BLASTP 7.6.0


Query=fugu4_739757 |jgi|Takru4|739757|fgh5_pg.C_scaffold_286000008
        (221 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002gne |17|NM_001372|Q9NYC9|DYH9_HUMAN|DNAH9|NM_001372|N...     93   3e-019
hg18||uc002jvr |17|NM_003727|NA|NA|DNAH17|NM_003727|NP_003718|dy...     88   8e-018
hg18||uc003svc |7|NM_003777|NA|NA|DNAH11|NM_003777|NP_003768|dyn...     69   4e-012
hg18||uc003ooe |6|NM_001371|Q96JB1|DYH8_HUMAN|DNAH8|NM_001371|NP...     45   8e-005
hg18||uc003oog |6|AX748244|NA|NA|DNAH8|NA|NA|Homo sapiens axonem...     45   8e-005
hg18||uc003dds |3|NM_015512|NA|NA|DNAH1|NM_015512|NP_056327|dyne...     40   0.002
hg18||uc003ddv |3|AK074130|NA|NA|KIAA1410|NA|NA|Homo sapiens mRN...     40   0.002
hg18||uc003jfd |5|NM_001369|Q8TE73|DYH5_HUMAN|DNAH5|NM_001369|NP...     39   0.003
hg18||uc003ebt |3|NM_002338|Q13449|LSAMP_HUMAN|LSAMP|NM_002338|N...     32   0.534
hg18||uc001jnd |10|NM_012238|Q96EB6|SIRT1_HUMAN|SIRT1|NM_012238|...     28   7.706
hg18||uc001jne |10|AK074805|NA|NA|SIRT1|NA|NA|Homo sapiens sirtu...     28   7.706

>hg18||uc002gne
        |17|NM_001372|Q9NYC9|DYH9_HUMAN|DNAH9|NM_001372|NP_001363|dynein,
        axonemal, heavy chain 9 isoform 2

          Length = 4486

 Score =  93 bits (229), Expect = 3e-019
 Identities = 46/57 (80%), Positives = 53/57 (92%)

Query:  146 LESDLTKEQNGFKITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEK 202
            |.|||||.|||||||||||||.||| ||.|||||||.  ||||||||| ||||.|.|
Sbjct: 3601 LKSDLTKQQNGFKITLKTLEDSLLSRLSSASGNFLGETVLVENLEITKQTAAEVEKK 3657

>hg18||uc002jvr |17|NM_003727|NA|NA|DNAH17|NM_003727|NP_003718|dynein, axonemal,
        heavy polypeptide 17

          Length = 1472

 Score =  88 bits (216), Expect = 8e-018
 Identities = 45/64 (70%), Positives = 52/64 (81%)

Query: 146 LESDLTKEQNGFKITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEKSVS 205
           |...||| || ||| || |||.||. |||||||||||  |||||| |||||.||||| | 
Sbjct: 587 LKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTASEIEEKVVE 646

Query: 206 DKFS 209
            | .
Sbjct: 647 AKIT 650

>hg18||uc003svc |7|NM_003777|NA|NA|DNAH11|NM_003777|NP_003768|dynein, axonemal,
        heavy chain 11

          Length = 4523

 Score =  69 bits (167), Expect = 4e-012
 Identities = 37/58 (63%), Positives = 41/58 (70%)

Query:  150 LTKEQNGFKITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEKSVSDK 207
            ||| || ||| || |||.||  |||| |.|| | .||| || || | |||| | .  |
Sbjct: 3642 LTKHQNDFKIELKYLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAK 3699

>hg18||uc003ooe |6|NM_001371|Q96JB1|DYH8_HUMAN|DNAH8|NM_001371|NP_001362|dynein,
        axonemal, heavy polypeptide 8

          Length = 4490

 Score =  45 bits (104), Expect = 8e-005
 Identities = 23/45 (51%), Positives = 28/45 (62%)

Query:  158 KITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEK 202
            |  .| ||||||  |||  |. . |  |.  |  || ||||. ||
Sbjct: 3619 KRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEK 3663

>hg18||uc003oog |6|AX748244|NA|NA|DNAH8|NA|NA|Homo sapiens axonemal dynein heavy
        chain 8 (DNAH8) mRNA, complete cds

          Length = 605

 Score =  45 bits (104), Expect = 8e-005
 Identities = 23/45 (51%), Positives = 28/45 (62%)

Query: 158 KITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEK 202
           |  .| ||||||  |||  |. . |  |.  |  || ||||. ||
Sbjct:  68 KRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEK 112

>hg18||uc003dds |3|NM_015512|NA|NA|DNAH1|NM_015512|NP_056327|dynein, axonemal,
        heavy polypeptide 1

          Length = 4330

 Score =  40 bits (93), Expect = 0.002
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query:  161 LKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEK-SVSDKFSADVRL 214
            || .|| .|  ||.. || . | ||.. || .|  ||||. |  ....   |. |
Sbjct: 3452 LKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDL 3506

>hg18||uc003ddv |3|AK074130|NA|NA|KIAA1410|NA|NA|Homo sapiens mRNA for KIAA1410
        protein, partial cds

          Length = 1054

 Score =  40 bits (93), Expect = 0.002
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 161 LKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEK-SVSDKFSADVRL 214
           || .|| .|  ||.. || . | ||.. || .|  ||||. |  ....   |. |
Sbjct: 245 LKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDL 299

>hg18||uc003jfd |5|NM_001369|Q8TE73|DYH5_HUMAN|DNAH5|NM_001369|NP_001360|dynein,
        axonemal, heavy polypeptide 5

          Length = 4624

 Score =  39 bits (90), Expect = 0.003
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query:  150 LTKEQNGFKITLKTLEDNLLSHLSAASGNFLGDNELVENLEITKHTAAEIEEKSVSDKFS 209
            | ..    |  .| ||||||  |..  |. . |  |.  |  || || |. .|    . |
Sbjct: 3746 LMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKL---EIS 3802

Query:  210 ADVRLLQKTGRE 221
            |.  .   . ||
Sbjct: 3803 AETEVQINSARE 3814

>hg18||uc003ebt |3|NM_002338|Q13449|LSAMP_HUMAN|LSAMP|NM_002338|NP_002329|limbic
        system-associated membrane protein

          Length = 338

 Score =  32 bits (71), Expect = 0.534
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 144 ATLESDLTKEQNGFKITLKTLEDN------LLSHLSAASGNFLGDNELVENLEITKHTAA 197
           . . ||.|  . |  .||  . .          ||.     | |. | .| | ||.  . 
Sbjct: 135 SNISSDVTVNE-GSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSG 193

Query: 198 EIEEKSVSDKFSADVRLLQKT 218
           . | |. ..  ||||. .. |
Sbjct: 194 KYECKAANEVSSADVKQVKVT 214

>hg18||uc001jnd
        |10|NM_012238|Q96EB6|SIRT1_HUMAN|SIRT1|NM_012238|NP_036370|sirtuin 1

          Length = 747

 Score =  28 bits (61), Expect = 7.706
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query:  41 VCSPLCHHLGGEVLKDCHGALQISQV 66
           . . ||| ||||  | |   ...|..
Sbjct: 485 IINELCHRLGGEYAKLCCNPVKLSEI 510

>hg18||uc001jne |10|AK074805|NA|NA|SIRT1|NA|NA|Homo sapiens sirtuin type 1
        (SIRT1) mRNA, complete cds

          Length = 444

 Score =  28 bits (61), Expect = 7.706
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query:  41 VCSPLCHHLGGEVLKDCHGALQISQV 66
           . . ||| ||||  | |   ...|..
Sbjct: 182 IINELCHRLGGEYAKLCCNPVKLSEI 207

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,994,661
Number of Sequences: 45480
Number of Extensions: 193994661
Number of Successful Extensions: 11136213
Number of sequences better than 0.0: 0
BLASTP 7.6.0