1|AK128167|Q8N786|Q8N786_HUMAN|DKFZp434A0311|NA|...     33   0.203
hg18||uc001agn |1|AX747093|Q96AX9-6|Q96AX9-6|MIB2|NM_080875|NP_5...     33   0.203
hg18||uc001ytu |15|NM_207355|Q6S5H4|POT15_HUMAN|POTE15|NM_207355...     33   0.203
hg18||uc002yjb |21|NM_174981|Q86YR6|ANR21_HUMAN|ANKRD21|NM_17498...     33   0.203
hg18||uc003koi |5|NM_031438|Q9BQG2|NUD12_HUMAN|NUDT12|NM_031438|...     33   0.203
hg18||uc001iif |10|NM_024701|NA|NA|ASB13|NA|NA|Homo sapiens cDNA...     32   0.265
hg18||uc001iig |10|NM_024701|Q8WXK3|ASB13_HUMAN|ASB13|NM_024701|...     32   0.265
hg18||uc003diq |3|AL832472|NA|NA|ASB14|NA|NA|Homo sapiens ankyri...     32   0.265
hg18||uc003ojx |6|NM_015245|Q92625|ANKS1_HUMAN|ANKS1A|NM_015245|...     32   0.265
hg18||uc003vku |7|AK125360|Q8WXK1|ASB15_HUMAN|ASB15|NM_080928|NP...     32   0.265
hg18||uc003vkv |7|BC100877|NA|NA|ASB15|NM_080928|NP_563616|ankyr...     32   0.265
hg18||uc003vkw |7|NM_080928|Q8WXK1|ASB15_HUMAN|ASB15|NM_080928|N...     32   0.265
hg18||uc003wss |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP...     32   0.265
hg18||uc002vyz |2|NM_016552|Q9P2S6|ANKY1_HUMAN|ANKMY1|NM_016552|...     32   0.347
hg18||uc001khp |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|...     32   0.453
hg18||uc001dgc |1|BX640903|Q59H18-3|Q59H18-3|TNNI3K|NA|NA|Serine...     31   0.591
hg18||uc001dgd |1|BC032865|Q59H18-4|Q59H18-4|TNNI3K|NA|NA|Serine...     31   0.591
hg18||uc001dge |1|AB208941|Q59H18|TNI3K_HUMAN|TNNI3K|NA|NA|Serin...     31   0.591
hg18||uc001dgf |1|NM_015978|Q59H18-2|Q59H18-2|TNNI3K|NM_015978|N...     31   0.591
hg18||uc001wtg |14|CR615977|NA|NA|NFKBIA|NM_020529|NP_065390|nuc...     31   0.591
hg18||uc002sxd |2|NM_016466|Q53RE8|ANR39_HUMAN|ANKRD39|NM_016466...     31   0.591
hg18||uc003hgo |4|BX648035|O75179|O75179_HUMAN|ANKRD17|NM_032217...     31   0.591
hg18||uc003hgp |4|NM_032217|O75179|O75179_HUMAN|ANKRD17|NM_03221...     31   0.591
hg18||uc003hgq |4|NM_198889|O75179|O75179_HUMAN|ANKRD17|NM_19888...     31   0.591
hg18||uc003hgr |4|AB014597|O75179|O75179_HUMAN|ANKRD17|NM_032217...     31   0.591
hg18||uc003lfo |5|NM_024668|Q8WY90|Q8WY90_HUMAN|ANKHD1|NM_024668...     31   0.591
hg18||uc003lfp |5|NM_017978|Q96GK0|Q96GK0_HUMAN|ANKHD1|NM_017978...     31   0.591
hg18||uc003lfq |5|AK074173|Q8TEF1|Q8TEF1_HUMAN|ANKHD1|NM_017747|...     31   0.591
hg18||uc003lfr |5|NM_017747|Q8IWZ3|Q8IWZ3_HUMAN|ANKHD1|NM_017747...     31   0.591
hg18||uc003lfs |5|NM_020690|Q8IWZ2|Q8IWZ2_HUMAN|MASK-BP3|NM_0206...     31   0.591
hg18||uc004apc |9|AB208871|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|N...     31   0.591
hg18||uc004apd |9|NM_004938|Q1W5W0|Q1W5W0_HUMAN|DAPK1|NM_004938|...     31   0.591
hg18||uc004ape |9|CR626501|NA|NA|DAPK1|NA|NA|Homo sapiens mRNA f...     31   0.591
hg18||uc004apf |9|AK127855|Q6ZRZ3|Q6ZRZ3_HUMAN|DAPK1|NA|NA|CDNA ...     31   0.591
hg18||uc004evb |X|NM_021946|Q8TEN3|Q8TEN3_HUMAN|BCORL1|NM_021946...     31   0.591
hg18||uc004evc |X|AK124676|NA|NA|FLJ00160|NA|NA|Homo sapiens cDN...     31   0.591
hg18||uc003ifg |4|NM_020337|Q9ULJ7|ANR50_HUMAN|ANKRD50|NM_020337...     31   0.772
hg18||uc003wss |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP...     31   0.772
hg18||uc003zcu |8|NM_013432|Q96HA7|Q96HA7_HUMAN|NFKBIL2|NM_01343...     31   0.772
hg18||uc001wte |14|CR603242|P25963|IKBA_HUMAN|NFKBIA|NM_020529|N...     30   1.008
hg18||uc001wtf |14|NM_020529|P25963|IKBA_HUMAN|NFKBIA|NM_020529|...     30   1.008
hg18||uc003xpz |8|NM_001005365|Q6S8J7|POTE8_HUMAN|POTE8|NM_00100...     30   1.008
hg18||uc003xqa |8|NM_001002920|Q6S8J7-2|Q6S8J7-2|POTE8|NM_001002...     30   1.008
hg18||uc002cox |16|NM_020764|Q8WXD9|CSKI1_HUMAN|CASKIN1|NM_02076...     30   1.317
hg18||uc003pne |6|NM_014942|Q8IUQ8|Q8IUQ8_HUMAN|ANKRD6|NM_014942...     30   1.317
hg18||uc003pnf |6|AB023174|Q5JUJ5|Q5JUJ5_HUMAN|ANKRD6|NM_014942|...     30   1.317
hg18||uc001skm |12|AK125379|Q8NB46|ANR52_HUMAN|ANKRD52|NA|NA|Ank...     30   1.720
hg18||uc002joc |17|NM_020753|Q8WXE0|CSKI2_HUMAN|CASKIN2|NM_02075...     30   1.720
hg18||uc002jod |17|BC032359|NA|NA|KIAA1139|NA|NA|Homo sapiens mR...     30   1.720

>hg18||uc002joc
        |17|NM_020753|Q8WXE0|CSKI2_HUMAN|CASKIN2|NM_020753|NP_065804|cask-inter
        acting protein 2

          Length = 1202

 Score =  107 bits (267), Expect = 6e-024
 Identities = 54/64 (84%), Positives = 58/64 (90%)

Query:   1 MNRLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIK 60
           .|| || || |||||||||||||||||. |..||| ||||||||||||||||| ||||||
Sbjct: 215 INRQTKTGTALHEAALYGKTEVVRLLLEGGVDVNIRNTYNQTALDIVNQFTTSQASREIK 274

Query:  61 QLLR 64
           ||||
Sbjct: 275 QLLR 278

>hg18||uc002jod |17|BC032359|NA|NA|KIAA1139|NA|NA|Homo sapiens mRNA for KIAA1139
        protein, partial cds

          Length = 323

 Score =  107 bits (267), Expect = 6e-024
 Identities = 54/64 (84%), Positives = 58/64 (90%)

Query:   1 MNRLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIK 60
           .|| || || |||||||||||||||||. |..||| ||||||||||||||||| ||||||
Sbjct: 215 INRQTKTGTALHEAALYGKTEVVRLLLEGGVDVNIRNTYNQTALDIVNQFTTSQASREIK 274

Query:  61 QLLR 64
           ||||
Sbjct: 275 QLLR 278

>hg18||uc002cox
        |16|NM_020764|Q8WXD9|CSKI1_HUMAN|CASKIN1|NM_020764|NP_065815|CASK
        interacting protein 1

          Length = 1431

 Score =  101 bits (251), Expect = 5e-022
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 4/75 (5%)

Query:   1 MNRLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIK 60
           .|| ||.|| |||||| |||||||||||.||| .. |||.|||||||.||||| ||||||
Sbjct: 215 INRQTKSGTALHEAALCGKTEVVRLLLDSGINAHVRNTYSQTALDIVHQFTTSQASREIK 274

Query:  61 QLLR----VIPVRST 71
           ||||     . ||.|
Sbjct: 275 QLLREASAALQVRAT 289

>hg18||uc003ojx
        |6|NM_015245|Q92625|ANKS1_HUMAN|ANKS1A|NM_015245|NP_056060|ankyrin
        repeat and sterile alpha motif domain

          Length = 1134

 Score =  57 bits (136), Expect = 1e-008
 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 4/83 (4%)

Query:   2 NRLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQ 61
           |  |. |. ||||||.|||.||..|| || .||| . .  |||| | .      |.. .|
Sbjct: 242 NYQTEMGSALHEAALFGKTDVVQILLAAGTDVNIKDNHGLTALDTVREL----PSQKSQQ 297

Query:  62 LLRVIPVRSTPNEGTDVAPKAAP 84
           .  .|    |    |    |  |
Sbjct: 298 IAALIEDHMTGKRSTKEVDKTPP 320

>hg18||uc001tge
        |12|NM_152788|Q7Z6G8|Q7Z6G8_HUMAN|ANKS1B|NM_152788|NP_690001|cajalin 2
        isoform a

          Length = 1248

 Score =  53 bits (126), Expect = 1e-007
 Identities = 28/60 (46%), Positives = 42/60 (70%), Gaps = 1/60 (1%)

Query:   5 TKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLR 64
           |. |. ||||||.|| .|||.||. ||. || ..  .| |||. .   |  | .|  ||.
Sbjct: 224 TEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEH-PSQKSLQIATLLQ 282

>hg18||uc003wss
        |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP_003738|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1327

 Score =  39 bits (89), Expect = 0.003
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQ 61
           | |||||. || .|  .||  | . || ||  ..|||. .    .  . | |.
Sbjct: 284 TPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKK 336

>hg18||uc002ntn
        |19|NM_032139|Q86UC3|Q86UC3_HUMAN|ANKRD27|NM_032139|NP_115515|ankyrin
        repeat domain 27 (VPS9 domain)

          Length = 1050

 Score =  38 bits (87), Expect = 0.005
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRV 65
           |  | |||| .     || |||  | .| . |   .||.|   |      . .| .||.|
Sbjct: 842 KGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQ------NSKIMELLQV 895

Query:  66 IP 67
           .|
Sbjct: 896 VP 897

>hg18||uc001khp
        |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|NP_079511|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1166

 Score =  38 bits (86), Expect = 0.006
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQ 61
           | |||||. || .|  .||  |    | ||  .||||. .    .  . | |.
Sbjct: 126 TPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKK 178

>hg18||uc003ztc
        |9|NM_001013728|Q5W0G2|Q5W0G2_HUMAN|RP11-255A11.5-0|NM_001013728|NP_001
        013750|Ankyrin repeat domain 18B

          Length = 1117

 Score =  38 bits (86), Expect = 0.006
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           |  | || |  .|. .|| ||||    .|||.  |.| |
Sbjct:  67 KDRTVLHLACAHGRVQVVTLLLDRKCQINICDRLNRTPL 105

>hg18||uc003ojx
        |6|NM_015245|Q92625|ANKS1_HUMAN|ANKS1A|NM_015245|NP_056060|ankyrin
        repeat and sterile alpha motif domain

          Length = 1134

 Score =  37 bits (85), Expect = 0.008
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query:   3 RLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDI 46
           |  |  | |  |||||. |||..||.|  |.  |||   | | .
Sbjct: 178 RNNKFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHL 221

>hg18||uc003pnf
        |6|AB023174|Q5JUJ5|Q5JUJ5_HUMAN|ANKRD6|NM_014942|NP_055757|ankyrin
        repeat domain 6

          Length = 692

 Score =  35 bits (79), Expect = 0.041
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASR 57
           | ||||. .| ..  .||. || ||   |    ||| .  | . | ..|
Sbjct: 110 TALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTR 158

>hg18||uc003ysz
        |8|AB033075|Q9ULH1-2|Q9ULH1-2|DDEF1|NM_018482|NP_060952|development and
        differentiation enhancing factor

          Length = 940

 Score =  35 bits (79), Expect = 0.041
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQ 61
           | ||  ..| | | ..||| .   |.| |   .|||||  .   .     . |
Sbjct: 450 TVLHYCSMYSKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQ 502

>hg18||uc003yta
        |8|NM_018482|Q9ULH1|DDEF1_HUMAN|DDEF1|NM_018482|NP_060952|development
        and differentiation enhancing factor

          Length = 1129

 Score =  35 bits (79), Expect = 0.041
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQ 61
           | ||  ..| | | ..||| .   |.| |   .|||||  .   .     . |
Sbjct: 639 TVLHYCSMYSKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQ 691

>hg18||uc001khp
        |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|NP_079511|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1166

 Score =  35 bits (78), Expect = 0.053
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query:   7 AGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVN 48
           | | |||||  |.|..  |||  | .  . |   || ||.|.
Sbjct: 745 AFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVS 786

>hg18||uc001tge
        |12|NM_152788|Q7Z6G8|Q7Z6G8_HUMAN|ANKS1B|NM_152788|NP_690001|cajalin 2
        isoform a

          Length = 1248

 Score =  35 bits (78), Expect = 0.053
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query:   3 RLTKAGTCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDI 46
           | .|  | |  |||||.  ||.... |  |.  |||   | | .
Sbjct: 157 RNSKLETPLDLAALYGRLRVVKMIISAHPNLMSCNTRKHTPLHL 200

>hg18||uc001vuz
        |14|NM_001005356|Q6S5H5-3|Q6S5H5-3|ACTBL1|NM_001005356|NP_001005356|pro
        tein expressed in prostate, ovary, testis,

          Length = 508

 Score =  35 bits (78), Expect = 0.053
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIPV 68
           | || |.  | .|||.||||    .|| .   .|||      | .   || .  | ..  
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL------TKAVQCREDECALMLLEH 228

Query:  69 RSTPN 73
            . ||
Sbjct: 229 GTDPN 233

>hg18||uc003pne
        |6|NM_014942|Q8IUQ8|Q8IUQ8_HUMAN|ANKRD6|NM_014942|NP_055757|ankyrin
        repeat domain 6

          Length = 722

 Score =  35 bits (78), Expect = 0.053
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASR 57
           | ||||. .| ..  .||. || ||   |    ||| .  | . | ..|
Sbjct: 110 TALHEASWHGFSQSAKLLVKAGANVLAKNKAGNTALHLACQNSHSQSTR 158

>hg18||uc003wss
        |8|NM_003747|O95271|TNKS1_HUMAN|TNKS|NM_003747|NP_003738|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1327

 Score =  35 bits (78), Expect = 0.053
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLR 64
           | |||||  || |. .|||  | .    |    | ||.| .  |     .|. |||
Sbjct: 752 TPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDT-----DIQDLLR 802

>hg18||uc001khp
        |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|NP_079511|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1166

 Score =  34 bits (77), Expect = 0.070
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLR 64
           | |||||  || |. .|||  | .    |    | ||.|    |     .|. |||
Sbjct: 594 TPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDT-----DIQDLLR 644

>hg18||uc001khp
        |10|NM_025235|Q9H2K2|TNKS2_HUMAN|TNKS2|NM_025235|NP_079511|tankyrase,
        TRF1-interacting ankyrin-related

          Length = 1166

 Score =  34 bits (76), Expect = 0.091
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDI 46
           | |||||   . ||  |||  | .  . | .|..|.|.
Sbjct: 279 TPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDL 316

>hg18||uc003ibc |4|AK095596|NA|NA|ANK2|NM_020977|NP_066187|ankyrin 2 isoform 2

          Length = 1102

 Score =  34 bits (76), Expect = 0.091
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query:   2 NRLTKAG-TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | .|| | | || |.  | |..| |||| | |...      |.| .  |
Sbjct: 632 NIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 680

>hg18||uc003ibc |4|AK095596|NA|NA|ANK2|NM_020977|NP_066187|ankyrin 2 isoform 2

          Length = 1102

 Score =  34 bits (76), Expect = 0.091
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLL---RV 65
           | || ||  |. |||| ||  |  |.      || | | ..        || |||     
Sbjct: 442 TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL----GKTEIVQLLLQHMA 497

Query:  66 IPVRSTPNEGTDVAPKAAPGSWSEEALGITTGATLGASGLITRRG 110
            |  .| |  | .   |  |     .. .  ||   |  | |..|
Sbjct: 498 HPDAATTNGYTPLHISAREGQVDVASVLLEAGA---AHSLATKKG 539

>hg18||uc003ibd |4|BX537758|Q7Z3L5|Q7Z3L5_HUMAN|ANK2|NM_020977|NP_066187|ankyrin
        2 isoform 2

          Length = 1860

 Score =  34 bits (76), Expect = 0.091
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query:   2 NRLTKAG-TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | .|| | | || |.  | |..| |||| | |...      |.| .  |
Sbjct: 632 NIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 680

>hg18||uc003ibd |4|BX537758|Q7Z3L5|Q7Z3L5_HUMAN|ANK2|NM_020977|NP_066187|ankyrin
        2 isoform 2

          Length = 1860

 Score =  34 bits (76), Expect = 0.091
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLL---RV 65
           | || ||  |. |||| ||  |  |.      || | | ..        || |||     
Sbjct: 442 TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL----GKTEIVQLLLQHMA 497

Query:  66 IPVRSTPNEGTDVAPKAAPGSWSEEALGITTGATLGASGLITRRG 110
            |  .| |  | .   |  |     .. .  ||   |  | |..|
Sbjct: 498 HPDAATTNGYTPLHISAREGQVDVASVLLEAGA---AHSLATKKG 539

>hg18||uc003ibe |4|NM_001148|Q01484|ANK2_HUMAN|ANK2|NM_001148|NP_001139|ankyrin
        2 isoform 1

          Length = 3957

 Score =  34 bits (76), Expect = 0.091
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query:   2 NRLTKAG-TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | .|| | | || |.  | |..| |||| | |...      |.| .  |
Sbjct: 656 NIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 704

>hg18||uc003ibe |4|NM_001148|Q01484|ANK2_HUMAN|ANK2|NM_001148|NP_001139|ankyrin
        2 isoform 1

          Length = 3957

 Score =  34 bits (76), Expect = 0.091
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLL---RV 65
           | || ||  |. |||| ||  |  |.      || | | ..        || |||     
Sbjct: 466 TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL----GKTEIVQLLLQHMA 521

Query:  66 IPVRSTPNEGTDVAPKAAPGSWSEEALGITTGATLGASGLITRRG 110
            |  .| |  | .   |  |     .. .  ||   |  | |..|
Sbjct: 522 HPDAATTNGYTPLHISAREGQVDVASVLLEAGA---AHSLATKKG 563

>hg18||uc003ibf |4|NM_020977|Q01484-2|Q01484-2|ANK2|NM_020977|NP_066187|ankyrin
        2 isoform 2

          Length = 1872

 Score =  34 bits (76), Expect = 0.091
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query:   2 NRLTKAG-TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | .|| | | || |.  | |..| |||| | |...      |.| .  |
Sbjct: 656 NIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 704

>hg18||uc003ibf |4|NM_020977|Q01484-2|Q01484-2|ANK2|NM_020977|NP_066187|ankyrin
        2 isoform 2

          Length = 1872

 Score =  34 bits (76), Expect = 0.091
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLL---RV 65
           | || ||  |. |||| ||  |  |.      || | | ..        || |||     
Sbjct: 466 TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL----GKTEIVQLLLQHMA 521

Query:  66 IPVRSTPNEGTDVAPKAAPGSWSEEALGITTGATLGASGLITRRG 110
            |  .| |  | .   |  |     .. .  ||   |  | |..|
Sbjct: 522 HPDAATTNGYTPLHISAREGQVDVASVLLEAGA---AHSLATKKG 563

>hg18||uc001vwc
        |14|AY462874|Q6S5H5-3|Q6S5H5-3|ACTBL1|NM_001005356|NP_001005356|protein
        expressed in prostate, ovary, testis,

          Length = 508

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|| .   .|||
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL 210

>hg18||uc002zli
        |22|NM_001004053|Q6S545|POT22_HUMAN|ACTBL1|NM_001004053|NP_001004053|pr
        otein expressed in prostate, ovary, testis,

          Length = 288

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|| .   .|||
Sbjct: 212 TALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL 247

>hg18||uc002zlj |22|BC127623|NA|NA|ACTBL1|NA|NA|Homo sapiens POTE14B mRNA,
        complete cds, alternatively spliced

          Length = 341

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query:  9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
          | || |.  | .|||.||||    .|| .   .|||
Sbjct: 47 TALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL 82

>hg18||uc003pne
        |6|NM_014942|Q8IUQ8|Q8IUQ8_HUMAN|ANKRD6|NM_014942|NP_055757|ankyrin
        repeat domain 6

          Length = 722

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDI 46
           |||| || |    ..|||| |  .|.  |    ||| .
Sbjct: 176 TCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHV 213

>hg18||uc003pnf
        |6|AB023174|Q5JUJ5|Q5JUJ5_HUMAN|ANKRD6|NM_014942|NP_055757|ankyrin
        repeat domain 6

          Length = 692

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDI 46
           |||| || |    ..|||| |  .|.  |    ||| .
Sbjct: 176 TCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHV 213

>hg18||uc003xoi |8|NM_000037|P16157-3|P16157-3|ANK1|NM_000037|NP_000028|ankyrin
        1 isoform 3

          Length = 1880

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVN 34
           |  | || ||| |. |||| |.. | |||
Sbjct:  77 KGNTALHIAALAGQDEVVRELVNYGANVN 105

>hg18||uc003xoj |8|NM_020475|P16157-5|P16157-5|ANK1|NM_020475|NP_065208|ankyrin
        1 isoform 4

          Length = 1856

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVN 34
           |  | || ||| |. |||| |.. | |||
Sbjct:  77 KGNTALHIAALAGQDEVVRELVNYGANVN 105

>hg18||uc003xok |8|NM_020476|P16157|ANK1_HUMAN|ANK1|NM_020476|NP_065209|ankyrin
        1 isoform 1

          Length = 1881

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVN 34
           |  | || ||| |. |||| |.. | |||
Sbjct:  77 KGNTALHIAALAGQDEVVRELVNYGANVN 105

>hg18||uc003xol |8|NM_020477|P16157-4|P16157-4|ANK1|NM_020477|NP_065210|ankyrin
        1 isoform 2

          Length = 1719

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVN 34
           |  | || ||| |. |||| |.. | |||
Sbjct:  77 KGNTALHIAALAGQDEVVRELVNYGANVN 105

>hg18||uc003xom |8|AB209418|P16157-21|P16157-21|ANK1|NM_020475|NP_065208|ankyrin
        1 isoform 4

          Length = 1897

 Score =  33 bits (75), Expect = 0.119
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query:   6 KAGTCLHEAALYGKTEVVRLLLDAGINVN 34
           |  | || ||| |. |||| |.. | |||
Sbjct: 110 KGNTALHIAALAGQDEVVRELVNYGANVN 138

>hg18||uc001bgy
        |1|AK000206|Q8TDY4-2|Q8TDY4-2|DDEFL1|NM_017707|NP_060177|development
        and differentiation enhancing

          Length = 407

 Score =  33 bits (74), Expect = 0.156
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | || |||| . . ..|||     |   |   .|||||  .
Sbjct: 128 TALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARK 168

>hg18||uc001bha
        |1|NM_017707|Q8TDY4|DDFL1_HUMAN|DDEFL1|NM_017707|NP_060177|development
        and differentiation enhancing

          Length = 903

 Score =  33 bits (74), Expect = 0.156
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | || |||| . . ..|||     |   |   .|||||  .
Sbjct: 624 TALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARK 664

>hg18||uc001bhb
        |1|AK000253|Q9NXH7|Q9NXH7_HUMAN|DDEFL1|NM_017707|NP_060177|development
        and differentiation enhancing

          Length = 323

 Score =  33 bits (74), Expect = 0.156
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQ 49
           | || |||| . . ..|||     |   |   .|||||  .
Sbjct: 147 TALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARK 187

>hg18||uc002tsk
        |2|NM_001005364|Q6S8J3-2|Q6S8J3-2|POTE2|NM_001005364|NP_001005364|prote
        in expressed in prostate, ovary, testis,

          Length = 394

 Score =  33 bits (74), Expect = 0.156
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|. .   .|||
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTAL 210

>hg18||uc002tsl
        |2|NM_001004054|Q6S8J3-3|Q6S8J3-3|POTE2|NM_001004054|NP_001004054|prote
        in expressed in prostate, ovary, testis,

          Length = 376

 Score =  33 bits (74), Expect = 0.156
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|. .   .|||
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTAL 210

>hg18||uc002tsm
        |2|NM_001005359|Q6S8J3-3|Q6S8J3-3|POTE2|NM_001005359|NP_001005359|prote
        in expressed in prostate, ovary, testis,

          Length = 376

 Score =  33 bits (74), Expect = 0.156
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|. .   .|||
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTAL 210

>hg18||uc002tsn |2|AY462871|Q6S8J3|POTE2_HUMAN|POTE2|NA|NA|Prostate, ovary,
        testis-expressed protein on chromosome 2 (Fragment)

          Length = 712

 Score =  33 bits (74), Expect = 0.156
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTAL 44
           | || |.  | .|||.||||    .|. .   .|||
Sbjct: 175 TALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTAL 210

>hg18||uc001agg |1|NM_080875|Q96AX9|MIB2_HUMAN|MIB2|NM_080875|NP_543151|mindbomb
        homolog 2

          Length = 1013

 Score =  33 bits (73), Expect = 0.203
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIP- 67
           | || |   |  |||| | . | .||. . .. | |   .  .  | .  | ..|  .| 
Sbjct: 591 TALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLH--SAISAGTGASGIVEVLTEVPN 648

Query:  68 --VRSTPNEG 75
             | .| ..|
Sbjct: 649 IDVTATNSQG 658

>hg18||uc001agh |1|BC016490|Q96AX9-2|Q96AX9-2|MIB2|NM_080875|NP_543151|mindbomb
        homolog 2

          Length = 999

 Score =  33 bits (73), Expect = 0.203
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIP- 67
           | || |   |  |||| | . | .||. . .. | |   .  .  | .  | ..|  .| 
Sbjct: 577 TALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLH--SAISAGTGASGIVEVLTEVPN 634

Query:  68 --VRSTPNEG 75
             | .| ..|
Sbjct: 635 IDVTATNSQG 644

>hg18||uc001agi |1|AB076693|Q96AX9-3|Q96AX9-3|MIB2|NM_080875|NP_543151|mindbomb
        homolog 2

          Length = 1009

 Score =  33 bits (73), Expect = 0.203
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIP- 67
           | || |   |  |||| | . | .||. . .. | |   .  .  | .  | ..|  .| 
Sbjct: 587 TALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLH--SAISAGTGASGIVEVLTEVPN 644

Query:  68 --VRSTPNEG 75
             | .| ..|
Sbjct: 645 IDVTATNSQG 654

>hg18||uc001agj |1|AK122751|NA|NA|DKFZp434A0311|NA|NA|Homo sapiens mRNA for
        novelzin, partial cds

          Length = 854

 Score =  33 bits (73), Expect = 0.203
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIP- 67
           | || |   |  |||| | . | .||. . .. | |   .  .  | .  | ..|  .| 
Sbjct: 432 TALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLH--SAISAGTGASGIVEVLTEVPN 489

Query:  68 --VRSTPNEG 75
             | .| ..|
Sbjct: 490 IDVTATNSQG 499

>hg18||uc001agk |1|AB076692|Q96AX9-4|Q96AX9-4|MIB2|NM_080875|NP_543151|mindbomb
        homolog 2

          Length = 948

 Score =  33 bits (73), Expect = 0.203
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query:   9 TCLHEAALYGKTEVVRLLLDAGINVNICNTYNQTALDIVNQFTTSTASREIKQLLRVIP- 67
           | || |   |  |||| | . | .||. . .. | |   .  .  | .  | ..|  .| 
Sbjct: 526 TALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLH--SAISAGTGASGIVEVLTEVPN 583

Query:  68 --VRSTPNEG 75
             | .| ..|
Sbjct: 584 IDVTATNSQG 593

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,504,799
Number of Sequences: 45480
Number of Extensions: 192504799
Number of Successful Extensions: 11219916
Number of sequences better than 0.0: 0
BLASTP 7.6.0