BLASTP 7.6.0


Query=fugu4_739032 |jgi|Takru4|739032|fgh5_pg.C_scaffold_260000029
        (1082 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003wnh |7|NM_014671|Q15386|UBE3C_HUMAN|UBE3C|NM_014671|N...   1569   0.0
hg18||uc003wng |7|BC014029|Q15386-2|Q15386-2|UBE3C|NM_014671|NP_...    773   3e-223
hg18||uc003wni |7|AK127280|NA|NA|KIAA0010|NA|NA|Homo sapiens cDN...    755   9e-218
hg18||uc003wnf |7|BC026241|Q15386-3|Q15386-3|UBE3C|NM_014671|NP_...    425   2e-118
hg18||uc001top |12|NM_130466|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_130466...    282   2e-075
hg18||uc001toq |12|NM_183415|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_183415...    282   2e-075
hg18||uc001tos |12|AK127227|NA|NA|UBE3B|NM_183415|NP_904324|ubiq...    282   2e-075
hg18||uc002lgx |18|NM_015277|Q96PU5-5|Q96PU5-5|NEDD4L|NM_015277|...    196   1e-049
hg18||uc002lgy |18|AY312514|Q96PU5|NED4L_HUMAN|NEDD4L|NM_015277|...    196   1e-049
hg18||uc002lgz |18|DQ893350|Q96PU5-2|Q96PU5-2|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc002lhb |18|DQ181796|Q3LSM7|Q3LSM7_HUMAN|NEDD4L|NM_015277...    196   1e-049
hg18||uc002lhc |18|AY112984|Q96PU5-7|Q96PU5-7|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc002lhd |18|AY112983|Q96PU5-4|Q96PU5-4|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc002lhe |18|AY112985|Q96PU5-6|Q96PU5-6|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc002lhf |18|AB007899|Q3LSM7|Q3LSM7_HUMAN|NEDD4L|NM_015277...    196   1e-049
hg18||uc002lhg |18|AF210730|Q96PU5-4|Q96PU5-4|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc002lhh |18|AL137469|Q96PU5-3|Q96PU5-3|NEDD4L|NM_015277|N...    196   1e-049
hg18||uc001zaq |15|NM_000462|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_000462...    193   1e-048
hg18||uc001zar |15|AB194232|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130838|...    193   1e-048
hg18||uc001zas |15|NM_130839|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130839...    193   1e-048
hg18||uc001zat |15|U84404|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130838|NP...    193   1e-048
hg18||uc004dsn |X|AB002310|Q5H924|Q5H924_HUMAN|HUWE1|NM_031407|N...    189   2e-047
hg18||uc004dso |X|NM_031407|Q7Z6Z7|HUWE1_HUMAN|HUWE1|NM_031407|N...    189   2e-047
hg18||uc004dsp |X|DQ097177|Q7Z6Z7|HUWE1_HUMAN|HUWE1|NM_031407|NP...    189   2e-047
hg18||uc003pqt |6|AB037741|Q5VUA0|Q5VUA0_HUMAN|HACE1|NM_020771|N...    184   6e-046
hg18||uc003pqu |6|NM_020771|Q8IYU2|Q8IYU2_HUMAN|HACE1|NM_020771|...    184   6e-046
hg18||uc002exu |16|NM_007014|O00308|WWP2_HUMAN|WWP2|NM_007014|NP...    183   2e-045
hg18||uc002exv |16|BC064531|O00308|WWP2_HUMAN|WWP2|NM_007014|NP_...    183   2e-045
hg18||uc002exw |16|NM_199424|NA|NA|WWP2|NM_199424|NP_955456|WW d...    183   2e-045
hg18||uc002utl |2|CR749424|Q68DF8|Q68DF8_HUMAN|DKFZp686M17164|NA...    181   7e-045
hg18||uc002utm |2|NM_020760|Q17RT5|Q17RT5_HUMAN|HECW2|NM_020760|...    181   7e-045
hg18||uc003upu |7|NM_020429|Q9HCE7|SMUF1_HUMAN|SMURF1|NM_020429|...    179   2e-044
hg18||uc003upv |7|NM_181349|Q9HCE7-2|Q9HCE7-2|SMURF1|NM_181349|N...    179   2e-044
hg18||uc003pqs |6|AL834202|Q8ND12|Q8ND12_HUMAN|DKFZp434M0621|NA|...    176   1e-043
hg18||uc002jep |17|NM_022739|Q9HAU4|SMUF2_HUMAN|SMURF2|NM_022739...    173   2e-042
hg18||uc002jeq |17|BC051283|NA|NA|SMURF2|NA|NA|Homo sapiens ubiq...    173   2e-042
hg18||uc002jer |17|CR936721|Q52LL1|Q52LL1_HUMAN|SMURF2|NM_022739...    173   2e-042
hg18||uc003hrw |4|NM_014606|Q15034|HERC3_HUMAN|HERC3|NM_014606|N...    156   2e-037
hg18||uc001jng |10|NM_022079|Q5GLZ8|Q5GLZ8_HUMAN|HERC4|NM_022079...    156   2e-037
hg18||uc001jnh |10|NM_015601|Q8IXP9|Q8IXP9_HUMAN|HERC4|NM_015601...    156   2e-037
hg18||uc003upt |7|AL834242|Q8NDD8|Q8NDD8_HUMAN|SMURF1|NM_181349|...    150   1e-035
hg18||uc001xqb |14|NM_001039479|O15033|K0317_HUMAN|KIAA0317|NM_0...    149   2e-035
hg18||uc001khl |10|NM_182765|Q5U5R9|HECD2_HUMAN|HECTD2|NM_182765...    117   1e-025
hg18||uc001khn |10|BC036487|NA|NA|HECTD2|NM_182765|NP_877497|HEC...    117   1e-025
hg18||uc002vpw |2|NM_004238|Q14669|TRIPC_HUMAN|TRIP12|NM_004238|...    108   5e-023
hg18||uc002vpx |2|BC114556|Q14CA3|Q14CA3_HUMAN|TRIP12|NM_004238|...    108   5e-023
hg18||uc002vpy |2|BC113891|Q14CF1|Q14CF1_HUMAN|TRIP12|NM_004238|...    108   5e-023
hg18||uc001wra |14|AK125788|Q2KQ74|Q2KQ74_HUMAN|HECTD1|NM_015382...    104   7e-022
hg18||uc001wrb |14|AY739714|NA|NA|KIAA1131|NA|NA|Homo sapiens mR...    104   7e-022
hg18||uc001wrc |14|NM_015382|Q9ULT8|HECD1_HUMAN|HECTD1|NM_015382...    104   7e-022
hg18||uc001tot |12|AL096740|NA|NA|UBE3B|NA|NA|Homo sapiens clone...    103   2e-021
hg18||uc001zbi |15|AL834183|Q8ND39|Q8ND39_HUMAN|DKFZp547P028|NA|...    101   6e-021
hg18||uc001zbj |15|NM_004667|O95714|HERC2_HUMAN|HERC2|NM_004667|...    101   6e-021
hg18||uc003ykq |8|AF090904|NA|NA|KIAA0896|NA|NA|Homo sapiens mRN...     91   1e-017
hg18||uc003ykr |8|NM_015902|O95071|EDD1_HUMAN|EDD1|NM_015902|NP_...     91   1e-017
hg18||uc003yks |8|AB020703|O95071|EDD1_HUMAN|EDD1|NM_015902|NP_0...     91   1e-017
hg18||uc001cmx |1|AK091583|Q5T447-3|Q5T447-3|HECTD3|NM_024602|NP...     68   7e-011
hg18||uc001cmy |1|AK056873|Q5T447-2|Q5T447-2|HECTD3|NA|NA|Probab...     68   7e-011
hg18||uc001cmz |1|NM_024602|A1A4G1|A1A4G1_HUMAN|HECTD3|NM_024602...     68   7e-011
hg18||uc001top |12|NM_130466|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_130466...     54   8e-007
hg18||uc001toq |12|NM_183415|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_183415...     54   8e-007
hg18||uc001tos |12|AK127227|NA|NA|UBE3B|NM_183415|NP_904324|ubiq...     54   8e-007
hg18||uc001tot |12|AL096740|NA|NA|UBE3B|NA|NA|Homo sapiens clone...     54   8e-007
hg18||uc003wnf |7|BC026241|Q15386-3|Q15386-3|UBE3C|NM_014671|NP_...     44   0.001

>hg18||uc003wnh
        |7|NM_014671|Q15386|UBE3C_HUMAN|UBE3C|NM_014671|NP_055486|ubiquitin
        protein ligase E3C

          Length = 1083

 Score =  1569 bits (4062), Expect = 0.0
 Identities = 785/1083 (72%), Positives = 883/1083 (81%), Gaps = 2/1083 (0%)

Query:    1 MFSFEGDFRTRPSVSLGGASKKEEKASLLHRTQXXXXXXXXXXXXLKNAIIIQSFIRGYQ 60
            ||||||||.||| |||||||.||||||||||||            ||||||||||||||.
Sbjct:    1 MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR 60

Query:   61 DLKRQYATQRASFDECVSQSLVGGAQHTLDGPRLSLLSRQLIFFYKQSVDVHRLIWLCQN 120
            | |.||. ||..|| | . |  |||    .|| |.|| |||.|||||. |  ||||| ||
Sbjct:   61 DRKQQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN 120

Query:  121 LVKFNSQFVKLLMGPQSQTCLFQVKRILGFCCRLLQCCRDDSLNVTVPMRMLEVYSSEKT 180
            |.| .| ||| | | .  |||||.||..  |||||| | |||||| .|||||||.||| |
Sbjct:  121 LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENT 180

Query:  181 YHPVVPDALCLTSLLEQILHYMVQKGYYKSLYVLVNHKLPSSLEYSDSPSVPLASTLLEH 240
            | ||. ||  . |..|||||||.  |||.|||.|.| |||||.||||   ||.|  |||.
Sbjct:  181 YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN 240

Query:  241 ILKPLHFTYSSCTTGARQFVFAAFTKEFISAPFTEPIFHFFIPALSDAHVSFPFEAFLSS 300
            .||||||||.||  |||| || |||.||..||||. |||| ||||.||   ||.| ||..
Sbjct:  241 VLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA 300

Query:  301 LQATINSSSLLHSQAPWVFYFVLSAGENXXXXXXXXXXXXXXXXXXXXXXXXPVFXXXXX 360
            |    .  |     |||.|||||. |||                        ||      
Sbjct:  301 LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASAS 360

Query:  361 XXXXXXXXXXXNTGIQSSPMQDDSRISVQLITEECVHKLDSKHQTNALLNLVWRDSASEE 420
                       .         .| |.||  |||||. |||.| ||| |||||||||||||
Sbjct:  361 CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE 420

Query:  421 VFTMMASICHTLMVQHRLMVPKVRLLYSLAFNARFLRHLWHLITSMTTKMITGSTVALLQ 480
            ||| |||.|||||||||.|||||||||||||||||||||| ||.||.|.||||| | |||
Sbjct:  421 VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQ 480

Query:  481 LISRGSPMSFEDSNRXXXXXXXXXXXXXXXXXXVHDSEFFGHEIE--GRAQSSMMPFTLP 538
            .||||||||||||.|                  .||.||||  ||  |. ||||||||| 
Sbjct:  481 VISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLE 540

Query:  539 ELVTLSRCLRDACLGIIKLAYPETKAEHREEYMAAFRSVGVKTNTEVQQRIQAEQKRWVQ 598
            ||. ||||||||||||||||||||| | ||||. ||.|.|| |..|.|| || |||||.|
Sbjct:  541 ELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQ 600

Query:  599 LFKVITNLVKMVKARDIRRPFCPSGHWLSEEVNIRADKVTQLYVPSARNVWRTRRMGRIG 658
            |||||||||||.|.|| || |||  |||||. .|.||||||||||..|.||| |||||||
Sbjct:  601 LFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIG 660

Query:  659 PLQSSLDVGLEPPQLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFT 718
            ||||.|||||| | ||||||| ||.|||||||| |||||||||.||||||.|||||||| 
Sbjct:  661 PLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFL 720

Query:  719 DGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNEL 778
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:  721 DGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNEL 780

Query:  779 LKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFA 838
            ||||||||||||| ||. ||||||||.||||||| |||||| |.||||||||||||||||
Sbjct:  781 LKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLARMLGKALYENMLVELPFA 840

Query:  839 SFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVV 898
             ||||||||||||||||||||||||.|.||||||||| ||||||||||||||||||||||
Sbjct:  841 GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVV 900

Query:  899 ELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQEL 958
            ||| ||||||||.||||||||||||||||.||| |||||||||||||.|||||||||||.
Sbjct:  901 ELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEI 960

Query:  959 QVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSR 1018
            ||||||| ||| |.||| ||||||||.  ||||. || |||||. |||||||||||||||
Sbjct:  961 QVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSR 1020

Query: 1019 PPLLGFKELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
            ||||||||||| |||||||.|||||||||||||||||||| |. |.|.||||||| ..||
Sbjct: 1021 PPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF 1080

Query: 1079 ELS 1081
            |||
Sbjct: 1081 ELS 1083

>hg18||uc003wng
        |7|BC014029|Q15386-2|Q15386-2|UBE3C|NM_014671|NP_055486|ubiquitin
        protein ligase E3C

          Length = 649

 Score =  773 bits (1995), Expect = 3e-223
 Identities = 393/639 (61%), Positives = 465/639 (72%), Gaps = 2/639 (0%)

Query:   1 MFSFEGDFRTRPSVSLGGASKKEEKASLLHRTQXXXXXXXXXXXXLKNAIIIQSFIRGYQ 60
           ||||||||.||| |||||||.||||||||||||            ||||||||||||||.
Sbjct:   1 MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR 60

Query:  61 DLKRQYATQRASFDECVSQSLVGGAQHTLDGPRLSLLSRQLIFFYKQSVDVHRLIWLCQN 120
           | |.||. ||..|| | . |  |||    .|| |.|| |||.|||||. |  ||||| ||
Sbjct:  61 DRKQQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN 120

Query: 121 LVKFNSQFVKLLMGPQSQTCLFQVKRILGFCCRLLQCCRDDSLNVTVPMRMLEVYSSEKT 180
           |.| .| ||| | | .  |||||.||..  |||||| | |||||| .|||||||.||| |
Sbjct: 121 LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENT 180

Query: 181 YHPVVPDALCLTSLLEQILHYMVQKGYYKSLYVLVNHKLPSSLEYSDSPSVPLASTLLEH 240
           | ||. ||  . |..|||||||.  |||.|||.|.| |||||.||||   ||.|  |||.
Sbjct: 181 YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN 240

Query: 241 ILKPLHFTYSSCTTGARQFVFAAFTKEFISAPFTEPIFHFFIPALSDAHVSFPFEAFLSS 300
           .||||||||.||  |||| || |||.||..||||. |||| ||||.||   ||.| ||..
Sbjct: 241 VLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA 300

Query: 301 LQATINSSSLLHSQAPWVFYFVLSAGENXXXXXXXXXXXXXXXXXXXXXXXXPVFXXXXX 360
           |    .  |     |||.|||||. |||                        ||      
Sbjct: 301 LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASAS 360

Query: 361 XXXXXXXXXXXNTGIQSSPMQDDSRISVQLITEECVHKLDSKHQTNALLNLVWRDSASEE 420
                      .         .| |.||  |||||. |||.| ||| |||||||||||||
Sbjct: 361 CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE 420

Query: 421 VFTMMASICHTLMVQHRLMVPKVRLLYSLAFNARFLRHLWHLITSMTTKMITGSTVALLQ 480
           ||| |||.|||||||||.|||||||||||||||||||||| ||.||.|.||||| | |||
Sbjct: 421 VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQ 480

Query: 481 LISRGSPMSFEDSNRXXXXXXXXXXXXXXXXXXVHDSEFFGHEIE--GRAQSSMMPFTLP 538
           .||||||||||||.|                  .||.||||  ||  |. ||||||||| 
Sbjct: 481 VISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLE 540

Query: 539 ELVTLSRCLRDACLGIIKLAYPETKAEHREEYMAAFRSVGVKTNTEVQQRIQAEQKRWVQ 598
           ||. ||||||||||||||||||||| | ||||. ||.|.|| |..|.|| || |||||.|
Sbjct: 541 ELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQ 600

Query: 599 LFKVITNLVKMVKARDIRRPFCPSGHWLSEEVNIRADKV 637
           |||||||||||.|.|| || |||  |||||. .|.||||
Sbjct: 601 LFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKV 639

>hg18||uc003wni |7|AK127280|NA|NA|KIAA0010|NA|NA|Homo sapiens cDNA FLJ45347 fis,
        clone BRHIP3011082, highly  similar to Homo sapiens ubiquitin-protein
        isopeptide ligase (E3)

          Length = 446

 Score =  755 bits (1948), Expect = 9e-218
 Identities = 370/416 (88%), Positives = 392/416 (94%)

Query:  666 VGLEPPQLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTI 725
            |||| | ||||||| ||.|||||||| |||||||||.||||||.|||||||| |||||||
Sbjct:   31 VGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFLDGINVTI 90

Query:  726 RRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNP 785
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct:   91 RRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNP 150

Query:  786 NQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKL 845
            |||||| ||. ||||||||.||||||| ||||||||.|||||||||||||||| ||||||
Sbjct:  151 NQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKL 210

Query:  846 LGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGK 905
            ||||||||||||||||||.|.||||||||| ||||||||||||||||||||||||| |||
Sbjct:  211 LGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGK 270

Query:  906 DIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGA 965
            |||||.||||||||||||||||.||| |||||||||||||.|||||||||||.|||||||
Sbjct:  271 DIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGA 330

Query:  966 HVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFK 1025
             ||| |.||| ||||||||.  ||||. || |||||. ||||||||||||||||||||||
Sbjct:  331 QVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFK 390

Query: 1026 ELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFELS 1081
            |||| |||||||.|||||||||||||||||||| |. |.|.||||||| ..|||||
Sbjct:  391 ELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGFELS 446

>hg18||uc003wnf
        |7|BC026241|Q15386-3|Q15386-3|UBE3C|NM_014671|NP_055486|ubiquitin
        protein ligase E3C

          Length = 404

 Score =  425 bits (1091), Expect = 2e-118
 Identities = 212/382 (55%), Positives = 261/382 (68%)

Query:  64 RQYATQRASFDECVSQSLVGGAQHTLDGPRLSLLSRQLIFFYKQSVDVHRLIWLCQNLVK 123
           |.|. ||..|| | . |  |||    .|| |.|| |||.|||||. |  ||||| |||.|
Sbjct:  21 RKYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQNLIK 80

Query: 124 FNSQFVKLLMGPQSQTCLFQVKRILGFCCRLLQCCRDDSLNVTVPMRMLEVYSSEKTYHP 183
            .| ||| | | .  |||||.||..  |||||| | |||||| .|||||||.||| || |
Sbjct:  81 HSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENTYLP 140

Query: 184 VVPDALCLTSLLEQILHYMVQKGYYKSLYVLVNHKLPSSLEYSDSPSVPLASTLLEHILK 243
           |. ||  . |..|||||||.  |||.|||.|.| |||||.||||   ||.|  |||..||
Sbjct: 141 VLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLENVLK 200

Query: 244 PLHFTYSSCTTGARQFVFAAFTKEFISAPFTEPIFHFFIPALSDAHVSFPFEAFLSSLQA 303
           ||||||.||  |||| || |||.||..||||. |||| ||||.||   ||.| ||..|  
Sbjct: 201 PLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNALLL 260

Query: 304 TINSSSLLHSQAPWVFYFVLSAGENXXXXXXXXXXXXXXXXXXXXXXXXPVFXXXXXXXX 363
             .  |     |||.|||||. |||                        ||         
Sbjct: 261 IESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASASCHD 320

Query: 364 XXXXXXXXNTGIQSSPMQDDSRISVQLITEECVHKLDSKHQTNALLNLVWRDSASEEVFT 423
                   .         .| |.||  |||||. |||.| ||| ||||||||||||||||
Sbjct: 321 SASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEEVFT 380

Query: 424 MMASICHTLMVQHRLMVPKVRL 445
            |||.|||||||||.||||||.
Sbjct: 381 TMASVCHTLMVQHRMMVPKVRV 402

>hg18||uc001top
        |12|NM_130466|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_130466|NP_569733|ubiquitin
        protein ligase E3B

          Length = 1068

 Score =  282 bits (720), Expect = 2e-075
 Identities = 154/370 (41%), Positives = 231/370 (62%), Gaps = 10/370 (2%)

Query:  672 QLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKRE---VQGDGPFTDGINVTIRRN 728
            .|    .|   ||  .| |.  . || .|. ..  .| .   |.         ..||||.
Sbjct:  629 ELDRDRKRAQLILQYIPHVIPHKNRVLLFRTMVTKEKEKLGLVETSSASPHVTHITIRRS 688

Query:  729 YIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQG 788
             . || |..|   ..  .|  |||  .|  |.||||||  |.|.||| |..|  |.|   
Sbjct:  689 RMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKRVFDPALN 748

Query:  789 FFKATN-DSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLG 847
             || |. |  |||.| .   . ... . . |.|..||||.|| ..|..||||||||.|||
Sbjct:  749 LFKTTSGDERLYPSPTS--YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLG 806

Query:  848 TSADV---DIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGG 904
                |    .  | ||| | |.||  .| |.||. .|||  .   . .|.    || |||
Sbjct:  807 HHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGG 866

Query:  905 KDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISG 964
            | ||||  |.|.||||.| .|.. ||.    |   |  ...  ||.|||   ||| ||||
Sbjct:  867 KTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISG 926

Query:  965 AHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVV-EGFSQEEKRKLLKFVTSCSRPPLLG 1023
             .  | |.|||| | | ||.  .| ||   |...   |. .|.   ||||||||||||||
Sbjct:  927 DNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLG 986

Query: 1024 FKELYPVFCI 1033
            |  | | | |
Sbjct:  987 FAYLKPPFSI 996

>hg18||uc001toq
        |12|NM_183415|Q9BXZ4|Q9BXZ4_HUMAN|UBE3B|NM_183415|NP_904324|ubiquitin
        protein ligase E3B

          Length = 1068

 Score =  282 bits (720), Expect = 2e-075
 Identities = 154/370 (41%), Positives = 231/370 (62%), Gaps = 10/370 (2%)

Query:  672 QLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKRE---VQGDGPFTDGINVTIRRN 728
            .|    .|   ||  .| |.  . || .|. ..  .| .   |.         ..||||.
Sbjct:  629 ELDRDRKRAQLILQYIPHVIPHKNRVLLFRTMVTKEKEKLGLVETSSASPHVTHITIRRS 688

Query:  729 YIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQG 788
             . || |..|   ..  .|  |||  .|  |.||||||  |.|.||| |..|  |.|   
Sbjct:  689 RMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKRVFDPALN 748

Query:  789 FFKATN-DSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLG 847
             || |. |  |||.| .   . ... . . |.|..||||.|| ..|..||||||||.|||
Sbjct:  749 LFKTTSGDERLYPSPTS--YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLG 806

Query:  848 TSADV---DIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGG 904
                |    .  | ||| | |.||  .| |.||. .|||  .   . .|.    || |||
Sbjct:  807 HHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGG 866

Query:  905 KDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISG 964
            | ||||  |.|.||||.| .|.. ||.    |   |  ...  ||.|||   ||| ||||
Sbjct:  867 KTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISG 926

Query:  965 AHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVV-EGFSQEEKRKLLKFVTSCSRPPLLG 1023
             .  | |.|||| | | ||.  .| ||   |...   |. .|.   ||||||||||||||
Sbjct:  927 DNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLG 986

Query: 1024 FKELYPVFCI 1033
            |  | | | |
Sbjct:  987 FAYLKPPFSI 996

>hg18||uc001tos |12|AK127227|NA|NA|UBE3B|NM_183415|NP_904324|ubiquitin protein
        ligase E3B

          Length = 495

 Score =  282 bits (720), Expect = 2e-075
 Identities = 154/370 (41%), Positives = 231/370 (62%), Gaps = 10/370 (2%)

Query:  672 QLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKRE---VQGDGPFTDGINVTIRRN 728
            .|    .|   ||  .| |.  . || .|. ..  .| .   |.         ..||||.
Sbjct:   56 ELDRDRKRAQLILQYIPHVIPHKNRVLLFRTMVTKEKEKLGLVETSSASPHVTHITIRRS 115

Query:  729 YIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQG 788
             . || |..|   ..  .|  |||  .|  |.||||||  |.|.||| |..|  |.|   
Sbjct:  116 RMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKRVFDPALN 175

Query:  789 FFKATN-DSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLG 847
             || |. |  |||.| .   . ... . . |.|..||||.|| ..|..||||||||.|||
Sbjct:  176 LFKTTSGDERLYPSPTS--YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLG 233

Query:  848 TSADV---DIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGG 904
                |    .  | ||| | |.||  .| |.||. .|||  .   . .|.    || |||
Sbjct:  234 HHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGG 293

Query:  905 KDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISG 964
            | ||||  |.|.||||.| .|.. ||.    |   |  ...  ||.|||   ||| ||||
Sbjct:  294 KTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISG 353

Query:  965 AHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVV-EGFSQEEKRKLLKFVTSCSRPPLLG 1023
             .  | |.|||| | | ||.  .| ||   |...   |. .|.   ||||||||||||||
Sbjct:  354 DNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLG 413

Query: 1024 FKELYPVFCI 1033
            |  | | | |
Sbjct:  414 FAYLKPPFSI 423

>hg18||uc002lgx
        |18|NM_015277|Q96PU5-5|Q96PU5-5|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 955

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  571 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 623

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  624 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 678

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  679 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 735

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  736 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 793

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  794 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 852

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  853 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 912

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  913 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 952

>hg18||uc002lgy
        |18|AY312514|Q96PU5|NED4L_HUMAN|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 975

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  591 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 643

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  644 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 698

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  699 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 755

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  756 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 813

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  814 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 872

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  873 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 932

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  933 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 972

>hg18||uc002lgz |18|DQ893350|Q96PU5-2|Q96PU5-2|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 911

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  527 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 579

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  580 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 634

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  635 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 691

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  692 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 749

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  750 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 808

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  809 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 868

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  869 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 908

>hg18||uc002lhb
        |18|DQ181796|Q3LSM7|Q3LSM7_HUMAN|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 834

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  450 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 502

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  503 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 557

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  558 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 614

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  615 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 672

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  673 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 731

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  732 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 791

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  792 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 831

>hg18||uc002lhc |18|AY112984|Q96PU5-7|Q96PU5-7|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 967

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  583 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 635

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  636 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 690

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  691 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 747

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  748 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 805

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  806 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 864

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  865 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 924

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  925 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 964

>hg18||uc002lhd |18|AY112983|Q96PU5-4|Q96PU5-4|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 854

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  470 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 522

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  523 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 577

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  578 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 634

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  635 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 692

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  693 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 751

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  752 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 811

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  812 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 851

>hg18||uc002lhe |18|AY112985|Q96PU5-6|Q96PU5-6|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 947

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  563 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 615

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  616 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 670

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  671 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 727

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  728 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 785

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  786 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 844

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  845 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 904

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  905 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 944

>hg18||uc002lhf
        |18|AB007899|Q3LSM7|Q3LSM7_HUMAN|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 834

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  450 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 502

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  503 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 557

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  558 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 614

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  615 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 672

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  673 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 731

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  732 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 791

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  792 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 831

>hg18||uc002lhg |18|AF210730|Q96PU5-4|Q96PU5-4|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 854

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  470 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 522

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  523 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 577

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  578 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 634

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  635 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 692

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  693 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 751

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  752 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 811

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  812 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 851

>hg18||uc002lhh |18|AL137469|Q96PU5-3|Q96PU5-3|NEDD4L|NM_015277|NP_056092|neural
        precursor cell expressed, developmentally

          Length = 750

 Score =  196 bits (498), Expect = 1e-049
 Identities = 130/401 (32%), Positives = 216/401 (53%), Gaps = 27/401 (6%)

Query:  687 LPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPD- 745
            .|.  .|...   |.|     | .   | |  .   . . || |.|..| ..     || 
Sbjct:  366 VPYSREFKQKYDYFRK-----KLKKPADIP--NRFEMKLHRNNIFEESYRRIMSVKRPDV 418

Query:  746 LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFK--ATNDSLLYPNPA 803
            || |. .   .     | |.| ||. ||.   | |  |||  | |.  ||..  |  || 
Sbjct:  419 LKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPN 473

Query:  804 AEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPE 863
            .  |  .    .. |.||. | |..   |..  |   |   .||    . .. . |.| |
Sbjct:  474 SG-LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLG--KQITLNDMESVDSE 530

Query:  864 MYRNLLFLKSYEGDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVAD 923
             | .| ..   | |  || | | .   . |.   |.||| | .| ||  |.  || ||  
Sbjct:  531 YYNSLKWI--LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQ 588

Query:  924 YRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG 983
            .|   ...    || .|   .. .. ...||. ||..|. |    . ..| .. . |  |
Sbjct:  589 WRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDWRQHSIYKNG 647

Query:  984 YTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGN 1038
            |   ||||| ||. |     |.. .||.|||  || |. || |||      .| |   |.
Sbjct:  648 YCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS 707

Query: 1039 DLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGFE 1079
              |.|| | || | | || .     .| ||| |.|.. |||
Sbjct:  708 P-EKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 747

>hg18||uc001zaq
        |15|NM_000462|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_000462|NP_000453|ubiquitin
        protein ligase E3A isoform 2

          Length = 875

 Score =  193 bits (490), Expect = 1e-048
 Identities = 129/407 (31%), Positives = 213/407 (52%), Gaps = 30/407 (7%)

Query:  679 RNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDA---Y 735
            .|| .  .    .  | |. .   |.     . |   |.   . . .||..| .||    
Sbjct:  489 KNLGLYYDNRIRMYSERRITVLYSLV-----QGQQLNPY---LRLKVRRDHIIDDALVRL 540

Query:  736 DKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKATND 795
            . .. ||  ||||.. |         | |.| ||. .||   ...  |||. | |     
Sbjct:  541 EMIAMENPADLKKQLYVEFEG-----EQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDES 595

Query:  796 S-LLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDI 854
            . | . ||..    |      .  .| .|| |.| | .... |      ||.|       
Sbjct:  596 TKLFWFNPSSFETEG-----QFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKG--TF 648

Query:  855 HHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFTVVNNDL-GEAQVVELKPGGKDIPVTTA 912
              |    | .|..|  |  |||.|| .. . | .   || |   . .||  |  ||.|  
Sbjct:  649 RDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNE 708

Query:  913 NRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLR-MFDQQELQVLISGAHVPICL 971
            ||  ...| .|| ||| .     |||.|   | |   |. .|  .|...|| |.   .  
Sbjct:  709 NRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSR-NLDF 767

Query:  972 DDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVF 1031
              |.. | | ||||    .|. |||.|  |. |.||  |.| |   | |. |  .|  . 
Sbjct:  768 QALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMI- 826

Query: 1032 CIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
             |   | | |||||. || |.| |||.  .  .. .|| ||  . ||
Sbjct:  827 -IAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 872

>hg18||uc001zar
        |15|AB194232|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130838|NP_570853|ubiquitin
        protein ligase E3A isoform 1

          Length = 852

 Score =  193 bits (490), Expect = 1e-048
 Identities = 129/407 (31%), Positives = 213/407 (52%), Gaps = 30/407 (7%)

Query:  679 RNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDA---Y 735
            .|| .  .    .  | |. .   |.     . |   |.   . . .||..| .||    
Sbjct:  466 KNLGLYYDNRIRMYSERRITVLYSLV-----QGQQLNPY---LRLKVRRDHIIDDALVRL 517

Query:  736 DKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKATND 795
            . .. ||  ||||.. |         | |.| ||. .||   ...  |||. | |     
Sbjct:  518 EMIAMENPADLKKQLYVEFEG-----EQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDES 572

Query:  796 S-LLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDI 854
            . | . ||..    |      .  .| .|| |.| | .... |      ||.|       
Sbjct:  573 TKLFWFNPSSFETEG-----QFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKG--TF 625

Query:  855 HHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFTVVNNDL-GEAQVVELKPGGKDIPVTTA 912
              |    | .|..|  |  |||.|| .. . | .   || |   . .||  |  ||.|  
Sbjct:  626 RDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNE 685

Query:  913 NRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLR-MFDQQELQVLISGAHVPICL 971
            ||  ...| .|| ||| .     |||.|   | |   |. .|  .|...|| |.   .  
Sbjct:  686 NRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSR-NLDF 744

Query:  972 DDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVF 1031
              |.. | | ||||    .|. |||.|  |. |.||  |.| |   | |. |  .|  . 
Sbjct:  745 QALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMI- 803

Query: 1032 CIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
             |   | | |||||. || |.| |||.  .  .. .|| ||  . ||
Sbjct:  804 -IAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 849

>hg18||uc001zas
        |15|NM_130839|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130839|NP_570854|ubiquitin
        protein ligase E3A isoform 3

          Length = 872

 Score =  193 bits (490), Expect = 1e-048
 Identities = 129/407 (31%), Positives = 213/407 (52%), Gaps = 30/407 (7%)

Query:  679 RNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDA---Y 735
            .|| .  .    .  | |. .   |.     . |   |.   . . .||..| .||    
Sbjct:  486 KNLGLYYDNRIRMYSERRITVLYSLV-----QGQQLNPY---LRLKVRRDHIIDDALVRL 537

Query:  736 DKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKATND 795
            . .. ||  ||||.. |         | |.| ||. .||   ...  |||. | |     
Sbjct:  538 EMIAMENPADLKKQLYVEFEG-----EQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDES 592

Query:  796 S-LLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDI 854
            . | . ||..    |      .  .| .|| |.| | .... |      ||.|       
Sbjct:  593 TKLFWFNPSSFETEG-----QFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKG--TF 645

Query:  855 HHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFTVVNNDL-GEAQVVELKPGGKDIPVTTA 912
              |    | .|..|  |  |||.|| .. . | .   || |   . .||  |  ||.|  
Sbjct:  646 RDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNE 705

Query:  913 NRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLR-MFDQQELQVLISGAHVPICL 971
            ||  ...| .|| ||| .     |||.|   | |   |. .|  .|...|| |.   .  
Sbjct:  706 NRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSR-NLDF 764

Query:  972 DDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVF 1031
              |.. | | ||||    .|. |||.|  |. |.||  |.| |   | |. |  .|  . 
Sbjct:  765 QALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMI- 823

Query: 1032 CIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
             |   | | |||||. || |.| |||.  .  .. .|| ||  . ||
Sbjct:  824 -IAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 869

>hg18||uc001zat
        |15|U84404|Q9H2G0|Q9H2G0_HUMAN|UBE3A|NM_130838|NP_570853|ubiquitin
        protein ligase E3A isoform 1

          Length = 852

 Score =  193 bits (490), Expect = 1e-048
 Identities = 129/407 (31%), Positives = 213/407 (52%), Gaps = 30/407 (7%)

Query:  679 RNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDA---Y 735
            .|| .  .    .  | |. .   |.     . |   |.   . . .||..| .||    
Sbjct:  466 KNLGLYYDNRIRMYSERRITVLYSLV-----QGQQLNPY---LRLKVRRDHIIDDALVRL 517

Query:  736 DKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKATND 795
            . .. ||  ||||.. |         | |.| ||. .||   ...  |||. | |     
Sbjct:  518 EMIAMENPADLKKQLYVEFEG-----EQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDES 572

Query:  796 S-LLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDI 854
            . | . ||..    |      .  .| .|| |.| | .... |      ||.|       
Sbjct:  573 TKLFWFNPSSFETEG-----QFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKG--TF 625

Query:  855 HHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFTVVNNDL-GEAQVVELKPGGKDIPVTTA 912
              |    | .|..|  |  |||.|| .. . | .   || |   . .||  |  ||.|  
Sbjct:  626 RDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNE 685

Query:  913 NRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLR-MFDQQELQVLISGAHVPICL 971
            ||  ...| .|| ||| .     |||.|   | |   |. .|  .|...|| |.   .  
Sbjct:  686 NRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSR-NLDF 744

Query:  972 DDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVF 1031
              |.. | | ||||    .|. |||.|  |. |.||  |.| |   | |. |  .|  . 
Sbjct:  745 QALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMI- 803

Query: 1032 CIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
             |   | | |||||. || |.| |||.  .  .. .|| ||  . ||
Sbjct:  804 -IAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 849

>hg18||uc004dsn |X|AB002310|Q5H924|Q5H924_HUMAN|HUWE1|NM_031407|NP_113584|HECT,
        UBA and WWE domain containing 1

          Length = 3182

 Score =  189 bits (479), Expect = 2e-047
 Identities = 134/407 (32%), Positives = 209/407 (51%), Gaps = 28/407 (6%)

Query:  682 AILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPE 741
            |.| .   |. |. . | |..     . |   .|   . . | .||....||.| .|  .
Sbjct: 2791 AVLVDYIRVLDFDVKRKYFRQ-----ELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRK 2845

Query:  742 NEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKAT-NDSLLYP 800
            .  ..| |. .         | | | ||. ||.   . .  |||    |. .  | . | 
Sbjct: 2846 SPEEMKNRLYIVFEG-----EEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYT 2900

Query:  801 -NPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLAS 859
             ||..      .   .. |.||.. ||.|.| |.|  |   |   .|| |  |    . |
Sbjct: 2901 INPSSH--CNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS--VRYTDMES 2956

Query:  860 LDPEMYRNLLFLKSYEGDVEELG--LNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAY 917
             |   |. |..|   | ||  ||  | |.    . |  .| .||| | .| ||  |.  |
Sbjct: 2957 EDYHFYQGLVYL--LENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEY 3014

Query:  918 IHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKF 977
            .|||   |.   ||    || .|   ..    . .| .|||..||||    | .||||  
Sbjct: 3015 VHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPT-IDIDDLKSN 3073

Query:  978 TNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPV-----FC 1032
            | |   |      || ||  .  | | .. | |.|||  |. || ||  |  .     | 
Sbjct: 3074 TEYH-KYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQ 3132

Query: 1033 IHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAI-ESSSGF 1078
            ||      .|||.| || | | || .     .|. || || | | ||
Sbjct: 3133 IHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGF 3179

>hg18||uc004dso |X|NM_031407|Q7Z6Z7|HUWE1_HUMAN|HUWE1|NM_031407|NP_113584|HECT,
        UBA and WWE domain containing 1

          Length = 4374

 Score =  189 bits (479), Expect = 2e-047
 Identities = 134/407 (32%), Positives = 209/407 (51%), Gaps = 28/407 (6%)

Query:  682 AILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPE 741
            |.| .   |. |. . | |..     . |   .|   . . | .||....||.| .|  .
Sbjct: 3983 AVLVDYIRVLDFDVKRKYFRQ-----ELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRK 4037

Query:  742 NEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKAT-NDSLLYP 800
            .  ..| |. .         | | | ||. ||.   . .  |||    |. .  | . | 
Sbjct: 4038 SPEEMKNRLYIVFEG-----EEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYT 4092

Query:  801 -NPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLAS 859
             ||..      .   .. |.||.. ||.|.| |.|  |   |   .|| |  |    . |
Sbjct: 4093 INPSSH--CNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS--VRYTDMES 4148

Query:  860 LDPEMYRNLLFLKSYEGDVEELG--LNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAY 917
             |   |. |..|   | ||  ||  | |.    . |  .| .||| | .| ||  |.  |
Sbjct: 4149 EDYHFYQGLVYL--LENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEY 4206

Query:  918 IHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKF 977
            .|||   |.   ||    || .|   ..    . .| .|||..||||    | .||||  
Sbjct: 4207 VHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPT-IDIDDLKSN 4265

Query:  978 TNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPV-----FC 1032
            | |   |      || ||  .  | | .. | |.|||  |. || ||  |  .     | 
Sbjct: 4266 TEYH-KYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQ 4324

Query: 1033 IHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAI-ESSSGF 1078
            ||      .|||.| || | | || .     .|. || || | | ||
Sbjct: 4325 IHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGF 4371

>hg18||uc004dsp |X|DQ097177|Q7Z6Z7|HUWE1_HUMAN|HUWE1|NM_031407|NP_113584|HECT,
        UBA and WWE domain containing 1

          Length = 4374

 Score =  189 bits (479), Expect = 2e-047
 Identities = 134/407 (32%), Positives = 209/407 (51%), Gaps = 28/407 (6%)

Query:  682 AILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPE 741
            |.| .   |. |. . | |..     . |   .|   . . | .||....||.| .|  .
Sbjct: 3983 AVLVDYIRVLDFDVKRKYFRQ-----ELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRK 4037

Query:  742 NEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKAT-NDSLLYP 800
            .  ..| |. .         | | | ||. ||.   . .  |||    |. .  | . | 
Sbjct: 4038 SPEEMKNRLYIVFEG-----EEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYT 4092

Query:  801 -NPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLAS 859
             ||..      .   .. |.||.. ||.|.| |.|  |   |   .|| |  |    . |
Sbjct: 4093 INPSSH--CNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS--VRYTDMES 4148

Query:  860 LDPEMYRNLLFLKSYEGDVEELG--LNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAY 917
             |   |. |..|   | ||  ||  | |.    . |  .| .||| | .| ||  |.  |
Sbjct: 4149 EDYHFYQGLVYL--LENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEY 4206

Query:  918 IHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKF 977
            .|||   |.   ||    || .|   ..    . .| .|||..||||    | .||||  
Sbjct: 4207 VHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPT-IDIDDLKSN 4265

Query:  978 TNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPV-----FC 1032
            | |   |      || ||  .  | | .. | |.|||  |. || ||  |  .     | 
Sbjct: 4266 TEYH-KYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQ 4324

Query: 1033 IHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAI-ESSSGF 1078
            ||      .|||.| || | | || .     .|. || || | | ||
Sbjct: 4325 IHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGF 4371

>hg18||uc003pqt |6|AB037741|Q5VUA0|Q5VUA0_HUMAN|HACE1|NM_020771|NP_065822|HECT
        domain and ankyrin repeat containing, E3

          Length = 562

 Score =  184 bits (466), Expect = 6e-046
 Identities = 123/368 (33%), Positives = 189/368 (51%), Gaps = 19/368 (5%)

Query:  716 PFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFL 775
            |  .   . . |. |.  . . .|  |   ||. | |      |.      | |. ||. 
Sbjct:  201 PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGM------GQGVVREWF 254

Query:  776 NELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVEL 835
            . |     ||.   |  . |   .  | .   |      .. | |..|| ||    || .
Sbjct:  255 DILSNEIVNPDYALFTQSADGTTF-QPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI 313

Query:  836 PFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELG--LNFTVVNNDLG 893
             |   |   .||    |.   .||.|||  .|| ..   . |. .||  | |.|  .  |
Sbjct:  314 YFTRSFYKHILG--IPVNYQDVASIDPEYAKNLQWI--LDNDISDLGLELTFSVETDVFG 369

Query:  894 EAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMF 953
              . | |||||  | ||  |.  |. || . |. . |.|   || ||    .    ...|
Sbjct:  370 AMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLF 429

Query:  954 DQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFV 1013
            |. ||..|.||    | . |  | | |. ||    |||| ||||||  .|||.  ||.||
Sbjct:  430 DEYELELLLSGM-PEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFV 488

Query: 1014 TSCSRPPLLGFKEL-----YPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKL 1068
            |  || |  ||  .        | |         |||.|||.|.|||||.  . .....|
Sbjct:  489 TGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRL 548

Query: 1069 LYAIESSS 1076
            | |.   |
Sbjct:  549 LVALHCGS 556

>hg18||uc003pqu |6|NM_020771|Q8IYU2|Q8IYU2_HUMAN|HACE1|NM_020771|NP_065822|HECT
        domain and ankyrin repeat containing, E3

          Length = 909

 Score =  184 bits (466), Expect = 6e-046
 Identities = 123/368 (33%), Positives = 189/368 (51%), Gaps = 19/368 (5%)

Query:  716 PFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFL 775
            |  .   . . |. |.  . . .|  |   ||. | |      |.      | |. ||. 
Sbjct:  548 PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGM------GQGVVREWF 601

Query:  776 NELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVEL 835
            . |     ||.   |  . |   .  | .   |      .. | |..|| ||    || .
Sbjct:  602 DILSNEIVNPDYALFTQSADGTTF-QPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI 660

Query:  836 PFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELG--LNFTVVNNDLG 893
             |   |   .||    |.   .||.|||  .|| ..   . |. .||  | |.|  .  |
Sbjct:  661 YFTRSFYKHILG--IPVNYQDVASIDPEYAKNLQWI--LDNDISDLGLELTFSVETDVFG 716

Query:  894 EAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMF 953
              . | |||||  | ||  |.  |. || . |. . |.|   || ||    .    ...|
Sbjct:  717 AMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLF 776

Query:  954 DQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFV 1013
            |. ||..|.||    | . |  | | |. ||    |||| ||||||  .|||.  ||.||
Sbjct:  777 DEYELELLLSGM-PEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFV 835

Query: 1014 TSCSRPPLLGFKEL-----YPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKL 1068
            |  || |  ||  .        | |         |||.|||.|.|||||.  . .....|
Sbjct:  836 TGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRL 895

Query: 1069 LYAIESSS 1076
            | |.   |
Sbjct:  896 LVALHCGS 903

>hg18||uc002exu |16|NM_007014|O00308|WWP2_HUMAN|WWP2|NM_007014|NP_008945|WW
        domain containing E3 ubiquitin protein ligase

          Length = 870

 Score =  183 bits (462), Expect = 2e-045
 Identities = 121/367 (32%), Positives = 188/367 (51%), Gaps = 23/367 (6%)

Query:  721 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLK 780
            . ... |  ..||.. ..      ||..|. . .       | |.| ||| ||.   |  
Sbjct:  515 VKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRG-----EEGLDYGGIAREWFFLLSH 569

Query:  781 SGFNPNQGFFK--ATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFA 838
               ||    |.    |.  |  |||.   .      .. |.|| .  |||    ..  | 
Sbjct:  570 EVLNPMYCLFEYAGKNNYCLQINPASS--INPDHLTYFRFIGRFIAMALYHGKFIDTGFT 627

Query:  839 SFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNN--DLGEAQ 896
              |  ..|       .  | |.||| | .....|  | ..|| ||    . .   ||.  
Sbjct:  628 LPFYKRMLNKRP--TLKDLESIDPEFYNSIVWIK--ENNLEECGLELYFIQDMEILGKVT 683

Query:  897 VVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQ 956
              ||| ||. | ||  |.  || |. |.|  . .     ||  |   |  ||||| ||..
Sbjct:  684 THELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEK 743

Query:  957 ELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSC 1016
            ||.... |    | . | .| | |   ||     || ||.||.    |.. .||.|||  
Sbjct:  744 ELELMLCGMQ-EIDMSDWQKSTIYR-HYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGT 801

Query: 1017 SRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYA 1071
             | |. || ||        |||   | .   || . || | | || .     .| |||||
Sbjct:  802 CRLPVGGFAELIGSNGPQKFCIDKVGKE-TWLPRSHTCFNRLDLPPYKSYEQLREKLLYA 860

Query: 1072 IESSSGF 1078
            || . ||
Sbjct:  861 IEETEGF 867

>hg18||uc002exv |16|BC064531|O00308|WWP2_HUMAN|WWP2|NM_007014|NP_008945|WW
        domain containing E3 ubiquitin protein ligase

          Length = 870

 Score =  183 bits (462), Expect = 2e-045
 Identities = 121/367 (32%), Positives = 188/367 (51%), Gaps = 23/367 (6%)

Query:  721 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLK 780
            . ... |  ..||.. ..      ||..|. . .       | |.| ||| ||.   |  
Sbjct:  515 VKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRG-----EEGLDYGGIAREWFFLLSH 569

Query:  781 SGFNPNQGFFK--ATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFA 838
               ||    |.    |.  |  |||.   .      .. |.|| .  |||    ..  | 
Sbjct:  570 EVLNPMYCLFEYAGKNNYCLQINPASS--INPDHLTYFRFIGRFIAMALYHGKFIDTGFT 627

Query:  839 SFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNN--DLGEAQ 896
              |  ..|       .  | |.||| | .....|  | ..|| ||    . .   ||.  
Sbjct:  628 LPFYKRMLNKRP--TLKDLESIDPEFYNSIVWIK--ENNLEECGLELYFIQDMEILGKVT 683

Query:  897 VVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQ 956
              ||| ||. | ||  |.  || |. |.|  . .     ||  |   |  ||||| ||..
Sbjct:  684 THELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEK 743

Query:  957 ELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSC 1016
            ||.... |    | . | .| | |   ||     || ||.||.    |.. .||.|||  
Sbjct:  744 ELELMLCGMQ-EIDMSDWQKSTIYR-HYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGT 801

Query: 1017 SRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYA 1071
             | |. || ||        |||   | .   || . || | | || .     .| |||||
Sbjct:  802 CRLPVGGFAELIGSNGPQKFCIDKVGKE-TWLPRSHTCFNRLDLPPYKSYEQLREKLLYA 860

Query: 1072 IESSSGF 1078
            || . ||
Sbjct:  861 IEETEGF 867

>hg18||uc002exw |16|NM_199424|NA|NA|WWP2|NM_199424|NP_955456|WW domain
        containing E3 ubiquitin protein ligase

          Length = 431

 Score =  183 bits (462), Expect = 2e-045
 Identities = 121/367 (32%), Positives = 188/367 (51%), Gaps = 23/367 (6%)

Query:  721 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLK 780
            . ... |  ..||.. ..      ||..|. . .       | |.| ||| ||.   |  
Sbjct:   76 VKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRG-----EEGLDYGGIAREWFFLLSH 130

Query:  781 SGFNPNQGFFK--ATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFA 838
               ||    |.    |.  |  |||.   .      .. |.|| .  |||    ..  | 
Sbjct:  131 EVLNPMYCLFEYAGKNNYCLQINPASS--INPDHLTYFRFIGRFIAMALYHGKFIDTGFT 188

Query:  839 SFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFTVVNN--DLGEAQ 896
              |  ..|       .  | |.||| | .....|  | ..|| ||    . .   ||.  
Sbjct:  189 LPFYKRMLNKRP--TLKDLESIDPEFYNSIVWIK--ENNLEECGLELYFIQDMEILGKVT 244

Query:  897 VVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQ 956
              ||| ||. | ||  |.  || |. |.|  . .     ||  |   |  ||||| ||..
Sbjct:  245 THELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEK 304

Query:  957 ELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSC 1016
            ||.... |    | . | .| | |   ||     || ||.||.    |.. .||.|||  
Sbjct:  305 ELELMLCGMQ-EIDMSDWQKSTIYR-HYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGT 362

Query: 1017 SRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYA 1071
             | |. || ||        |||   | .   || . || | | || .     .| |||||
Sbjct:  363 CRLPVGGFAELIGSNGPQKFCIDKVGKE-TWLPRSHTCFNRLDLPPYKSYEQLREKLLYA 421

Query: 1072 IESSSGF 1078
            || . ||
Sbjct:  422 IEETEGF 428

>hg18||uc002utl
        |2|CR749424|Q68DF8|Q68DF8_HUMAN|DKFZp686M17164|NA|NA|Hypothetical
        protein DKFZp686M17164

          Length = 1216

 Score =  181 bits (457), Expect = 7e-045
 Identities = 137/427 (32%), Positives = 212/427 (49%), Gaps = 24/427 (5%)

Query:  661 QSSLDVGLEPPQLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDG 720
            ||     .  || |   .|  |     |.   || ... | .     | | .| |     
Sbjct:  806 QSPRGSPVSSPQNSPGTQRANA-RAPAPYKRDFEAKLRNFYR-----KLETKGYGQGPGK 859

Query:  721 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLK 780
            . . |||... |||....   .  ||..    . |    . | |.|  |  |||   . .
Sbjct:  860 LKLIIRRDHLLEDAFNQIMGYSRKDLQR----NKLYVTFVGEEGLDYSGPSREFFFLVSR 915

Query:  781 SGFNPNQGFFK-ATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFAS 839
              |||  | |. . ||.           | |.    . | ||.|| ||    |..  |  
Sbjct:  916 ELFNPYYGLFEYSANDTYTVQISPMSAFV-DNHHEWFRFSGRILGLALIHQYLLDAFFTR 974

Query:  840 FFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFTVVNNDLGEAQVV 898
             |   ||      |.  |  || | ...| ..|  . |. . | | |||     |.    
Sbjct:  975 PFYKALLRILC--DLSDLEYLDEEFHQSLQWMK--DNDIHDILDLTFTVNEEVFGQITER 1030

Query:  899 ELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQEL 958
            |||||| .||||  |.  ||  .  .|. . .     .  .|   ||.   . .|| .||
Sbjct: 1031 ELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDAREL 1090

Query:  959 QVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSR 1018
            ...|.|    | | | .  | | ||| | | ||. ||  || |. |.. .||.|||  | 
Sbjct: 1091 ELVIAGT-AEIDLSDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSS 1149

Query: 1019 PPLLGFKELYPV-----FCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIE 1073
             |  ||  |        ||.   |  .  || | || | | || .   ...  ||| |.|
Sbjct: 1150 IPYEGFASLRGSNGPRRFCVEKWGK-ITALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVE 1208

Query: 1074 SSSGFEL 1080
             .| | |
Sbjct: 1209 ETSTFGL 1215

>hg18||uc002utm |2|NM_020760|Q17RT5|Q17RT5_HUMAN|HECW2|NM_020760|NP_065811|HECT,
        C2 and WW domain containing E3 ubiquitin

          Length = 1572

 Score =  181 bits (457), Expect = 7e-045
 Identities = 137/427 (32%), Positives = 212/427 (49%), Gaps = 24/427 (5%)

Query:  661 QSSLDVGLEPPQLSVSEERNLAILTELPFVVQFEERVKIFQKLIYADKREVQGDGPFTDG 720
            ||     .  || |   .|  |     |.   || ... | .     | | .| |     
Sbjct: 1162 QSPRGSPVSSPQNSPGTQRANA-RAPAPYKRDFEAKLRNFYR-----KLETKGYGQGPGK 1215

Query:  721 INVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLK 780
            . . |||... |||....   .  ||..    . |    . | |.|  |  |||   . .
Sbjct: 1216 LKLIIRRDHLLEDAFNQIMGYSRKDLQR----NKLYVTFVGEEGLDYSGPSREFFFLVSR 1271

Query:  781 SGFNPNQGFFK-ATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFAS 839
              |||  | |. . ||.           | |.    . | ||.|| ||    |..  |  
Sbjct: 1272 ELFNPYYGLFEYSANDTYTVQISPMSAFV-DNHHEWFRFSGRILGLALIHQYLLDAFFTR 1330

Query:  840 FFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFTVVNNDLGEAQVV 898
             |   ||      |.  |  || | ...| ..|  . |. . | | |||     |.    
Sbjct: 1331 PFYKALLRILC--DLSDLEYLDEEFHQSLQWMK--DNDIHDILDLTFTVNEEVFGQITER 1386

Query:  899 ELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQEL 958
            |||||| .||||  |.  ||  .  .|. . .     .  .|   ||.   . .|| .||
Sbjct: 1387 ELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDAREL 1446

Query:  959 QVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSR 1018
            ...|.|    | | | .  | | ||| | | ||. ||  || |. |.. .||.|||  | 
Sbjct: 1447 ELVIAGT-AEIDLSDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSS 1505

Query: 1019 PPLLGFKELYPV-----FCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIE 1073
             |  ||  |        ||.   |  .  || | || | | || .   ...  ||| |.|
Sbjct: 1506 IPYEGFASLRGSNGPRRFCVEKWGK-ITALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVE 1564

Query: 1074 SSSGFEL 1080
             .| | |
Sbjct: 1565 ETSTFGL 1571

>hg18||uc003upu |7|NM_020429|Q9HCE7|SMUF1_HUMAN|SMURF1|NM_020429|NP_065162|Smad
        ubiquitination regulatory factor 1 isoform

          Length = 757

 Score =  179 bits (454), Expect = 2e-044
 Identities = 114/380 (30%), Positives = 193/380 (50%), Gaps = 20/380 (5%)

Query:  708 KREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDG 767
            . |.    |      . . |  |.|..| ..      |||||. |         | |.| 
Sbjct:  386 RHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRG-----EEGLDY 440

Query:  768 GGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKAL 827
            ||. ||.|  |     ||  | |. . |..       .  .      ...|.||..| |.
Sbjct:  441 GGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAV 500

Query:  828 YENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFT 886
            .    .   |   |  .|||    . .  | |.|||....|...   | |.   |   | 
Sbjct:  501 FHGHYINGGFTVPFYKQLLG--KPIQLSDLESVDPELHKSLVWI--LENDITPVLDHTFC 556

Query:  887 VVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVN 946
            | .|  |     |||| |...|||  |.  |. |  ..|  . |    || ..|   .. 
Sbjct:  557 VEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIP 616

Query:  947 LEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEK 1006
               |. |||.||...| |    | |.| |  |       |.. ... ||. || | .| .
Sbjct:  617 QHLLKPFDQKELELIIGGLD-KIDLNDWKSNTRLKHCVADSN-IVRWFWQAVETFDEERR 674

Query: 1007 RKLLKFVTSCSRPPLLGFKELY--------PVFCIHNGGNDLERLPTASTCMNLLKLPEF 1058
             .||.|||  .| || ||| |          .| ||    . . || | || | . .| .
Sbjct:  675 ARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPY 734

Query: 1059 CDQNLMRNKLLYAIESSSGF 1078
                 .  ||| |.| . ||
Sbjct:  735 ESYEKLYEKLLTAVEETCGF 754

>hg18||uc003upv |7|NM_181349|Q9HCE7-2|Q9HCE7-2|SMURF1|NM_181349|NP_851994|Smad
        ubiquitination regulatory factor 1 isoform

          Length = 731

 Score =  179 bits (454), Expect = 2e-044
 Identities = 114/380 (30%), Positives = 193/380 (50%), Gaps = 20/380 (5%)

Query:  708 KREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDG 767
            . |.    |      . . |  |.|..| ..      |||||. |         | |.| 
Sbjct:  360 RHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRG-----EEGLDY 414

Query:  768 GGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKAL 827
            ||. ||.|  |     ||  | |. . |..       .  .      ...|.||..| |.
Sbjct:  415 GGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAV 474

Query:  828 YENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFT 886
            .    .   |   |  .|||    . .  | |.|||....|...   | |.   |   | 
Sbjct:  475 FHGHYINGGFTVPFYKQLLG--KPIQLSDLESVDPELHKSLVWI--LENDITPVLDHTFC 530

Query:  887 VVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVN 946
            | .|  |     |||| |...|||  |.  |. |  ..|  . |    || ..|   .. 
Sbjct:  531 VEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIP 590

Query:  947 LEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEK 1006
               |. |||.||...| |    | |.| |  |       |.. ... ||. || | .| .
Sbjct:  591 QHLLKPFDQKELELIIGGLD-KIDLNDWKSNTRLKHCVADSN-IVRWFWQAVETFDEERR 648

Query: 1007 RKLLKFVTSCSRPPLLGFKELY--------PVFCIHNGGNDLERLPTASTCMNLLKLPEF 1058
             .||.|||  .| || ||| |          .| ||    . . || | || | . .| .
Sbjct:  649 ARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPY 708

Query: 1059 CDQNLMRNKLLYAIESSSGF 1078
                 .  ||| |.| . ||
Sbjct:  709 ESYEKLYEKLLTAVEETCGF 728

>hg18||uc003pqs |6|AL834202|Q8ND12|Q8ND12_HUMAN|DKFZp434M0621|NA|NA|Hypothetical
        protein DKFZp434M0621

          Length = 318

 Score =  176 bits (446), Expect = 1e-043
 Identities = 113/317 (35%), Positives = 169/317 (53%), Gaps = 13/317 (4%)

Query:  767 GGGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKA 826
            | |. ||. . |     ||.   |  . |   .  | .   |      .. | |..|| |
Sbjct:    2 GQGVVREWFDILSNEIVNPDYALFTQSADGTTF-QPNSNSYVNPDHLNYFRFAGQILGLA 60

Query:  827 LYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELG--LN 884
            |    || . |   |   .||    |.   .||.|||  .|| ..   . |. .||  | 
Sbjct:   61 LNHRQLVNIYFTRSFYKHILG--IPVNYQDVASIDPEYAKNLQWI--LDNDISDLGLELT 116

Query:  885 FTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANV 944
            |.|  .  |  . | |||||  | ||  |.  |. || . |. . |.|   || ||    
Sbjct:  117 FSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMF 176

Query:  945 VNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQE 1004
            .    ...||. ||..|.||    | . |  | | |. ||    |||| ||||||  .||
Sbjct:  177 IPPSLIQLFDEYELELLLSGM-PEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQE 235

Query: 1005 EKRKLLKFVTSCSRPPLLGFKEL-----YPVFCIHNGGNDLERLPTASTCMNLLKLPEFC 1059
            |.  ||.|||  || |  ||  .        | |         |||.|||.|.|||||. 
Sbjct:  236 ERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYP 295

Query: 1060 DQNLMRNKLLYAIESSS 1076
             . .....|| |.   |
Sbjct:  296 SKEILKDRLLVALHCGS 312

>hg18||uc002jep |17|NM_022739|Q9HAU4|SMUF2_HUMAN|SMURF2|NM_022739|NP_073576|SMAD
        specific E3 ubiquitin protein ligase 2

          Length = 748

 Score =  173 bits (436), Expect = 2e-042
 Identities = 116/377 (30%), Positives = 189/377 (50%), Gaps = 17/377 (4%)

Query:  708 KREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDG 767
            ..|.    |      . . |  |.|..| ..      || ||. .         | |.| 
Sbjct:  380 RQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRG-----EEGLDY 434

Query:  768 GGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKAL 827
            ||. ||.|  |     ||  | |. . | .       .  |      ...|.||..| |.
Sbjct:  435 GGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAV 494

Query:  828 YENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFT 886
            .    ..  |   |  .||| |  .|   |  .||... .|...   | |.   |   | 
Sbjct:  495 FHGHYIDGGFTLPFYKQLLGKSITLDDMEL--VDPDLHNSLVWI--LENDITGVLDHTFC 550

Query:  887 VVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVN 946
            | .|  ||    |||| || |||   |.  |. |  ..|  . |    || ..|   |. 
Sbjct:  551 VEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIP 610

Query:  947 LEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEK 1006
               |. ||..||...| |    | ..| |  |       |.. ... ||. || | .| .
Sbjct:  611 QHLLKTFDEKELELIICGLG-KIDVNDWKVNTRLKHCTPDSN-IVKWFWKAVEFFDEERR 668

Query: 1007 RKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQ 1061
             .||.|||  || || ||| |       .| ||        || | || | . .| .   
Sbjct:  669 ARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESY 728

Query: 1062 NLMRNKLLYAIESSSGF 1078
              .  ||| ||| . ||
Sbjct:  729 EKLYEKLLTAIEETCGF 745

>hg18||uc002jeq |17|BC051283|NA|NA|SMURF2|NA|NA|Homo sapiens ubiquitin E3 ligase
        SMURF2 (SMURF2) mRNA, complete cds

          Length = 507

 Score =  173 bits (436), Expect = 2e-042
 Identities = 116/377 (30%), Positives = 189/377 (50%), Gaps = 17/377 (4%)

Query:  708 KREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDG 767
            ..|.    |      . . |  |.|..| ..      || ||. .         | |.| 
Sbjct:  139 RQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRG-----EEGLDY 193

Query:  768 GGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKAL 827
            ||. ||.|  |     ||  | |. . | .       .  |      ...|.||..| |.
Sbjct:  194 GGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAV 253

Query:  828 YENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFT 886
            .    ..  |   |  .||| |  .|   |  .||... .|...   | |.   |   | 
Sbjct:  254 FHGHYIDGGFTLPFYKQLLGKSITLDDMEL--VDPDLHNSLVWI--LENDITGVLDHTFC 309

Query:  887 VVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVN 946
            | .|  ||    |||| || |||   |.  |. |  ..|  . |    || ..|   |. 
Sbjct:  310 VEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIP 369

Query:  947 LEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEK 1006
               |. ||..||...| |    | ..| |  |       |.. ... ||. || | .| .
Sbjct:  370 QHLLKTFDEKELELIICGLG-KIDVNDWKVNTRLKHCTPDSN-IVKWFWKAVEFFDEERR 427

Query: 1007 RKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQ 1061
             .||.|||  || || ||| |       .| ||        || | || | . .| .   
Sbjct:  428 ARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESY 487

Query: 1062 NLMRNKLLYAIESSSGF 1078
              .  ||| ||| . ||
Sbjct:  488 EKLYEKLLTAIEETCGF 504

>hg18||uc002jer |17|CR936721|Q52LL1|Q52LL1_HUMAN|SMURF2|NM_022739|NP_073576|SMAD
        specific E3 ubiquitin protein ligase 2

          Length = 507

 Score =  173 bits (436), Expect = 2e-042
 Identities = 116/377 (30%), Positives = 189/377 (50%), Gaps = 17/377 (4%)

Query:  708 KREVQGDGPFTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDG 767
            ..|.    |      . . |  |.|..| ..      || ||. .         | |.| 
Sbjct:  139 RQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRG-----EEGLDY 193

Query:  768 GGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKAL 827
            ||. ||.|  |     ||  | |. . | .       .  |      ...|.||..| |.
Sbjct:  194 GGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAV 253

Query:  828 YENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVE-ELGLNFT 886
            .    ..  |   |  .||| |  .|   |  .||... .|...   | |.   |   | 
Sbjct:  254 FHGHYIDGGFTLPFYKQLLGKSITLDDMEL--VDPDLHNSLVWI--LENDITGVLDHTFC 309

Query:  887 VVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVN 946
            | .|  ||    |||| || |||   |.  |. |  ..|  . |    || ..|   |. 
Sbjct:  310 VEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIP 369

Query:  947 LEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEK 1006
               |. ||..||...| |    | ..| |  |       |.. ... ||. || | .| .
Sbjct:  370 QHLLKTFDEKELELIICGLG-KIDVNDWKVNTRLKHCTPDSN-IVKWFWKAVEFFDEERR 427

Query: 1007 RKLLKFVTSCSRPPLLGFKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQ 1061
             .||.|||  || || ||| |       .| ||        || | || | . .| .   
Sbjct:  428 ARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESY 487

Query: 1062 NLMRNKLLYAIESSSGF 1078
              .  ||| ||| . ||
Sbjct:  488 EKLYEKLLTAIEETCGF 504

>hg18||uc003hrw |4|NM_014606|Q15034|HERC3_HUMAN|HERC3|NM_014606|NP_055421|hect
        domain and RLD 3

          Length = 1050

 Score =  156 bits (393), Expect = 2e-037
 Identities = 113/358 (31%), Positives = 169/358 (47%), Gaps = 20/358 (5%)

Query:  725 IRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFN 784
            .||| .  ||  .||  .. |||| ..|         |  .| ||. .||   |||   |
Sbjct:  706 VRRNNLVGDALRELSIHSDIDLKKPLKVIFDG-----EEAVDAGGVTKEFFLLLLKELLN 760

Query:  785 PNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYF--LGRLLGKALYENMLVELPFASFFL 842
            |  | |    || |             |  | .|  .|   | |.| . .|.| |     
Sbjct:  761 PIYGMFTYYQDSNLL------WFSDTCFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALY 814

Query:  843 SKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEG-DVEE-LGLNFTVVNNDLGEAQVVEL 900
             |||     ..   |  | |   |.|  |  | | ||||   ||||.     |  .  .|
Sbjct:  815 KKLLNVKPGLE--DLKELSPTEGRSLQELLDYPGEDVEETFCLNFTICRESYGVIEQKKL 872

Query:  901 KPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQV 960
             ||| .. |   ||  ..    .|     .     ||  |   |   . | .|   ||. 
Sbjct:  873 IPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRA 932

Query:  961 LISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPP 1020
            .. | .     ..|..   | | |. ||| .. |||    |  |.|.| | |.|   | |
Sbjct:  933 MMVG-NSNYNWEELEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRIP 991

Query: 1021 LLGFKELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
            . |   |  |  | .  .  | || | || ||| ||..  . ..  .|  |...  ||
Sbjct:  992 IYGMASLQIV--IQSTASGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQALDNYEGF 1047

>hg18||uc001jng |10|NM_022079|Q5GLZ8|Q5GLZ8_HUMAN|HERC4|NM_022079|NP_071362|hect
        domain and RLD 4 isoform a

          Length = 1057

 Score =  156 bits (392), Expect = 2e-037
 Identities = 106/319 (33%), Positives = 156/319 (48%), Gaps = 11/319 (3%)

Query:  762 EAGIDGGGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGR 821
            |  .| ||. .||   ...   .|  | |.   || |           | |    . .| 
Sbjct:  745 EDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLF----HLIGV 800

Query:  822 LLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSY-EGDVEE 880
            . | |.|   .|.| |      |||     .|   |  | |.. |..  |  | | |.||
Sbjct:  801 ICGLAIYNCTIVDLHFPLALYKKLLKKKPSLD--DLKELMPDVGRSMQQLLDYPEDDIEE 858

Query:  881 -LGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQ 939
               ||||.   . |  .| ||   | |  |   ||  ..    ||  || .     ||  
Sbjct:  859 TFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHA 918

Query:  940 GLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVE 999
            |   |   . | .|   ||| .. | .      .|.| | | | |   || |. ||||  
Sbjct:  919 GFHKVCGGKVLLLFQPNELQAMVIG-NTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFH 977

Query: 1000 GFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFC 1059
                |.|.. | |.|   | |.|| | |  |  | . |   | || . || ||| ||.. 
Sbjct:  978 ELPLEKKKQFLLFLTGSDRIPILGMKSLKLV--IQSTGGGEEYLPVSHTCFNLLDLPKYT 1035

Query: 1060 DQNLMRNKLLYAIESSSGF 1078
            ..  .|.||. ||. . ||
Sbjct: 1036 EKETLRSKLIQAIDHNEGF 1054

>hg18||uc001jnh |10|NM_015601|Q8IXP9|Q8IXP9_HUMAN|HERC4|NM_015601|NP_056416|hect
        domain and RLD 4 isoform b

          Length = 1049

 Score =  156 bits (392), Expect = 2e-037
 Identities = 106/319 (33%), Positives = 156/319 (48%), Gaps = 11/319 (3%)

Query:  762 EAGIDGGGIFREFLNELLKSGFNPNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGR 821
            |  .| ||. .||   ...   .|  | |.   || |           | |    . .| 
Sbjct:  737 EDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLF----HLIGV 792

Query:  822 LLGKALYENMLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSY-EGDVEE 880
            . | |.|   .|.| |      |||     .|   |  | |.. |..  |  | | |.||
Sbjct:  793 ICGLAIYNCTIVDLHFPLALYKKLLKKKPSLD--DLKELMPDVGRSMQQLLDYPEDDIEE 850

Query:  881 -LGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQ 939
               ||||.   . |  .| ||   | |  |   ||  ..    ||  || .     ||  
Sbjct:  851 TFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHA 910

Query:  940 GLANVVNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVE 999
            |   |   . | .|   ||| .. | .      .|.| | | | |   || |. ||||  
Sbjct:  911 GFHKVCGGKVLLLFQPNELQAMVIG-NTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFH 969

Query: 1000 GFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFC 1059
                |.|.. | |.|   | |.|| | |  |  | . |   | || . || ||| ||.. 
Sbjct:  970 ELPLEKKKQFLLFLTGSDRIPILGMKSLKLV--IQSTGGGEEYLPVSHTCFNLLDLPKYT 1027

Query: 1060 DQNLMRNKLLYAIESSSGF 1078
            ..  .|.||. ||. . ||
Sbjct: 1028 EKETLRSKLIQAIDHNEGF 1046

>hg18||uc003upt |7|AL834242|Q8NDD8|Q8NDD8_HUMAN|SMURF1|NM_181349|NP_851994|Smad
        ubiquitination regulatory factor 1 isoform

          Length = 300

 Score =  150 bits (377), Expect = 1e-035
 Identities = 92/300 (30%), Positives = 158/300 (52%), Gaps = 12/300 (4%)

Query:  785 PNQGFFKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYENMLVELPFASFFLSK 844
            |  | |. . |..       .  .      ...|.||..| |..    .   |   |  .
Sbjct:    4 PYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQ 63

Query:  845 LLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFTVVNNDLGEAQVVELKPG 903
            |||    . .  | |.|||....|...   | |.   |   | | .|  |     |||| 
Sbjct:   64 LLG--KPIQLSDLESVDPELHKSLVWI--LENDITPVLDHTFCVEHNAFGRILQHELKPN 119

Query:  904 GKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLIS 963
            |...|||  |.  |. |  ..|  . |    || ..|   ..    |. |||.||...| 
Sbjct:  120 GRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIG 179

Query:  964 GAHVPICLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLG 1023
            |    | |.| |  |       |.. ... ||. || | .| . .||.|||  .| || |
Sbjct:  180 GLD-KIDLNDWKSNTRLKHCVADSN-IVRWFWQAVETFDEERRARLLQFVTGSTRVPLQG 237

Query: 1024 FKELY-----PVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSGF 1078
            || |       .| ||    . . || | || | . .| .     .  ||| |.| . ||
Sbjct:  238 FKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGF 297

>hg18||uc001xqb
        |14|NM_001039479|O15033|K0317_HUMAN|KIAA0317|NM_001039479|NP_001034568|
        hypothetical protein LOC9870

          Length = 823

 Score =  149 bits (376), Expect = 2e-035
 Identities = 135/436 (30%), Positives = 206/436 (47%), Gaps = 39/436 (8%)

Query:  664 LDVGLEPPQLSVSEERNLAILTELPFVVQ-------FEERVKIFQKLIYADKREVQGDGP 716
            .| |..||     .|||.   | .  . .       |...|  ||.    . |.|    |
Sbjct:  403 VDDGIQPPVELSCKERNILAATFIRSLHKNIGGSETFQDKVNFFQR----ELRQVHMKRP 458

Query:  717 FTDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLN 776
             .  . . . |. . | .       .  |  |   |        ||  .| ||  ||.  
Sbjct:  459 HSK-VTLKVSRHALLESSLKATRNFSISDWSKNFEVVF-----QDEEALDWGGPRREWFE 512

Query:  777 ELLKSGFN-PNQGF--FKATNDSLLYPNPAAEMLVGDSFTRHYYFLGRLLGKALYEN--- 830
             . |. |.  || |  |   | .|..|||     .     . | | |||.|| |||.   
Sbjct:  513 LICKALFDTTNQLFTRFSDNNQALVHPNPNRPAHLR---LKMYEFAGRLVGKCLYESSLG 569

Query:  831 ----MLVELPFASFFLSKLLGTSADVDIHHLASLDPEMYRNLLFLKSYEGDVEELGLNFT 886
                 ||   |   ||....|    .   .  . ||| |.. .       |. |. | | 
Sbjct:  570 GAYKQLVRARFTRSFLAQIIGLR--MHYKYFETDDPEFYKSKVCF-ILNNDMSEMELVFA 626

Query:  887 VVN-NDLGEA-QVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANV 944
                |  |.  .||||  ||   ||| ||.| |..|.| |||  |..     | .||  .
Sbjct:  627 EEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYLNLLAQYRLASQVKEEVEHFLKGLNEL 686

Query:  945 VNLEWLRMFDQQELQVLISGAHVPICLDDLKKFTNYSGG-YTDTHPVIQTFWEVVEGFSQ 1003
            |    | .||. ||..|. |    | . | |      || .     |.. || ||   .|
Sbjct:  687 VPENLLAIFDENELELLMCGTG-DISVSDFKAHAVVVGGSWHFREKVMRWFWTVVSSLTQ 745

Query: 1004 EEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNL 1063
            ||  .||.| |  |. |  ||  | | | |         |||| || | | || .     
Sbjct:  746 EELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPTH-STLPTAHTCFNQLCLPTYDSYEE 804

Query: 1064 MRNKLLYAI-ESSSGF 1078
            .   |  || |   ||
Sbjct:  805 VHRMLQLAISEGCEGF 820

>hg18||uc001khl |10|NM_182765|Q5U5R9|HECD2_HUMAN|HECTD2|NM_182765|NP_877497|HECT
        domain containing 2 isoform a

          Length = 776

 Score =  117 bits (292), Expect = 1e-025
 Identities = 78/228 (34%), Positives = 113/228 (49%), Gaps = 5/228 (2%)

Query:  851 DVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFTVVNNDLGEAQVVELKPGGKDIPV 909
            .| .  |  . ||.   |  | |.||.|||     | |   . |  .   |||||  | |
Sbjct:  549 NVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISV 608

Query:  910 TTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPI 969
            |  ||  |. |  |. ||| |     ||  |  .|     | .   .|...|. |.   .
Sbjct:  609 TNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGS-PDL 667

Query:  970 CLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYP 1029
             .  |.. | |  ||  |   |. ||.|| ||  . ..||| | |   | |. |  .|  
Sbjct:  668 DMHALQRSTQYD-GYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLN- 725

Query: 1030 VFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSG 1077
             | |         || | || | | || .  .  .. ||.  | .| |
Sbjct:  726 -FKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEG 772

>hg18||uc001khn |10|BC036487|NA|NA|HECTD2|NM_182765|NP_877497|HECT domain
        containing 2 isoform a

          Length = 426

 Score =  117 bits (292), Expect = 1e-025
 Identities = 78/228 (34%), Positives = 113/228 (49%), Gaps = 5/228 (2%)

Query:  851 DVDIHHLASLDPEMYRNLLFLKSYEGDVEE-LGLNFTVVNNDLGEAQVVELKPGGKDIPV 909
            .| .  |  . ||.   |  | |.||.|||     | |   . |  .   |||||  | |
Sbjct:  199 NVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISV 258

Query:  910 TTANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLISGAHVPI 969
            |  ||  |. |  |. ||| |     ||  |  .|     | .   .|...|. |.   .
Sbjct:  259 TNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGS-PDL 317

Query:  970 CLDDLKKFTNYSGGYTDTHPVIQTFWEVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYP 1029
             .  |.. | |  ||  |   |. ||.|| ||  . ..||| | |   | |. |  .|  
Sbjct:  318 DMHALQRSTQYD-GYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLN- 375

Query: 1030 VFCIHNGGNDLERLPTASTCMNLLKLPEFCDQNLMRNKLLYAIESSSG 1077
             | |         || | || | | || .  .  .. ||.  | .| |
Sbjct:  376 -FKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEG 422

>hg18||uc002vpw
        |2|NM_004238|Q14669|TRIPC_HUMAN|TRIP12|NM_004238|NP_004229|thyroid
        hormone receptor interactor 12

          Length = 1992

 Score =  108 bits (269), Expect = 5e-023
 Identities = 75/211 (35%), Positives = 106/211 (50%), Gaps = 12/211 (5%)

Query:  878 VEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAF 937
            ||.|||.||     |     .||| ||||||||  |   |. ||  . ||. .     .|
Sbjct: 1787 VEDLGLDFT-----LPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSF 1841

Query:  938 RQGLANVVNLEWLRMFDQQELQVLISGAHVPIC-LDDLKKFTNYSGGYTDTHPVIQTFWE 996
            | |  .|  |  |. |  .||  |. |.         | .      |||     ..  .|
Sbjct: 1842 RDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFE 1901

Query:  997 VVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCI-----HNGGNDLERLPTASTCMN 1051
            ..  |  |..|  |.|||   | |. ||. | |   |      .  |  . ||.  ||.|
Sbjct: 1902 ILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVN 1961

Query: 1052 LLKLPEFCDQNLMRNKLLYAI-ESSSGFELS 1081
             ||||..    .|| ||| |  |    | ||
Sbjct: 1962 YLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1992

>hg18||uc002vpx
        |2|BC114556|Q14CA3|Q14CA3_HUMAN|TRIP12|NM_004238|NP_004229|thyroid
        hormone receptor interactor 12

          Length = 2040

 Score =  108 bits (269), Expect = 5e-023
 Identities = 75/211 (35%), Positives = 106/211 (50%), Gaps = 12/211 (5%)

Query:  878 VEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAF 937
            ||.|||.||     |     .||| ||||||||  |   |. ||  . ||. .     .|
Sbjct: 1835 VEDLGLDFT-----LPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSF 1889

Query:  938 RQGLANVVNLEWLRMFDQQELQVLISGAHVPIC-LDDLKKFTNYSGGYTDTHPVIQTFWE 996
            | |  .|  |  |. |  .||  |. |.         | .      |||     ..  .|
Sbjct: 1890 RDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFE 1949

Query:  997 VVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCI-----HNGGNDLERLPTASTCMN 1051
            ..  |  |..|  |.|||   | |. ||. | |   |      .  |  . ||.  ||.|
Sbjct: 1950 ILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVN 2009

Query: 1052 LLKLPEFCDQNLMRNKLLYAI-ESSSGFELS 1081
             ||||..    .|| ||| |  |    | ||
Sbjct: 2010 YLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2040

>hg18||uc002vpy
        |2|BC113891|Q14CF1|Q14CF1_HUMAN|TRIP12|NM_004238|NP_004229|thyroid
        hormone receptor interactor 12

          Length = 1722

 Score =  108 bits (269), Expect = 5e-023
 Identities = 75/211 (35%), Positives = 106/211 (50%), Gaps = 12/211 (5%)

Query:  878 VEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLAF 937
            ||.|||.||     |     .||| ||||||||  |   |. ||  . ||. .     .|
Sbjct: 1517 VEDLGLDFT-----LPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSF 1571

Query:  938 RQGLANVVNLEWLRMFDQQELQVLISGAHVPIC-LDDLKKFTNYSGGYTDTHPVIQTFWE 996
            | |  .|  |  |. |  .||  |. |.         | .      |||     ..  .|
Sbjct: 1572 RDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFE 1631

Query:  997 VVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCI-----HNGGNDLERLPTASTCMN 1051
            ..  |  |..|  |.|||   | |. ||. | |   |      .  |  . ||.  ||.|
Sbjct: 1632 ILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVN 1691

Query: 1052 LLKLPEFCDQNLMRNKLLYAI-ESSSGFELS 1081
             ||||..    .|| ||| |  |    | ||
Sbjct: 1692 YLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1722

>hg18||uc001wra |14|AK125788|Q2KQ74|Q2KQ74_HUMAN|HECTD1|NM_015382|NP_056197|HECT
        domain containing 1

          Length = 736

 Score =  104 bits (259), Expect = 7e-022
 Identities = 66/206 (32%), Positives = 106/206 (51%), Gaps = 4/206 (1%)

Query:  878 VEELGLNFTVV-NNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLA 936
            .|.|||||    .. .     |.||| |.|  .|  |   |. |. |. ..  |.    |
Sbjct:  531 IEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQKQMEA 590

Query:  937 FRQGLANVVNLEWLRMFDQQELQVLISGAHVPI-CLDDLKKFTNYSGGYTDTHPVIQTFW 995
            || |   |  .| |  |  .|.|... |   |    .|.  .|    |||   |    | 
Sbjct:  591 FRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGFLRFV 650

Query:  996 EVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLE-RLPTASTCMNLLK 1054
             |. | | .|..  |.| | ||  |  |   |.|   .    .  .   |. .||.. ||
Sbjct:  651 RVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLK 710

Query: 1055 LPEFCDQNLMRNKLLYAIESSSGFEL 1080
            |||.  . .|| .|| |     || |
Sbjct:  711 LPEYSSEEIMRERLL-AATMEKGFHL 735

>hg18||uc001wrb |14|AY739714|NA|NA|KIAA1131|NA|NA|Homo sapiens mRNA for KIAA1131
        protein, partial cds

          Length = 736

 Score =  104 bits (259), Expect = 7e-022
 Identities = 66/206 (32%), Positives = 106/206 (51%), Gaps = 4/206 (1%)

Query:  878 VEELGLNFTVV-NNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLA 936
            .|.|||||    .. .     |.||| |.|  .|  |   |. |. |. ..  |.    |
Sbjct:  531 IEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQKQMEA 590

Query:  937 FRQGLANVVNLEWLRMFDQQELQVLISGAHVPI-CLDDLKKFTNYSGGYTDTHPVIQTFW 995
            || |   |  .| |  |  .|.|... |   |    .|.  .|    |||   |    | 
Sbjct:  591 FRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGFLRFV 650

Query:  996 EVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLE-RLPTASTCMNLLK 1054
             |. | | .|..  |.| | ||  |  |   |.|   .    .  .   |. .||.. ||
Sbjct:  651 RVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLK 710

Query: 1055 LPEFCDQNLMRNKLLYAIESSSGFEL 1080
            |||.  . .|| .|| |     || |
Sbjct:  711 LPEYSSEEIMRERLL-AATMEKGFHL 735

>hg18||uc001wrc |14|NM_015382|Q9ULT8|HECD1_HUMAN|HECTD1|NM_015382|NP_056197|HECT
        domain containing 1

          Length = 2610

 Score =  104 bits (259), Expect = 7e-022
 Identities = 66/206 (32%), Positives = 106/206 (51%), Gaps = 4/206 (1%)

Query:  878 VEELGLNFTVV-NNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRPHCLA 936
            .|.|||||    .. .     |.||| |.|  .|  |   |. |. |. ..  |.    |
Sbjct: 2405 IEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQKQMEA 2464

Query:  937 FRQGLANVVNLEWLRMFDQQELQVLISGAHVPI-CLDDLKKFTNYSGGYTDTHPVIQTFW 995
            || |   |  .| |  |  .|.|... |   |    .|.  .|    |||   |    | 
Sbjct: 2465 FRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGFLRFV 2524

Query:  996 EVVEGFSQEEKRKLLKFVTSCSRPPLLGFKELYPVFCIHNGGNDLE-RLPTASTCMNLLK 1054
             |. | | .|..  |.| | ||  |  |   |.|   .    .  .   |. .||.. ||
Sbjct: 2525 RVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLK 2584

Query: 1055 LPEFCDQNLMRNKLLYAIESSSGFEL 1080
            |||.  . .|| .|| |     || |
Sbjct: 2585 LPEYSSEEIMRERLL-AATMEKGFHL 2609

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,198,093
Number of Sequences: 45480
Number of Extensions: 193198093
Number of Successful Extensions: 11050774
Number of sequences better than 0.0: 0
BLASTP 7.6.0