BLASTP 7.6.0


Query=fugu4_739780 |jgi|Takru4|739780|fgh5_pg.C_scaffold_287000014
        (438 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003oxi |6|NM_182539|Q5JU00|Q5JU00_HUMAN|MGC33600|NM_1825...    228   1e-059
hg18||uc003oxi |6|NM_182539|Q5JU00|Q5JU00_HUMAN|MGC33600|NM_1825...    135   1e-031
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...    103   5e-022
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     89   1e-017
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     82   9e-016
hg18||uc003tav |7|NM_006092|Q9Y239|CARD4_HUMAN|NOD1|NM_006092|NP...     79   1e-014
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     62   1e-009
hg18||uc002egm |16|NM_022162|Q9HC29|CAR15_HUMAN|NOD2|NM_022162|N...     57   3e-008
hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|N...     55   1e-007
hg18||uc002qma |19|NM_145007|P59045|NAL11_HUMAN|NLRP11|NM_145007...     55   1e-007
hg18||uc002qmb |19|AY168968|Q2TV85|Q2TV85_HUMAN|NLRP11|NM_145007...     55   1e-007
hg18||uc003ffx |3|NM_153353|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|...     52   2e-006
hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|N...     49   1e-005
hg18||uc002qme |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|...     49   1e-005
hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP...     49   1e-005
hg18||uc002ekk |16|NM_032206|Q86WI3|Q86WI3_HUMAN|NLRC5|NM_032206...     47   4e-005
hg18||uc002ekq |16|BC040278|Q6P4A6|Q6P4A6_HUMAN|NLRC5|NM_032206|...     47   4e-005
hg18||uc002ekr |16|AK027416|Q969L7|Q969L7_HUMAN|NLRC5|NM_032206|...     47   4e-005
hg18||uc002qmh |19|NM_176811|Q7RTR4|Q7RTR4_HUMAN|NLRP8|NM_176811...     47   6e-005
hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     44   3e-004
hg18||uc003ffy |3|BC028610|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|N...     44   3e-004
hg18||uc003ffz |3|CR606238|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|N...     44   3e-004
hg18||uc001icv |1|NM_183395|Q96P20-2|Q96P20-2|NLRP3|NM_183395|NP...     43   6e-004
hg18||uc003tav |7|NM_006092|Q9Y239|CARD4_HUMAN|NOD1|NM_006092|NP...     42   0.001
hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_...     42   0.002
hg18||uc003fga |3|AK095125|NA|NA|LRRC34|NA|NA|Homo sapiens cDNA ...     41   0.003
hg18||uc003zcu |8|NM_013432|Q96HA7|Q96HA7_HUMAN|NFKBIL2|NM_01343...     41   0.003
hg18||uc001icw |1|BC117211|Q96P20-4|Q96P20-4|NLRP3|NM_004895|NP_...     40   0.007
hg18||uc001xsx |14|NM_001081002|Q0VAA2|Q0VAA2_HUMAN|C14orf166B|N...     39   0.012
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...     37   0.045
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     37   0.045
hg18||uc002qcg |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|...     37   0.058
hg18||uc002qci |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     37   0.058
hg18||uc003ffy |3|BC028610|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|N...     37   0.058
hg18||uc003ffz |3|CR606238|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|N...     37   0.058
hg18||uc003fga |3|AK095125|NA|NA|LRRC34|NA|NA|Homo sapiens cDNA ...     37   0.058
hg18||uc001fql |1|NM_144702|Q96M24|Q96M24_HUMAN|C1orf92|NM_14470...     36   0.076
hg18||uc001fqm |1|BC033790|Q8N4P6|Q8N4P6_HUMAN|C1orf92|NA|NA|C1o...     36   0.076
hg18||uc002gcg |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001...     36   0.099
hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP...     36   0.099
hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|...     36   0.099
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...     36   0.099
hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|N...     36   0.099
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...     36   0.099
hg18||uc001lpk |11|AL161967|P13489|RINI_HUMAN|RNH1|NM_203389|NP_...     35   0.130
hg18||uc001lpl |11|NM_002939|P13489|RINI_HUMAN|RNH1|NM_002939|NP...     35   0.130
hg18||uc001lpm |11|NM_203385|P13489|RINI_HUMAN|RNH1|NM_203385|NP...     35   0.130
hg18||uc001lpn |11|NM_203383|P13489|RINI_HUMAN|RNH1|NM_203383|NP...     35   0.130
hg18||uc001lpo |11|NM_203384|P13489|RINI_HUMAN|RNH1|NM_203384|NP...     35   0.130
hg18||uc001lpp |11|NM_203387|P13489|RINI_HUMAN|RNH1|NM_203387|NP...     35   0.130
hg18||uc001lpq |11|NM_203389|P13489|RINI_HUMAN|RNH1|NM_203389|NP...     35   0.130
hg18||uc001lpr |11|NM_203386|P13489|RINI_HUMAN|RNH1|NM_203386|NP...     35   0.130
hg18||uc001lps |11|NM_203388|P13489|RINI_HUMAN|RNH1|NM_203388|NP...     35   0.130
hg18||uc001lpt |11|CR596248|Q59GB3|Q59GB3_HUMAN|DKFZp434K249|NA|...     35   0.130
hg18||uc002etn |16|NM_001013838|Q6F5E8|Q6F5E8_HUMAN|RLTPR|NM_001...     35   0.169
hg18||uc002etn |16|NM_001013838|Q6F5E8|Q6F5E8_HUMAN|RLTPR|NM_001...     35   0.221
hg18||uc001icr |1|NM_001079821|Q96P20|CIAS1_HUMAN|NLRP3|NM_00107...     34   0.289
hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_...     34   0.289
hg18||uc001icu |1|NM_004895|Q96P20|CIAS1_HUMAN|NLRP3|NM_004895|N...     34   0.289
hg18||uc002abk |15|NM_014548|Q9NZR1|TMOD2_HUMAN|TMOD2|NM_014548|...     33   0.493
hg18||uc002ekk |16|NM_032206|Q86WI3|Q86WI3_HUMAN|NLRC5|NM_032206...     33   0.644
hg18||uc002ekl |16|AK025362|NA|NA|NLRC5|NM_032206|NP_115582|nucl...     33   0.644
hg18||uc002ekm |16|BX640842|NA|NA|NLRC5|NM_032206|NP_115582|nucl...     33   0.644
hg18||uc003ney |6|NM_017640|Q5VZK9|Q5VZK9_HUMAN|LRRC16|NM_017640...     33   0.841
hg18||uc002gcg |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001...     32   1.098
hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP...     32   1.098
hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|...     32   1.098
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...     32   1.098
hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|N...     32   1.098
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...     32   1.098
hg18||uc003ffx |3|NM_153353|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|...     32   1.435
hg18||uc002cmy |16|NM_004970|P35858|ALS_HUMAN|IGFALS|NM_004970|N...     32   1.874
hg18||uc002qch |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687...     32   1.874
hg18||uc002qcj |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|...     32   1.874
hg18||uc002abm |15|NM_014547|Q9NYL9|TMOD3_HUMAN|TMOD3|NM_014547|...     31   2.447
hg18||uc002qmi |19|NM_153447|P59047|NALP5_HUMAN|NLRP5|NM_153447|...     31   2.447
hg18||uc002qmj |19|AY154460|P59047|NALP5_HUMAN|NLRP5|NM_153447|N...     31   2.447
hg18||uc001pvu |11|BX647705|Q86UT6|Q86UT6_HUMAN|NLRX1|NM_024618|...     30   5.451
hg18||uc001pvw |11|NM_024618|Q86UT6|Q86UT6_HUMAN|NLRX1|NM_024618...     30   5.451
hg18||uc001pvx |11|BC110890|Q86UT6|Q86UT6_HUMAN|NLRX1|NM_024618|...     30   5.451
hg18||uc002gcg |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001...     30   5.451
hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP...     30   5.451
hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|...     30   5.451
hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|N...     30   5.451
hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|N...     30   5.451
hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|N...     30   5.451

>hg18||uc003oxi
        |6|NM_182539|Q5JU00|Q5JU00_HUMAN|MGC33600|NM_182539|NP_872345|t-complex
        -associated testis expressed 1

          Length = 501

 Score =  228 bits (581), Expect = 1e-059
 Identities = 121/262 (46%), Positives = 167/262 (63%)

Query: 172 DLESEPDHDGPYLDHFDFNIVLHKLPNLEELHLVYQVKDCGMNFEWSLFEITDRDCESLG 231
           |  || . . | .||.    ..  | .|||| ||| ||||||||||.||  | ||| || 
Sbjct: 213 DSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLA 272

Query: 232 KALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN 291
            |.|.| |||   .  | .||.|   ... | ||| | ||||| |||||.||.  ..||.
Sbjct: 273 AAIKACHTLKIFKLTRSKVDDDKARIIIRSLLDHPVLEELDLSQNLIGDRGARGAAKLLS 332

Query: 292 KSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSL 351
            |||  | . || .  |||...| ||.|              .||||.|.| ||  |  |
Sbjct: 333 HSRLRVLNLANNQVRAPGAQSLAHALAHNTNLISLNLRLNCIEDEGGQALAHALQTNKCL 392

Query: 352 CHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAALSCNTILTECD 411
             |||| |||.  || .|.. |  | || ||||| | .|.|||| |   .| |  | | |
Sbjct: 393 TTLHLGGNELSEPTATLLSQVLAINTTLTSINLSCNHIGLDGGKQLLEGMSDNKTLLEFD 452

Query: 412 VRLTEIEDQSASSIKQVVWSNQ 433
           .||...  .|   | | ...|.
Sbjct: 453 LRLSDVAQESEYLIGQALYANR 474

>hg18||uc003oxi
        |6|NM_182539|Q5JU00|Q5JU00_HUMAN|MGC33600|NM_182539|NP_872345|t-complex
        -associated testis expressed 1

          Length = 501

 Score =  135 bits (339), Expect = 1e-031
 Identities = 54/112 (48%), Positives = 80/112 (71%)

Query:  41 KKKPVYDQLMPVHKDFVHERLSTSLPLHITANLISDGAYWRRCCEQRWDFCDVSCYGHSW 100
           .| |.  |..| |.  |   ||  ||| .|||||    || |||  ||  | |. .| ||
Sbjct:  92 QKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWPVCHVAHHGGSW 151

Query: 101 KRMFFERHMAHVIEFFVPGVTEPATVLNIVPLCNNYIKRLNISQLLPPIKNP 152
           ||||||||. .... |.|| |.|| .|...||| ||..|... | |||.. |
Sbjct: 152 KRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLP 203

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  103 bits (256), Expect = 5e-022
 Identities = 72/215 (33%), Positives = 108/215 (50%), Gaps = 1/215 (0%)

Query: 222 ITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDK 281
           . |    |. .|| |  ||  ||.  . .      |.   |  . ||.||  | | ||| 
Sbjct: 734 VRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDG 793

Query: 282 GAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEA 340
           ||||... |  .. ||.| . .| | | |  |.  ||                  || .|
Sbjct: 794 GAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQA 853

Query: 341 IAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAA 400
           || ||  | .| .| | || |    |  .| |.|.|.|| |..| .| .     .||  |
Sbjct: 854 IAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQA 913

Query: 401 LSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHL 435
           |  |  ||  |..   | |  | .. . .  |  |
Sbjct: 914 LQLNRSLTSLDLQENAIGDDGACAVARALKVNTAL 948

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  89 bits (219), Expect = 1e-017
 Identities = 65/215 (30%), Positives = 108/215 (50%), Gaps = 1/215 (0%)

Query: 222 ITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDK 281
           |  .  ..|  |||   || .| .  . . |.    . . |. . .|  | |  | ||  
Sbjct: 706 IGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPM 765

Query: 282 GAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEA 340
           ||. ..  | ..| |. |   .| ||| ||||.|.||                 | |  |
Sbjct: 766 GAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAA 825

Query: 341 IAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAA 400
           . |||  | .|  | |  | ..   |  .| ||  | ||....|. | |   | .|.  |
Sbjct: 826 LMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVA 885

Query: 401 LSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHL 435
           .  |  ||   ..   |.  .| .. | .  |. |
Sbjct: 886 VRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSL 920

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  82 bits (202), Expect = 9e-016
 Identities = 64/219 (29%), Positives = 103/219 (47%), Gaps = 4/219 (1%)

Query: 221 EITDRDCESLGKAL--KSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLI 278
           .  |   | ||  |  | |  .. . .  . . .     | . |  . ||  |||  | |
Sbjct: 648 QFQDPVMELLGSVLSGKDC-RIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSI 706

Query: 279 GDKGAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEG 337
           | .||||..  |  .| | .| .  | . | ||...|.||.                  |
Sbjct: 707 GPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMG 766

Query: 338 GEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKAL 397
            . .| || .| ||  |   .| .    |  ||.||. |. | |..|  | .   |  ||
Sbjct: 767 AQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAAL 826

Query: 398 QAALSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHLE 436
             ||  |  |    .|   |  . | .|   . .|  |.
Sbjct: 827 MGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLK 865

>hg18||uc003tav |7|NM_006092|Q9Y239|CARD4_HUMAN|NOD1|NM_006092|NP_006083|caspase
        recruitment domain family, member 4

          Length = 953

 Score =  79 bits (192), Expect = 1e-014
 Identities = 60/193 (31%), Positives = 92/193 (47%), Gaps = 1/193 (0%)

Query: 218 SLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
           |. .|||   . | . |     .  | .  . . |     . | | .   |  | |  | 
Sbjct: 736 SVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECKGLTHLKLGKNK 795

Query: 278 IGDKGAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDE 336
           |  .| | ..  .  |. .  . |  | .|| |||| |.|| .                |
Sbjct: 796 ITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTE 855

Query: 337 GGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKA 396
           ||...| || .| ||  | |  |||    |  ||. |. |.||. . |  |..   |   
Sbjct: 856 GGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGTAQ 915

Query: 397 LQAALSCNTILTE 409
           |  ||  || .||
Sbjct: 916 LADALQSNTGITE 928

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  62 bits (149), Expect = 1e-009
 Identities = 47/165 (28%), Positives = 80/165 (48%), Gaps = 3/165 (1%)

Query:  213 MNFEWSLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELD 272
            .. .|.   |     ..||.||.   .| .| .  . . |.  | . . |  . .|  | 
Sbjct:  895 LHLQWNF--IQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALY 952

Query:  273 LSYNLIGDKGAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXX 331
            |    ||  ||. . . |  .| || | .  | ||  ||||.| ||              
Sbjct:  953 LQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQEN 1012

Query:  332 XXQDEGGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQN 376
                .|   || ||  |  | |..|  | .    | |...|.. |
Sbjct: 1013 SLGMDGAICIATALSGNHRLQHINLQGNHIGDSGARMISEAIKTN 1057

>hg18||uc002egm
        |16|NM_022162|Q9HC29|CAR15_HUMAN|NOD2|NM_022162|NP_071445|nucleotide-bi
        nding oligomerization domain

          Length = 1040

 Score =  57 bits (137), Expect = 3e-008
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 1/173 (0%)

Query:  221 EITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGD 280
            ..||    |. | |        | .  ...       | . |  . ||. |    | .||
Sbjct:  854 KLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGD 913

Query:  281 KGAKAISQLL-NKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGE 339
            .||.|... | .   |  | .  | ||  ||.|.|  |.               ||||  
Sbjct:  914 EGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVC 973

Query:  340 AIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVD 392
            ..|  | .| ||  | |  | .|   |  | .|| .| |.  . |  |   ..
Sbjct:  974 SLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLE 1026

>hg18||uc002qlz |19|AK129784|P59045-2|P59045-2|NLRP11|NM_145007|NP_659444|NACHT,
        leucine rich repeat and PYD containing

          Length = 880

 Score =  55 bits (132), Expect = 1e-007
 Identities = 54/207 (26%), Positives = 92/207 (44%), Gaps = 9/207 (4%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |..|     . ..|  .  ||.   .| |  | . |   |.||.|||  | . . |   .
Sbjct: 614 CDALLHPNCTLISLVLVFCCLT---ENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHV 670

Query: 287 S--QLLNKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGA 344
           .   |    .|| | .          . ||  ..               .| | . . | 
Sbjct: 671 TFPLLFPTCQLEELHLSGCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGG 730

Query: 345 LLRNDSLCHLHLGANE--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG-GKALQAAL 401
            ||. .   ...|  |  ||      ||  |  ||||  .||  | || ||  | |.. .
Sbjct: 731 -LRHPNCMLVNIGLEECMLTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLI 789

Query: 402 SCNTILTECDVRLTEIEDQSASSIKQV 428
           | . .|    . || .  |.   .  |
Sbjct: 790 SPDCVLKVVGLPLTGLNTQTQQLLMTV 816

>hg18||uc002qma
        |19|NM_145007|P59045|NAL11_HUMAN|NLRP11|NM_145007|NP_659444|NACHT,
        leucine rich repeat and PYD containing

          Length = 1033

 Score =  55 bits (132), Expect = 1e-007
 Identities = 54/207 (26%), Positives = 92/207 (44%), Gaps = 9/207 (4%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |..|     . ..|  .  ||.   .| |  | . |   |.||.|||  | . . |   .
Sbjct: 767 CDALLHPNCTLISLVLVFCCLT---ENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHV 823

Query: 287 S--QLLNKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGA 344
           .   |    .|| | .          . ||  ..               .| | . . | 
Sbjct: 824 TFPLLFPTCQLEELHLSGCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGG 883

Query: 345 LLRNDSLCHLHLGANE--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG-GKALQAAL 401
            ||. .   ...|  |  ||      ||  |  ||||  .||  | || ||  | |.. .
Sbjct: 884 -LRHPNCMLVNIGLEECMLTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLI 942

Query: 402 SCNTILTECDVRLTEIEDQSASSIKQV 428
           | . .|    . || .  |.   .  |
Sbjct: 943 SPDCVLKVVGLPLTGLNTQTQQLLMTV 969

>hg18||uc002qmb
        |19|AY168968|Q2TV85|Q2TV85_HUMAN|NLRP11|NM_145007|NP_659444|NACHT,
        leucine rich repeat and PYD containing

          Length = 934

 Score =  55 bits (132), Expect = 1e-007
 Identities = 54/207 (26%), Positives = 92/207 (44%), Gaps = 9/207 (4%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |..|     . ..|  .  ||.   .| |  | . |   |.||.|||  | . . |   .
Sbjct: 668 CDALLHPNCTLISLVLVFCCLT---ENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHV 724

Query: 287 S--QLLNKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGA 344
           .   |    .|| | .          . ||  ..               .| | . . | 
Sbjct: 725 TFPLLFPTCQLEELHLSGCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGG 784

Query: 345 LLRNDSLCHLHLGANE--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG-GKALQAAL 401
            ||. .   ...|  |  ||      ||  |  ||||  .||  | || ||  | |.. .
Sbjct: 785 -LRHPNCMLVNIGLEECMLTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLI 843

Query: 402 SCNTILTECDVRLTEIEDQSASSIKQV 428
           | . .|    . || .  |.   .  |
Sbjct: 844 SPDCVLKVVGLPLTGLNTQTQQLLMTV 870

>hg18||uc003ffx
        |3|NM_153353|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|NP_699184|leucine rich
        repeat containing 34

          Length = 419

 Score =  52 bits (122), Expect = 2e-006
 Identities = 51/203 (25%), Positives = 87/203 (42%), Gaps = 3/203 (1%)

Query: 232 KALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN 291
           | |.  | |  |..  . .       . | |  . .|. | .. | | .||    . .| 
Sbjct: 132 KLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIENKGGMFFAAMLQ 191

Query: 292 -KSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDS 350
             | || | .  .|  .     . . |                .. | . .  ||  | |
Sbjct: 192 INSSLEKLDL-GDCDLEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSS 250

Query: 351 LCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAAL-SCNTILTE 409
           | .| .  |..|      ||  |. | ||  |.||||..   |   |   | | |  |  
Sbjct: 251 LRYLDVSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKA 310

Query: 410 CDVRLTEIEDQSASSIKQVVWSN 432
             |    || .   .. | . .|
Sbjct: 311 LSVVSNNIEGEGLVALSQSMKTN 333

>hg18||uc002qmd |19|BC050326|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  49 bits (114), Expect = 1e-005
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 243 LHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLNKSR--LETLKM 300
           | .   |. .  |  . . |  . |.| |||| |.. |.| | . . |      |..| .
Sbjct: 784 LMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCL 843

Query: 301 CNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLH-LGAN 359
               |   | . .| ||                 | | . .  ||   |  | |  ||  
Sbjct: 844 VKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTD--CRLEILGLE 901

Query: 360 E--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAAL 401
           |  ||      ||  |  .|||. .||. | |   |   |  ||
Sbjct: 902 ECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEAL 945

>hg18||uc002qme
        |19|NM_134444|Q96MN2|NALP4_HUMAN|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 994

 Score =  49 bits (114), Expect = 1e-005
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 243 LHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLNKSR--LETLKM 300
           | .   |. .  |  . . |  . |.| |||| |.. |.| | . . |      |..| .
Sbjct: 784 LMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCL 843

Query: 301 CNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLH-LGAN 359
               |   | . .| ||                 | | . .  ||   |  | |  ||  
Sbjct: 844 VKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTD--CRLEILGLE 901

Query: 360 E--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAAL 401
           |  ||      ||  |  .|||. .||. | |   |   |  ||
Sbjct: 902 ECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEAL 945

>hg18||uc002qmf |19|AK056688|Q96MN2-3|Q96MN2-3|NLRP4|NM_134444|NP_604393|NACHT,
        leucine rich repeat and PYD containing 4

          Length = 919

 Score =  49 bits (114), Expect = 1e-005
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 243 LHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLNKSR--LETLKM 300
           | .   |. .  |  . . |  . |.| |||| |.. |.| | . . |      |..| .
Sbjct: 709 LMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCL 768

Query: 301 CNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLH-LGAN 359
               |   | . .| ||                 | | . .  ||   |  | |  ||  
Sbjct: 769 VKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTD--CRLEILGLE 826

Query: 360 E--LTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAAL 401
           |  ||      ||  |  .|||. .||. | |   |   |  ||
Sbjct: 827 ECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEAL 870

>hg18||uc002ekk
        |16|NM_032206|Q86WI3|Q86WI3_HUMAN|NLRC5|NM_032206|NP_115582|nucleotide-
        binding oligomerization domains 27

          Length = 1866

 Score =  47 bits (110), Expect = 4e-005
 Identities = 58/219 (26%), Positives = 82/219 (37%), Gaps = 3/219 (1%)

Query:  218 SLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
            .| |  |     |   | |   |||  .  | .       |   |     | ||||| | 
Sbjct: 1474 NLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQ 1533

Query:  278 IGDKGAKAISQLL-NKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDE 336
              ..| ||. . |  |  |. | . .  .       .   ||                | 
Sbjct: 1534 FDEEGTKALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDV 1593

Query:  337 GGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKA 396
            |   .. ||    ||  | |  |..       ||  |     || |.|| | .   ||  
Sbjct: 1594 GCCHLSEALRAATSLEELDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQ 1653

Query:  397 LQAALSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHL 435
            |  .|     | |  .    . | .|  . | .   |||
Sbjct: 1654 LAESLVLCRRLEELMLGCNALGDPTALGLAQEL--PQHL 1690

>hg18||uc002ekq
        |16|BC040278|Q6P4A6|Q6P4A6_HUMAN|NLRC5|NM_032206|NP_115582|nucleotide-b
        inding oligomerization domains 27

          Length = 408

 Score =  47 bits (110), Expect = 4e-005
 Identities = 58/219 (26%), Positives = 82/219 (37%), Gaps = 3/219 (1%)

Query: 218 SLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
           .| |  |     |   | |   |||  .  | .       |   |     | ||||| | 
Sbjct:  16 NLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQ 75

Query: 278 IGDKGAKAISQLL-NKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDE 336
             ..| ||. . |  |  |. | . .  .       .   ||                | 
Sbjct:  76 FDEEGTKALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDV 135

Query: 337 GGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKA 396
           |   .. ||    ||  | |  |..       ||  |     || |.|| | .   ||  
Sbjct: 136 GCCHLSEALRAATSLEELDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQ 195

Query: 397 LQAALSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHL 435
           |  .|     | |  .    . | .|  . | .   |||
Sbjct: 196 LAESLVLCRRLEELMLGCNALGDPTALGLAQEL--PQHL 232

>hg18||uc002ekr
        |16|AK027416|Q969L7|Q969L7_HUMAN|NLRC5|NM_032206|NP_115582|nucleotide-b
        inding oligomerization domains 27

          Length = 753

 Score =  47 bits (110), Expect = 4e-005
 Identities = 58/219 (26%), Positives = 82/219 (37%), Gaps = 3/219 (1%)

Query: 218 SLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
           .| |  |     |   | |   |||  .  | .       |   |     | ||||| | 
Sbjct: 361 NLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQ 420

Query: 278 IGDKGAKAISQLL-NKSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDE 336
             ..| ||. . |  |  |. | . .  .       .   ||                | 
Sbjct: 421 FDEEGTKALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDV 480

Query: 337 GGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKA 396
           |   .. ||    ||  | |  |..       ||  |     || |.|| | .   ||  
Sbjct: 481 GCCHLSEALRAATSLEELDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQ 540

Query: 397 LQAALSCNTILTECDVRLTEIEDQSASSIKQVVWSNQHL 435
           |  .|     | |  .    . | .|  . | .   |||
Sbjct: 541 LAESLVLCRRLEELMLGCNALGDPTALGLAQEL--PQHL 577

>hg18||uc002qmh
        |19|NM_176811|Q7RTR4|Q7RTR4_HUMAN|NLRP8|NM_176811|NP_789781|NACHT,
        leucine rich repeat and PYD containing 8

          Length = 1048

 Score =  47 bits (109), Expect = 6e-005
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 14/184 (7%)

Query: 258 LVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLNKSRLETLKMCNNCIGDPGAKAIAQAL 317
           |  .|  .  |. | |  | . . ||      |. ..|| | . |  .     ...|  |
Sbjct: 808 LGNNLQGNGHLKTLILRKNSLENCGA----YYLSVAQLERLSIENCNLTQLTCESLASCL 863

Query: 318 SHXXXXXXXXXXXXXXQDEGGEAIAGALLR-NDSLCHLHLGANELTGHTAAMLAKALRQN 376
                           .||| . |  ||      |  | |   .|| .    .  || .|
Sbjct: 864 RQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQRLVLRKCDLTFNCCQDMISALCKN 923

Query: 377 KTLRSINLSFNKLGVDGGKALQAALSCNTILTECDVRLTEIEDQSASSI-----KQVVWS 431
           |||.|..|||| |  ||   |  ||       .| ... |.|.   .||       ..  
Sbjct: 924 KTLKSLDLSFNSLKDDGVILLCEALK----NPDCTLQILELENCLFTSICCQAMASMLRK 979

Query: 432 NQHL 435
           ||||
Sbjct: 980 NQHL 983

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  44 bits (103), Expect = 3e-004
 Identities = 39/136 (28%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query:  222 ITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDK 281
            | |    .. .|||    |  |.. .. .  .    | . |. . .|  |||  | ||  
Sbjct:  930 IGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVA 989

Query:  282 GAKAISQLLN-KSRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEA 340
            ||||..  |   | |  | .  | .|  ||  || |||                | |   
Sbjct:  990 GAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGARM 1049

Query:  341 IAGALLRNDSLCHLHL 356
            |. |.  |   | . .
Sbjct: 1050 ISEAIKTNAPTCTVEM 1065

>hg18||uc003ffy
        |3|BC028610|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|NP_699184|leucine rich
        repeat containing 34

          Length = 451

 Score =  44 bits (103), Expect = 3e-004
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 334 QDEGGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG 393
           .. | . .  ||  | || .| .  |..|      ||  |. | ||  |.||||..   |
Sbjct: 266 KNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAG 325

Query: 394 GKALQAAL-SCNTILTECDVRLTEIEDQSASSIKQVVWSN 432
              |   | | |  |    |    || .   .. | . .|
Sbjct: 326 ANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTN 365

>hg18||uc003ffz
        |3|CR606238|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|NP_699184|leucine rich
        repeat containing 34

          Length = 403

 Score =  44 bits (103), Expect = 3e-004
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 334 QDEGGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG 393
           .. | . .  ||  | || .| .  |..|      ||  |. | ||  |.||||..   |
Sbjct: 218 KNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAG 277

Query: 394 GKALQAAL-SCNTILTECDVRLTEIEDQSASSIKQVVWSN 432
              |   | | |  |    |    || .   .. | . .|
Sbjct: 278 ANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTN 317

>hg18||uc001icv |1|NM_183395|Q96P20-2|Q96P20-2|NLRP3|NM_183395|NP_899632|NLR
        family, pyrin domain containing 3 isoform b

          Length = 922

 Score =  43 bits (100), Expect = 6e-004
 Identities = 43/163 (26%), Positives = 66/163 (40%), Gaps = 9/163 (5%)

Query: 237 CLTLKTLHVCLSH------MDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLL 290
           |.   . |   ||      .    |  .   || .  | ||||| | .|| | . .   |
Sbjct: 706 CVLPSSSHAACSHGLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGL 765

Query: 291 NK--SRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRN 348
                 |. | . |. .      |..  ||                |.| . .   ||  
Sbjct: 766 KHLLCNLKKLWLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHP 825

Query: 349 D-SLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLG 390
           |  |  | |    || |    |.  |  ...|| ..|  | ||
Sbjct: 826 DCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLG 868

>hg18||uc003tav |7|NM_006092|Q9Y239|CARD4_HUMAN|NOD1|NM_006092|NP_006083|caspase
        recruitment domain family, member 4

          Length = 953

 Score =  42 bits (98), Expect = 0.001
 Identities = 33/140 (23%), Positives = 63/140 (45%), Gaps = 1/140 (0%)

Query: 221 EITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGD 280
           .||    . |  |.|.  ..  . .  . . |       . | .||||  | |. | |  
Sbjct: 795 KITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGIST 854

Query: 281 KGAKAISQLLNK-SRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGE 339
           .| |.... | . . || | .  | . |  |...|. |                  .|  
Sbjct: 855 EGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGTA 914

Query: 340 AIAGALLRNDSLCHLHLGAN 359
            .| ||  |  .  . |  |
Sbjct: 915 QLADALQSNTGITEICLNGN 934

>hg18||uc001ics |1|AB208891|Q96P20-5|Q96P20-5|NLRP3|NM_183395|NP_899632|NLR
        family, pyrin domain containing 3 isoform b

          Length = 977

 Score =  42 bits (96), Expect = 0.002
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 253 NKCC-RLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLNK--SRLETLKMCNNCIGDPG 309
           ..||  .   || .  | ||||| | .|| | . .   |      |. | . |. .    
Sbjct: 782 HECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVNSGLTSVC 841

Query: 310 AKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRND-SLCHLHLGANELTGHTAAM 368
             |..  ||                |.| . .   ||  |  |  | |    || |    
Sbjct: 842 CSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWD 901

Query: 369 LAKALRQNKTLRSINLSFNKLG 390
           |.  |  ...|| ..|  | ||
Sbjct: 902 LSTLLTSSQSLRKLSLGNNDLG 923

>hg18||uc003fga |3|AK095125|NA|NA|LRRC34|NA|NA|Homo sapiens cDNA FLJ37806 fis,
        clone BRSSN2001426

          Length = 300

 Score =  41 bits (94), Expect = 0.003
 Identities = 23/69 (33%), Positives = 36/69 (52%)

Query: 334 QDEGGEAIAGALLRNDSLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDG 393
           .. | . .  ||  | || .| .  |..|      ||  |. | ||  |.||||..   |
Sbjct: 218 KNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAG 277

Query: 394 GKALQAALS 402
              |   |.
Sbjct: 278 ANYLSETLT 286

>hg18||uc003zcu
        |8|NM_013432|Q96HA7|Q96HA7_HUMAN|NFKBIL2|NM_013432|NP_038460|I-kappa-B-
        related protein

          Length = 1219

 Score =  41 bits (94), Expect = 0.003
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 207 QVKDCGMNFEWSLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHP 266
           ...  |..|      .       | .|||    |. | .  . . |     ||  |   |
Sbjct: 880 ELQGLGLSFSACSLALDQAQLTPLLRALKLHTALRELRLAGNRLGDKCVAELVAALGTMP 939

Query: 267 SLRELDLSYNLIGDKGAKAISQLL----NKSRLETLKMCNNCIGDPGAKAIAQAL 317
           ||  |||| | .| .| . ..  |        || | .  | .||   ...|  |
Sbjct: 940 SLALLDLSSNHLGPEGLRQLAMGLPGQATLQSLEELDLSMNPLGDGCGQSLASLL 994

>hg18||uc001icw |1|BC117211|Q96P20-4|Q96P20-4|NLRP3|NM_004895|NP_004886|NLR
        family, pyrin domain containing 3 isoform a

          Length = 977

 Score =  40 bits (91), Expect = 0.007
 Identities = 50/199 (25%), Positives = 81/199 (40%), Gaps = 17/199 (8%)

Query: 237 CLTLKTLHVCLSH------MDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLL 290
           |.   . |   ||      .    |  .   || .  | ||||| | .|| | . .   |
Sbjct: 704 CVLPSSSHAACSHGLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGL 763

Query: 291 NK--SRLETLKMCNNCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRN 348
                 |. | . . |.     . .|  ||                |  | ||     .|
Sbjct: 764 KHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGD-SGVAILCEKAKN 822

Query: 349 D--SLCHLHLGANELTGHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAALSCNTI 406
              .|  | |  . ||    . |.  |  |. |  . |  | ||  | | |     |  .
Sbjct: 823 PQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLL-----CEGL 877

Query: 407 L-TECDVRLTEIEDQSASS 424
           |  .| ... |... . .|
Sbjct: 878 LHPDCKLQVLELDNCNLTS 896

>hg18||uc001xsx
        |14|NM_001081002|Q0VAA2|Q0VAA2_HUMAN|C14orf166B|NM_001081002|NP_0010744
        71|hypothetical protein LOC145497

          Length = 462

 Score =  39 bits (89), Expect = 0.012
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 5/113 (4%)

Query: 206 YQVKDCGMNFEWSLFEITDRDCESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDH 265
           ||.|   ..      . .|   | ||. |   . | .| .  ..        |   |  .
Sbjct: 192 YQIKKLDLSHN----QFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTRGAVALCNGLRGN 247

Query: 266 PSLRELDLSYNLIGDKGAKAISQLLNKSR-LETLKMCNNCIGDPGAKAIAQAL 317
            .| .|||| |  |.. | |. ..|  .| |  | .  | ||. ||  |.. |
Sbjct: 248 VTLTKLDLSMNGFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGL 300

>hg18||uc002qch
        |19|NM_144687|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-conta
        ining APAF1-like protein 7 isoform 2

          Length = 1061

 Score =  37 bits (84), Expect = 0.045
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 240 LKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN--KSRLET 297
           |.|| . .  .    |  |   || . |||||||| | .|| |   . . |     .|.|
Sbjct: 858 LRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQT 917

Query: 298 LKMCNNCIGDPGAKAIAQAL 317
           |..    .|    . ..  |
Sbjct: 918 LRLGICRLGSAACEGLSVVL 937

>hg18||uc002qcj
        |19|AY116204|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1062

 Score =  37 bits (84), Expect = 0.045
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 240 LKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN--KSRLET 297
           |.|| . .  .    |  |   || . |||||||| | .|| |   . . |     .|.|
Sbjct: 859 LRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQT 918

Query: 298 LKMCNNCIGDPGAKAIAQAL 317
           |..    .|    . ..  |
Sbjct: 919 LRLGICRLGSAACEGLSVVL 938

>hg18||uc002qcg
        |19|NM_033297|P59046-5|P59046-5|NLRP12|NM_033297|NP_150639|PYRIN-contai
        ning APAF1-like protein 7 isoform 1

          Length = 287

 Score =  37 bits (83), Expect = 0.058
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 240 LKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN--KSRLET 297
           |.|| . .  .    |  |   || . |||||||| | .|| |   . . |     .|.|
Sbjct: 141 LRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQT 200

Query: 298 LKM 300
           |..
Sbjct: 201 LRL 203

>hg18||uc002qci
        |19|AK095460|P59046|NAL12_HUMAN|NLRP12|NM_144687|NP_653288|PYRIN-contai
        ning APAF1-like protein 7 isoform 2

          Length = 1004

 Score =  37 bits (83), Expect = 0.058
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 240 LKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAISQLLN--KSRLET 297
           |.|| . .  .    |  |   || . |||||||| | .|| |   . . |     .|.|
Sbjct: 858 LRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQT 917

Query: 298 LKM 300
           |..
Sbjct: 918 LRL 920

>hg18||uc003ffy
        |3|BC028610|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|NP_699184|leucine rich
        repeat containing 34

          Length = 451

 Score =  37 bits (83), Expect = 0.058
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 303 NCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLHLGANELT 362
           | . | ||   |. |                  |||| ||  | .| .| .| .  |.. 
Sbjct: 120 NLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIE 179

Query: 363 GHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAALSCNTILTE 409
                  |  |. | .|  ..|    ||      .|. ..  |.||.
Sbjct: 180 NKGGMFFAAMLQINSSLEKLDLGDCDLG------MQSVIAFATVLTQ 220

>hg18||uc003ffz
        |3|CR606238|Q8IZ02|LRC34_HUMAN|LRRC34|NM_153353|NP_699184|leucine rich
        repeat containing 34

          Length = 403

 Score =  37 bits (83), Expect = 0.058
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 303 NCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLHLGANELT 362
           | . | ||   |. |                  |||| ||  | .| .| .| .  |.. 
Sbjct:  72 NLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIE 131

Query: 363 GHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAALSCNTILTE 409
                  |  |. | .|  ..|    ||      .|. ..  |.||.
Sbjct: 132 NKGGMFFAAMLQINSSLEKLDLGDCDLG------MQSVIAFATVLTQ 172

>hg18||uc003fga |3|AK095125|NA|NA|LRRC34|NA|NA|Homo sapiens cDNA FLJ37806 fis,
        clone BRSSN2001426

          Length = 300

 Score =  37 bits (83), Expect = 0.058
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 303 NCIGDPGAKAIAQALSHXXXXXXXXXXXXXXQDEGGEAIAGALLRNDSLCHLHLGANELT 362
           | . | ||   |. |                  |||| ||  | .| .| .| .  |.. 
Sbjct:  72 NLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIE 131

Query: 363 GHTAAMLAKALRQNKTLRSINLSFNKLGVDGGKALQAALSCNTILTE 409
                  |  |. | .|  ..|    ||      .|. ..  |.||.
Sbjct: 132 NKGGMFFAAMLQINSSLEKLDLGDCDLG------MQSVIAFATVLTQ 172

>hg18||uc001fql
        |1|NM_144702|Q96M24|Q96M24_HUMAN|C1orf92|NM_144702|NP_653303|hypothetic
        al protein LOC149499

          Length = 354

 Score =  36 bits (82), Expect = 0.076
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 222 ITDRDCESLGKALK---SC-LTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
           | ||  . ||.||    ||  || .|..  .|. |     .   |  . ||  | |..| 
Sbjct:  17 IDDRGAQLLGQALSTLHSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNR 76

Query: 278 IGDKGAKAISQLLNKSRL 295
           | ||||  ....|    |
Sbjct:  77 IQDKGALKLAEVLRAFEL 94

>hg18||uc001fqm |1|BC033790|Q8N4P6|Q8N4P6_HUMAN|C1orf92|NA|NA|C1orf92 protein
        (Novel protein)

          Length = 344

 Score =  36 bits (82), Expect = 0.076
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 222 ITDRDCESLGKALK---SC-LTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNL 277
           | ||  . ||.||    ||  || .|..  .|. |     .   |  . ||  | |..| 
Sbjct:  17 IDDRGAQLLGQALSTLHSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNR 76

Query: 278 IGDKGAKAISQLLNKSRL 295
           | ||||  ....|    |
Sbjct:  77 IQDKGALKLAEVLRAFEL 94

>hg18||uc002gcg
        |17|NM_001033053|Q86UB5|Q86UB5_HUMAN|NLRP1|NM_001033053|NP_001028225|NL
        R family, pyrin domain containing 1 isoform 5

          Length = 1375

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc002gch |17|AF298548|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP_055737|NLR
        family, pyrin domain containing 1 isoform 2

          Length = 1429

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc002gci |17|NM_033004|Q9C000|NALP1_HUMAN|NLRP1|NM_033004|NP_127497|NLR
        family, pyrin domain containing 1 isoform 1

          Length = 1473

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc002gcj |17|NM_033006|Q9C000-4|Q9C000-4|NLRP1|NM_033006|NP_127499|NLR
        family, pyrin domain containing 1 isoform 3

          Length = 1443

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc002gck |17|NM_014922|Q9C000-2|Q9C000-2|NLRP1|NM_014922|NP_055737|NLR
        family, pyrin domain containing 1 isoform 2

          Length = 1429

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc002gcl |17|NM_033007|Q9C000-3|Q9C000-3|NLRP1|NM_033007|NP_127500|NLR
        family, pyrin domain containing 1 isoform 4

          Length = 1399

 Score =  36 bits (81), Expect = 0.099
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 228 ESLGKALK--SCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKA 285
           .|| | |.   || |.|| .    .    |  |   |  . .| |||||.|.. | ||| 
Sbjct: 826 KSLCKTLRRPRCL-LETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKH 884

Query: 286 ISQLLNK--SRLETLKMCNNCIGDPGAKAIAQALS 318
           . | | .   .|. |.. .  .     . .|  ||
Sbjct: 885 LCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLS 919

>hg18||uc001lpk
        |11|AL161967|P13489|RINI_HUMAN|RNH1|NM_203389|NP_976323|ribonuclease/an
        giogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

>hg18||uc001lpl
        |11|NM_002939|P13489|RINI_HUMAN|RNH1|NM_002939|NP_002930|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

>hg18||uc001lpm
        |11|NM_203385|P13489|RINI_HUMAN|RNH1|NM_203385|NP_976319|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

>hg18||uc001lpn
        |11|NM_203383|P13489|RINI_HUMAN|RNH1|NM_203383|NP_976317|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

>hg18||uc001lpo
        |11|NM_203384|P13489|RINI_HUMAN|RNH1|NM_203384|NP_976318|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

>hg18||uc001lpp
        |11|NM_203387|P13489|RINI_HUMAN|RNH1|NM_203387|NP_976321|ribonuclease/a
        ngiogenin inhibitor

          Length = 461

 Score =  35 bits (80), Expect = 0.130
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 227 CESLGKALKSCLTLKTLHVCLSHMDDNKCCRLVKHLSDHPSLRELDLSYNLIGDKGAKAI 286
           |. ||.       |. | .    . |. |  |   |  . |||||||| | .|| |   |
Sbjct: 362 CQGLGQPGS---VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAG---I 415

Query: 287 SQLLNKSR 294
            ||.   |
Sbjct: 416 LQLVESVR 423

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,252,843
Number of Sequences: 45480
Number of Extensions: 191252843
Number of Successful Extensions: 11153049
Number of sequences better than 0.0: 0
BLASTP 7.6.0