BLASTP 7.6.0


Query=fugu4_740492 |jgi|Takru4|740492|fgh5_pg.C_scaffold_312000018
        (591 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001pym |11|NM_024806|Q6NUN7|Q6NUN7_HUMAN|C11orf63|NM_024...     79   1e-014
hg18||uc001vqj |13|NM_018011|Q6IQ34|Q6IQ34_HUMAN|FLJ10154|NM_018...     31   3.529
hg18||uc001vqk |13|AK001016|Q9NWB6|Q9NWB6_HUMAN|RP11-297I6.1|NA|...     31   3.529
hg18||uc003ocn |6|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_...     31   4.609
hg18||uc003ocp |6|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313H139|NA|N...     31   4.609
hg18||uc003ocq |6|BX648109|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_0...     31   4.609
hg18||uc003rov |6_cox_hap1|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_0...     31   4.609
hg18||uc003rox |6_cox_hap1|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313...     31   4.609
hg18||uc003roy |6_cox_hap1|BX648109|P25440|BRD2_HUMAN|BRD2|NM_00...     31   4.609
hg18||uc003sgg |6_qbl_hap2|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_0...     31   4.609
hg18||uc003sgi |6_qbl_hap2|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313...     31   4.609
hg18||uc003sgj |6_qbl_hap2|BX648109|P25440|BRD2_HUMAN|BRD2|NM_00...     31   4.609

>hg18||uc001pym
        |11|NM_024806|Q6NUN7|Q6NUN7_HUMAN|C11orf63|NM_024806|NP_079082|hypothet
        ical protein LOC79864 isoform 1

          Length = 778

 Score =  79 bits (194), Expect = 1e-014
 Identities = 48/126 (38%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 463 LKDYKQLKPDIELRGLGPDYRNIEKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKD 522
           || |.  | |..| |||||. .|    .|. .||.||  |.| |         |  |   
Sbjct: 647 LKGYQ--KRDVKLGGLGPDFESIRDKTQKLIQQKEYAKQVKEYNMKTLSILSKPQTEKTQ 704

Query: 523 NDQKVPRRKALEYAKTI--ARPSAPQQPRSNQAPRPRAFIEGLNVSDLSRLEVLKKRHEE 580
               .||.|||||||||   .||      | .   |    .  .. ..| ||.|. ||| 
Sbjct: 705 KKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEILQNRHER 764

Query: 581 EKMAFA 586
           || | |
Sbjct: 765 EKQAVA 770

>hg18||uc001vqj
        |13|NM_018011|Q6IQ34|Q6IQ34_HUMAN|FLJ10154|NM_018011|NP_060481|hypothet
        ical protein LOC55082

          Length = 273

 Score =  31 bits (69), Expect = 3.529
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 488 TAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAPQQ 547
           |      .|.  .  | ..|   ||    ..| | | ..  | ..      ..|    ..
Sbjct:  15 TKSSKHNKKRSRSRSRSRDKERVRKR-SKSRESKRNRRRESRSRSRSTNTAVSRRERDRE 73

Query: 548 PRSNQAPRPRAFIEGLNVSDLSRLEVLKKRHEEEKMA 584
             |  .|  |  | |  ||  | |.  .|| |||| |
Sbjct:  74 RAS--SPPDRIDIFGRTVSKRSSLDEKQKREEEEKKA 108

>hg18||uc001vqk |13|AK001016|Q9NWB6|Q9NWB6_HUMAN|RP11-297I6.1|NA|NA|CDNA
        FLJ10154 fis, clone HEMBA1003418 (OTTHUMP00000018683) (FLJ10154
        protein)

          Length = 273

 Score =  31 bits (69), Expect = 3.529
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 488 TAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAPQQ 547
           |      .|.  .  | ..|   ||    ..| | | ..  | ..      ..|    ..
Sbjct:  15 TKSSKHNKKRSRSRSRSRDKERVRKR-SKSRESKRNRRRESRSRSRSTNTAVSRRERDRE 73

Query: 548 PRSNQAPRPRAFIEGLNVSDLSRLEVLKKRHEEEKMA 584
             |  .|  |  | |  ||  | |.  .|| |||| |
Sbjct:  74 RAS--SPPDRIDIFGRTVSKRSSLDEKQKREEEEKKA 108

>hg18||uc003ocn
        |6|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromodomain
        containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

>hg18||uc003ocp |6|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313H139|NA|NA|Hypothetical
        protein DKFZp313H139

          Length = 681

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 394 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 450

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 451 EDDKGPRAPRP 461

>hg18||uc003ocq
        |6|BX648109|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromodomain
        containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

>hg18||uc003rov
        |6_cox_hap1|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromod
        omain containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

>hg18||uc003rox
        |6_cox_hap1|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313H139|NA|NA|Hypothetica
        l protein DKFZp313H139

          Length = 681

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 394 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 450

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 451 EDDKGPRAPRP 461

>hg18||uc003roy
        |6_cox_hap1|BX648109|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromodo
        main containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

>hg18||uc003sgg
        |6_qbl_hap2|NM_005104|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromod
        omain containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

>hg18||uc003sgi
        |6_qbl_hap2|AL832722|Q658Y7|Q658Y7_HUMAN|DKFZp313H139|NA|NA|Hypothetica
        l protein DKFZp313H139

          Length = 681

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 394 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 450

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 451 EDDKGPRAPRP 461

>hg18||uc003sgj
        |6_qbl_hap2|BX648109|P25440|BRD2_HUMAN|BRD2|NM_005104|NP_005095|bromodo
        main containing protein 2

          Length = 801

 Score =  31 bits (68), Expect = 4.609
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 486 EKTAEKMRRQKQYANTVREQNKNINRKPFIPTKEPKDNDQKVPRRKALEYAKTIARPSAP 545
           |. | ..   ..    | ||   ... |    |  ..  .|  .|||    |   |  | 
Sbjct: 514 EERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA---EKHRGRAGAD 570

Query: 546 QQPRSNQAPRP 556
           .  .  .||||
Sbjct: 571 EDDKGPRAPRP 581

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,631,354
Number of Sequences: 45480
Number of Extensions: 191631354
Number of Successful Extensions: 11116211
Number of sequences better than 0.0: 0
BLASTP 7.6.0