BLASTP 7.6.0


Query=fugu4_738891 |jgi|Takru4|738891|fgh5_pg.C_scaffold_255000003
        (907 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003sjf |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|...    337   4e-092
hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|N...    337   4e-092
hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRN...    337   4e-092
hg18||uc003sjk |7|BX648893|NA|NA|KIAA0810|NA|NA|Homo sapiens mRN...    337   4e-092
hg18||uc003sjf |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|...    332   2e-090
hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|N...    332   2e-090
hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRN...    332   2e-090
hg18||uc003sjk |7|BX648893|NA|NA|KIAA0810|NA|NA|Homo sapiens mRN...    332   2e-090
hg18||uc003awh |22|BX537962|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|...    282   1e-075
hg18||uc003awi |22|NM_015374|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374...    282   1e-075
hg18||uc003tof |7|NM_152782|Q8TAQ9|Q8TAQ9_HUMAN|SUNC1|NM_152782|...    179   2e-044
hg18||uc003tog |7|NM_001030019|Q8TAQ9|Q8TAQ9_HUMAN|SUNC1|NM_0010...    179   2e-044
hg18||uc002wyi |20|NM_080675|Q8TC36|SPA4L_HUMAN|SPAG4L|NM_080675...    153   2e-036
hg18||uc002xdb |20|NM_003116|Q9NPE6|SPAG4_HUMAN|SPAG4|NM_003116|...    140   1e-032
hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRN...     53   1e-006
hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|N...     52   2e-006
hg18||uc003awh |22|BX537962|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|...     44   7e-004
hg18||uc003awi |22|NM_015374|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374...     44   7e-004
hg18||uc003sjf |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|...     42   0.003
hg18||uc003cxe |3|NM_003458|Q9UPA5|BSN_HUMAN|BSN|NM_003458|NP_00...     38   0.047
hg18||uc003uyu |7|NM_181500|Q13948|CASP_HUMAN|CUTL1|NM_181500|NP...     35   0.307
hg18||uc003uys |7|BC066592|P39880-3|P39880-3|CUTL1|NM_181552|NP_...     34   0.683
hg18||uc003uyt |7|NM_001913|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP...     34   0.683
hg18||uc003uyv |7|AK125097|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_...     34   0.683
hg18||uc003uyw |7|AK122726|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_...     34   0.683
hg18||uc003uyx |7|NM_181552|P39880|CUTL1_HUMAN|CUTL1|NM_181552|N...     34   0.683
hg18||uc001rta |12|AF010404|O14686-2|O14686-2|MLL2|NM_003482|NP_...     33   1.521
hg18||uc001rtb |12|NM_003482|NA|NA|MLL2|NM_003482|NP_003473|myel...     33   1.521
hg18||uc004bef |9|NM_053016|Q8IXS6-2|Q8IXS6-2|PALM2|NM_053016|NP...     33   1.987
hg18||uc004beg |9|NM_001037293|Q8IXS6|PALM2_HUMAN|PALM2|NM_00103...     33   1.987
hg18||uc004beh |9|AJ312216|Q8IXS6-2|Q8IXS6-2|PALM2|NM_053016|NP_...     33   1.987
hg18||uc004bei |9|AJ312217|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_14...     33   1.987
hg18||uc004bej |9|NM_007203|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_0...     33   1.987
hg18||uc004bek |9|NM_147150|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_1...     33   1.987
hg18||uc002ivx |17|NM_004758|O95153|RIMB1_HUMAN|BZRAP1|NM_004758...     32   2.595
hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1...     32   4.427
hg18||uc002fze |17|NM_170663|Q8N4C8-3|Q8N4C8-3|MINK1|NM_170663|N...     30   9.861
hg18||uc002fzf |17|NM_153827|Q8N4C8|MINK1_HUMAN|MINK1|NM_153827|...     30   9.861
hg18||uc002fzg |17|NM_001024937|Q5U8Z0|Q5U8Z0_HUMAN|MINK1|NM_001...     30   9.861
hg18||uc002fzh |17|NM_015716|Q8N4C8-2|Q8N4C8-2|MINK1|NM_015716|N...     30   9.861

>hg18||uc003sjf
        |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 702

 Score =  337 bits (864), Expect = 4e-092
 Identities = 169/283 (59%), Positives = 213/283 (75%), Gaps = 13/283 (4%)

Query: 614 ISAQVSAQVRKELQTLFFGSSGTGELPESLLHWLSQRYVSTPDLQASLASLEMAILRNVS 673
           .  .|  |||. .. ||      | | | ||   | ..||  |||  |  |.. |||||.
Sbjct: 422 VQERVDVQVREMVKLLFSEDQQGGSL-EQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVT 480

Query: 674 LQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLYSQDRTG 733
             .         .   |  |    ||   .  | | |.||   . .| .||.|||||.||
Sbjct: 481 HHV---------SVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLYSQDKTG 529

Query: 734 LVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFK 793
           .||.|||||||||||||||||||||||||||||.||||||||||||||||.|||||||||
Sbjct: 530 MVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFK 589

Query: 794 GSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEGKLLGQY 853
           |||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||.||||.
Sbjct: 590 GSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQF 649

Query: 854 TYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLY 895
           ||  |||.||||  ... .| .||..|.|. ||||||.|||||
Sbjct: 650 TYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLY 692

>hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 690

 Score =  337 bits (864), Expect = 4e-092
 Identities = 169/283 (59%), Positives = 213/283 (75%), Gaps = 13/283 (4%)

Query: 614 ISAQVSAQVRKELQTLFFGSSGTGELPESLLHWLSQRYVSTPDLQASLASLEMAILRNVS 673
           .  .|  |||. .. ||      | | | ||   | ..||  |||  |  |.. |||||.
Sbjct: 410 VQERVDVQVREMVKLLFSEDQQGGSL-EQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVT 468

Query: 674 LQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLYSQDRTG 733
             .         .   |  |    ||   .  | | |.||   . .| .||.|||||.||
Sbjct: 469 HHV---------SVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLYSQDKTG 517

Query: 734 LVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFK 793
           .||.|||||||||||||||||||||||||||||.||||||||||||||||.|||||||||
Sbjct: 518 MVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFK 577

Query: 794 GSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEGKLLGQY 853
           |||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||.||||.
Sbjct: 578 GSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQF 637

Query: 854 TYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLY 895
           ||  |||.||||  ... .| .||..|.|. ||||||.|||||
Sbjct: 638 TYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLY 680

>hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRNA for KIAA0810
        protein, partial cds

          Length = 623

 Score =  337 bits (864), Expect = 4e-092
 Identities = 169/283 (59%), Positives = 213/283 (75%), Gaps = 13/283 (4%)

Query: 614 ISAQVSAQVRKELQTLFFGSSGTGELPESLLHWLSQRYVSTPDLQASLASLEMAILRNVS 673
           .  .|  |||. .. ||      | | | ||   | ..||  |||  |  |.. |||||.
Sbjct: 343 VQERVDVQVREMVKLLFSEDQQGGSL-EQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVT 401

Query: 674 LQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLYSQDRTG 733
             .         .   |  |    ||   .  | | |.||   . .| .||.|||||.||
Sbjct: 402 HHV---------SVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLYSQDKTG 450

Query: 734 LVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFK 793
           .||.|||||||||||||||||||||||||||||.||||||||||||||||.|||||||||
Sbjct: 451 MVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFK 510

Query: 794 GSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEGKLLGQY 853
           |||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||.||||.
Sbjct: 511 GSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQF 570

Query: 854 TYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLY 895
           ||  |||.||||  ... .| .||..|.|. ||||||.|||||
Sbjct: 571 TYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLY 613

>hg18||uc003sjk |7|BX648893|NA|NA|KIAA0810|NA|NA|Homo sapiens mRNA for KIAA0810
        protein, partial cds

          Length = 424

 Score =  337 bits (864), Expect = 4e-092
 Identities = 169/283 (59%), Positives = 213/283 (75%), Gaps = 13/283 (4%)

Query: 614 ISAQVSAQVRKELQTLFFGSSGTGELPESLLHWLSQRYVSTPDLQASLASLEMAILRNVS 673
           .  .|  |||. .. ||      | | | ||   | ..||  |||  |  |.. |||||.
Sbjct: 144 VQERVDVQVREMVKLLFSEDQQGGSL-EQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVT 202

Query: 674 LQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLYSQDRTG 733
             .         .   |  |    ||   .  | | |.||   . .| .||.|||||.||
Sbjct: 203 HHV---------SVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLYSQDKTG 251

Query: 734 LVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFK 793
           .||.|||||||||||||||||||||||||||||.||||||||||||||||.|||||||||
Sbjct: 252 MVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFK 311

Query: 794 GSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEGKLLGQY 853
           |||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||.||||.
Sbjct: 312 GSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQF 371

Query: 854 TYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLY 895
           ||  |||.||||  ... .| .||..|.|. ||||||.|||||
Sbjct: 372 TYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLY 414

>hg18||uc003sjf
        |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 702

 Score =  332 bits (849), Expect = 2e-090
 Identities = 158/237 (66%), Positives = 197/237 (83%), Gaps = 4/237 (1%)

Query: 668 ILRNVSLQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLY 727
           .||.. ||. .|  |   .   |  |    ||   .  | | |.||   . .| .||.||
Sbjct: 467 MLRDLQLQILRN-VTHHVSVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLY 523

Query: 728 SQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPG 787
           |||.||.||.|||||||||||||||||||||||||||||.||||||||||||||||.|||
Sbjct: 524 SQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPG 583

Query: 788 NCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEG 847
           |||||||||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||
Sbjct: 584 NCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEG 643

Query: 848 KLLGQYTYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLYRFRVHGDP 903
           .||||.||  |||.||||  ... .| .||..|.|. ||||||.|||||||||||.|
Sbjct: 644 QLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEP 700

>hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 690

 Score =  332 bits (849), Expect = 2e-090
 Identities = 158/237 (66%), Positives = 197/237 (83%), Gaps = 4/237 (1%)

Query: 668 ILRNVSLQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLY 727
           .||.. ||. .|  |   .   |  |    ||   .  | | |.||   . .| .||.||
Sbjct: 455 MLRDLQLQILRN-VTHHVSVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLY 511

Query: 728 SQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPG 787
           |||.||.||.|||||||||||||||||||||||||||||.||||||||||||||||.|||
Sbjct: 512 SQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPG 571

Query: 788 NCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEG 847
           |||||||||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||
Sbjct: 572 NCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEG 631

Query: 848 KLLGQYTYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLYRFRVHGDP 903
           .||||.||  |||.||||  ... .| .||..|.|. ||||||.|||||||||||.|
Sbjct: 632 QLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEP 688

>hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRNA for KIAA0810
        protein, partial cds

          Length = 623

 Score =  332 bits (849), Expect = 2e-090
 Identities = 158/237 (66%), Positives = 197/237 (83%), Gaps = 4/237 (1%)

Query: 668 ILRNVSLQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLY 727
           .||.. ||. .|  |   .   |  |    ||   .  | | |.||   . .| .||.||
Sbjct: 388 MLRDLQLQILRN-VTHHVSVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLY 444

Query: 728 SQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPG 787
           |||.||.||.|||||||||||||||||||||||||||||.||||||||||||||||.|||
Sbjct: 445 SQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPG 504

Query: 788 NCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEG 847
           |||||||||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||
Sbjct: 505 NCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEG 564

Query: 848 KLLGQYTYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLYRFRVHGDP 903
           .||||.||  |||.||||  ... .| .||..|.|. ||||||.|||||||||||.|
Sbjct: 565 QLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEP 621

>hg18||uc003sjk |7|BX648893|NA|NA|KIAA0810|NA|NA|Homo sapiens mRNA for KIAA0810
        protein, partial cds

          Length = 424

 Score =  332 bits (849), Expect = 2e-090
 Identities = 158/237 (66%), Positives = 197/237 (83%), Gaps = 4/237 (1%)

Query: 668 ILRNVSLQLEQNRATTLGAAESQAKTIFHTVSGAVQHTAAAEGLTEEHVKIMVQNALRLY 727
           .||.. ||. .|  |   .   |  |    ||   .  | | |.||   . .| .||.||
Sbjct: 189 MLRDLQLQILRN-VTHHVSVTKQLPTSEAVVSAVSE--AGASGITEAQARAIVNSALKLY 245

Query: 728 SQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPG 787
           |||.||.||.|||||||||||||||||||||||||||||.||||||||||||||||.|||
Sbjct: 246 SQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPG 305

Query: 788 NCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEG 847
           |||||||||||||.|||. | | .| ||||||||||||||.|||.|| |.||..||||||
Sbjct: 306 NCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEG 365

Query: 848 KLLGQYTYQDDGEALQMFPVMEQ-NDKSFQVIEVRVLSNWGHPDYTCLYRFRVHGDP 903
           .||||.||  |||.||||  ... .| .||..|.|. ||||||.|||||||||||.|
Sbjct: 366 QLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEP 422

>hg18||uc003awh
        |22|BX537962|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|NP_056189|unc-84
        homolog B

          Length = 717

 Score =  282 bits (721), Expect = 1e-075
 Identities = 123/194 (63%), Positives = 159/194 (81%)

Query: 710 GLTEEHVKIMVQNALRLYSQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPL 769
           |.||| |  .|. ||. ||.|| || |||||||| |..||||||||||||||.||||.||
Sbjct: 522 GVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPL 581

Query: 770 WYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITS 829
           || ||||||..||||.|||||||.| ||. |.||| .| ||.  |||.|| |||   |.|
Sbjct: 582 WYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISS 641

Query: 830 APRDFTVFGLDDEYQEEGKLLGQYTYQDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHP 889
           ||.|| .|| |.. |.|| |||..||  ||| .| |        ..||.|.|.|.|||||
Sbjct: 642 APKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHP 701

Query: 890 DYTCLYRFRVHGDP 903
           .|||.|||||||.|
Sbjct: 702 EYTCIYRFRVHGEP 715

>hg18||uc003awi
        |22|NM_015374|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|NP_056189|unc-84
        homolog B

          Length = 717

 Score =  282 bits (721), Expect = 1e-075
 Identities = 123/194 (63%), Positives = 159/194 (81%)

Query: 710 GLTEEHVKIMVQNALRLYSQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPL 769
           |.||| |  .|. ||. ||.|| || |||||||| |..||||||||||||||.||||.||
Sbjct: 522 GVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPL 581

Query: 770 WYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITS 829
           || ||||||..||||.|||||||.| ||. |.||| .| ||.  |||.|| |||   |.|
Sbjct: 582 WYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISS 641

Query: 830 APRDFTVFGLDDEYQEEGKLLGQYTYQDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHP 889
           ||.|| .|| |.. |.|| |||..||  ||| .| |        ..||.|.|.|.|||||
Sbjct: 642 APKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHP 701

Query: 890 DYTCLYRFRVHGDP 903
           .|||.|||||||.|
Sbjct: 702 EYTCIYRFRVHGEP 715

>hg18||uc003tof |7|NM_152782|Q8TAQ9|Q8TAQ9_HUMAN|SUNC1|NM_152782|NP_689995|Sad1
        and UNC84 domain containing 1

          Length = 357

 Score =  179 bits (453), Expect = 2e-044
 Identities = 80/190 (42%), Positives = 120/190 (63%)

Query: 714 EHVKIMVQNALRLYSQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFS 773
           | |  .|   |.   .|.  . ||||.| | ||.    ||.|.   | .   |.      
Sbjct: 164 EEVSNLVNYVLKKLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHE 223

Query: 774 QSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRD 833
             | ...||||||| |||| ||||. .|.|. ||.||.  .||| . .||.|||.|||..
Sbjct: 224 MPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKE 283

Query: 834 FTVFGLDDEYQEEGKLLGQYTYQDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHPDYTC 893
           |.|.|.  . . |   |||. |   |  .| | .     .    ... . |||||| |||
Sbjct: 284 FSVYGITKKCEGEEIFLGQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTC 343

Query: 894 LYRFRVHGDP 903
           |||||||| |
Sbjct: 344 LYRFRVHGTP 353

>hg18||uc003tog
        |7|NM_001030019|Q8TAQ9|Q8TAQ9_HUMAN|SUNC1|NM_001030019|NP_001025190|Sad
        1 and UNC84 domain containing 1

          Length = 357

 Score =  179 bits (453), Expect = 2e-044
 Identities = 80/190 (42%), Positives = 120/190 (63%)

Query: 714 EHVKIMVQNALRLYSQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFS 773
           | |  .|   |.   .|.  . ||||.| | ||.    ||.|.   | .   |.      
Sbjct: 164 EEVSNLVNYVLKKLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHE 223

Query: 774 QSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRD 833
             | ...||||||| |||| ||||. .|.|. ||.||.  .||| . .||.|||.|||..
Sbjct: 224 MPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKE 283

Query: 834 FTVFGLDDEYQEEGKLLGQYTYQDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHPDYTC 893
           |.|.|.  . . |   |||. |   |  .| | .     .    ... . |||||| |||
Sbjct: 284 FSVYGITKKCEGEEIFLGQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTC 343

Query: 894 LYRFRVHGDP 903
           |||||||| |
Sbjct: 344 LYRFRVHGTP 353

>hg18||uc002wyi
        |20|NM_080675|Q8TC36|SPA4L_HUMAN|SPAG4L|NM_080675|NP_542406|sperm
        associated antigen 4-like

          Length = 379

 Score =  153 bits (384), Expect = 2e-036
 Identities = 72/183 (39%), Positives = 118/183 (64%), Gaps = 2/183 (1%)

Query: 719 MVQNALRLYSQDRTGLVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRV 778
           | |  ...   |     |.||.| | ||     | ||  . |      . || ..| | |
Sbjct: 181 MAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSVTYNHEKAHSYWNWIQLWNYAQPPDV 240

Query: 779 VIQPDVYPGNCWAFKGSQGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFG 838
           ...|.| |||||||.| .| . |.|. |.  ..  |.|||||.| .|.. .||.|| ..|
Sbjct: 241 ILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYG 300

Query: 839 LDDEYQEEGKLLGQYTYQDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHPDYTCLYRFR 898
           ..   .||   || . .| .   .||||.  |  ..|  ..|.. ||||.| .||||| |
Sbjct: 301 MEGSPKEE-VFLGAFQFQPE-NIIQMFPLQNQPARAFSAVKVKISSNWGNPGFTCLYRVR 358

Query: 899 VHG 901
           |||
Sbjct: 359 VHG 361

>hg18||uc002xdb |20|NM_003116|Q9NPE6|SPAG4_HUMAN|SPAG4|NM_003116|NP_003107|sperm
        associated antigen 4

          Length = 437

 Score =  140 bits (351), Expect = 1e-032
 Identities = 66/166 (39%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query: 736 DYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGS 795
           |||| | | ||   . |  |  .           | ... | |...| |.|||||||.| 
Sbjct: 258 DYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGD 317

Query: 796 QGYLVIRLSLKIVPTSFCLEHIPKTLSPTGNITSAPRDFTVFGLDDEYQEEGKLLGQYTY 855
           || .||.|  ..  .   |.| | ..  ||   |||||| ||||   | |    ||..|.
Sbjct: 318 QGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFGL-QVYDETEVSLGKFTF 376

Query: 856 QDDGEALQMFPVMEQNDKSFQVIEVRVLSNWGHPDYTCLYRFRVHG 901
             .   .| | .      .|  .....||||||| .||||| | ||
Sbjct: 377 DVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRAHG 422

>hg18||uc003sji |7|AK025737|NA|NA|KIAA0810|NA|NA|Homo sapiens mRNA for KIAA0810
        protein, partial cds

          Length = 623

 Score =  53 bits (126), Expect = 1e-006
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 292 GHCVVRSGKVLGCGAVTAFQSLLSLLWMFLTAPVKAVRRLLWFLATGWYQLVSLMSVFNV 351
           |. ...  . .|       ..  | ||. . || ||   . |.|  |||| |.|.|  ||
Sbjct:  58 GYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNV 117

Query: 352 FFLTQC 357
           | ||.|
Sbjct: 118 FLLTRC 123

>hg18||uc003sjg |7|BX649069|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 690

 Score =  52 bits (124), Expect = 2e-006
 Identities = 22/43 (51%), Positives = 29/43 (67%)

Query: 315 SLLWMFLTAPVKAVRRLLWFLATGWYQLVSLMSVFNVFFLTQC 357
           | ||. . || ||   . |.|  |||| |.|.|  ||| ||.|
Sbjct: 148 SALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRC 190

>hg18||uc003awh
        |22|BX537962|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|NP_056189|unc-84
        homolog B

          Length = 717

 Score =  44 bits (103), Expect = 7e-004
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 315 SLLWMFLTAPVKAVRRLLWFLATGWYQLVSLMSVFNVFFLTQ 356
           |||||  |.| .  | | |.  | ||.| .  |. .|| ||.
Sbjct: 164 SLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDVFVLTR 205

>hg18||uc003awi
        |22|NM_015374|Q9UH99|UN84B_HUMAN|UNC84B|NM_015374|NP_056189|unc-84
        homolog B

          Length = 717

 Score =  44 bits (103), Expect = 7e-004
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 315 SLLWMFLTAPVKAVRRLLWFLATGWYQLVSLMSVFNVFFLTQ 356
           |||||  |.| .  | | |.  | ||.| .  |. .|| ||.
Sbjct: 164 SLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDVFVLTR 205

>hg18||uc003sjf
        |7|NM_025154|O94901|UN84A_HUMAN|UNC84A|NM_025154|NP_079430|unc-84
        homolog A

          Length = 702

 Score =  42 bits (97), Expect = 0.003
 Identities = 17/32 (53%), Positives = 22/32 (68%)

Query: 326 KAVRRLLWFLATGWYQLVSLMSVFNVFFLTQC 357
           ||   . |.|  |||| |.|.|  ||| ||.|
Sbjct: 171 KAASGVFWWLGIGWYQFVTLISWLNVFLLTRC 202

>hg18||uc003cxe |3|NM_003458|Q9UPA5|BSN_HUMAN|BSN|NM_003458|NP_003449|bassoon
        protein

          Length = 3926

 Score =  38 bits (87), Expect = 0.047
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 3/123 (2%)

Query:  445 GADLERLERVERQLALLWEQLQ-QRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWV 503
            | . |   . |||     . || .|.  . |.   .       .|..  |  ||   | |
Sbjct: 2353 GFEKEEASQEERQRKQQEQLLQLERERVELEKLRQLRLQEELERERVELQRHREEEQLLV 2412

Query:  504 SSLLDQRVGVLHGELEQEQ-TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQ 562
               | .   . |  |.|.|  |. |   |.|.| | |  .| .|. |   |  . .| .|
Sbjct: 2413 QRELQELQTIKHHVLQQQQEERQAQFALQREQLAQ-QRLQLEQIQQLQQQLQQQLEEQKQ 2471

Query:  563 RQK 565
            |||
Sbjct: 2472 RQK 2474

>hg18||uc003uyu |7|NM_181500|Q13948|CASP_HUMAN|CUTL1|NM_181500|NP_852477|CCAAT
        displacement protein isoform c

          Length = 676

 Score =  35 bits (80), Expect = 0.307
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 4/111 (3%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|    |. |               .| . || 
Sbjct: 248 ERANQRAEVAQREAETLREQLSSANHSLQ----LASQIQKAPDVAIEVLTRSSLEVELAA 303

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 304 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 354

>hg18||uc003uys |7|BC066592|P39880-3|P39880-3|CUTL1|NM_181552|NP_853530|CCAAT
        displacement protein isoform a

          Length = 1516

 Score =  34 bits (77), Expect = 0.683
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|   ..  |               .| . || 
Sbjct: 248 ERANQRAEVAQREAETLREQLSSANHSLQLASQI--QKAPDVEQAIEVLTRSSLEVELAA 305

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 306 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 356

>hg18||uc003uyt |7|NM_001913|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 678

 Score =  34 bits (77), Expect = 0.683
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|   ..  |               .| . || 
Sbjct: 248 ERANQRAEVAQREAETLREQLSSANHSLQLASQI--QKAPDVEQAIEVLTRSSLEVELAA 305

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 306 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 356

>hg18||uc003uyv |7|AK125097|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 662

 Score =  34 bits (77), Expect = 0.683
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|   ..  |               .| . || 
Sbjct: 232 ERANQRAEVAQREAETLREQLSSANHSLQLASQI--QKAPDVEQAIEVLTRSSLEVELAA 289

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 290 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 340

>hg18||uc003uyw |7|AK122726|Q13948|CASP_HUMAN|CUTL1|NM_001913|NP_001904|CCAAT
        displacement protein isoform b

          Length = 632

 Score =  34 bits (77), Expect = 0.683
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|   ..  |               .| . || 
Sbjct: 202 ERANQRAEVAQREAETLREQLSSANHSLQLASQI--QKAPDVEQAIEVLTRSSLEVELAA 259

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 260 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 310

>hg18||uc003uyx |7|NM_181552|P39880|CUTL1_HUMAN|CUTL1|NM_181552|NP_853530|CCAAT
        displacement protein isoform a

          Length = 1505

 Score =  34 bits (77), Expect = 0.683
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 533 ERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQXXXXXXXXXXXXXXXTLPLSLAV 592
           ||  |       | | |   |..    .|   ..  |               .| . || 
Sbjct: 237 ERANQRAEVAQREAETLREQLSSANHSLQLASQI--QKAPDVEQAIEVLTRSSLEVELAA 294

Query: 593 KQEDHDALLVEVQRLEAELIKISAQVSAQVRKELQTLFFGSSGTGELPESL 643
           |. .   |. .||||.| | |.    ..|. .  | |   .|   .| | |
Sbjct: 295 KEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKL 345

>hg18||uc001rta
        |12|AF010404|O14686-2|O14686-2|MLL2|NM_003482|NP_003473|myeloid/lymphoi
        d or mixed-lineage leukemia 2

          Length = 4957

 Score =  33 bits (74), Expect = 1.521
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query:  443 LTGADLERLERVERQLALLWEQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLW 502
            |.   .  |.....|     .||||.   | ..   .       ..||  |  .. |   
Sbjct: 3309 LSAQPMGSLQQLQQQ-----QQLQQQQQLQQQQQQQLQQQQQLQQQQLQQQQQQQQLQQQ 3363

Query:  503 VSSLLDQRVGVLHGELEQEQTRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEV 560
                | |.      .|.|.| .. |  .||.  || |   | .   |||    . |.|
Sbjct: 3364 QQQQLQQQ----QQQLQQQQQQQQQQFQQQQ--QQQQMGLLNQSRTLLSPQQQQQQQV 3415

>hg18||uc001rtb |12|NM_003482|NA|NA|MLL2|NM_003482|NP_003473|myeloid/lymphoid or
        mixed-lineage leukemia 2

          Length = 5262

 Score =  33 bits (74), Expect = 1.521
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query:  443 LTGADLERLERVERQLALLWEQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLW 502
            |.   .  |.....|     .||||.   | ..   .       ..||  |  .. |   
Sbjct: 3614 LSAQPMGSLQQLQQQ-----QQLQQQQQLQQQQQQQLQQQQQLQQQQLQQQQQQQQLQQQ 3668

Query:  503 VSSLLDQRVGVLHGELEQEQTRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEV 560
                | |.      .|.|.| .. |  .||.  || |   | .   |||    . |.|
Sbjct: 3669 QQQQLQQQ----QQQLQQQQQQQQQQFQQQQ--QQQQMGLLNQSRTLLSPQQQQQQQV 3720

>hg18||uc004bef
        |9|NM_053016|Q8IXS6-2|Q8IXS6-2|PALM2|NM_053016|NP_443749|paralemmin 2
        isoform a

          Length = 413

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:  11 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 66

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  67 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 109

>hg18||uc004beg
        |9|NM_001037293|Q8IXS6|PALM2_HUMAN|PALM2|NM_001037293|NP_001032370|para
        lemmin 2 isoform b

          Length = 379

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:  11 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 66

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  67 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 109

>hg18||uc004beh
        |9|AJ312216|Q8IXS6-2|Q8IXS6-2|PALM2|NM_053016|NP_443749|paralemmin 2
        isoform a

          Length = 411

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:   9 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 64

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  65 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 107

>hg18||uc004bei
        |9|AJ312217|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_147150|NP_671492|PALM2-A
        KAP2 protein isoform 2

          Length = 1230

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:   9 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 64

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  65 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 107

>hg18||uc004bej
        |9|NM_007203|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_007203|NP_009134|PALM2-
        AKAP2 protein isoform 1

          Length = 1103

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:   9 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 64

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  65 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 107

>hg18||uc004bek
        |9|NM_147150|Q5T721|Q5T721_HUMAN|PALM2-AKAP2|NM_147150|NP_671492|PALM2-
        AKAP2 protein isoform 2

          Length = 1090

 Score =  33 bits (73), Expect = 1.987
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 463 EQLQQRDHKQDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQ 522
           |.||    |. .|   | |    | ||.      .|  |    ||    |.  |  |.|.
Sbjct:   9 ERLQAIAEKR-KRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQ---GIPAGTAEEEE 64

Query: 523 TRRVQSEEQQERLQQGQATRLAEIELLLSTLAARTQEVQQRQKL 566
            || |||| . |..| .   .  .|  . || .   ..  ....
Sbjct:  65 ARRRQSEEDEFRVKQLE-DNIQRLEQEIQTLESEESQISAKEQI 107

>hg18||uc002ivx
        |17|NM_004758|O95153|RIMB1_HUMAN|BZRAP1|NM_004758|NP_004749|peripheral
        benzodiazepine receptor-associated

          Length = 1857

 Score =  32 bits (72), Expect = 2.595
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 13/111 (11%)

Query: 466 QQRDHKQDERHGNILGLY----NTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQE 521
           .| . .  |  | .||.     . |..    |.  |||   .  . .        |.| |
Sbjct: 397 EQVEWENAELRGQLLGVTQERDSALRKSQGLQSKLESLEQVLKHMREVAQRRQQLEVEHE 456

Query: 522 QTRRVQSEEQQE--RLQQGQATRLAE----IELLLSTL---AARTQEVQQR 563
           | |    |.|.|  |||| ||    |    ..|| |||    || .|....
Sbjct: 457 QARLSLREKQEEVRRLQQAQAEAQREHEGAVQLLESTLDSMQARVRELEEQ 507

>hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1000 protein
        (Fragment)

          Length = 1946

 Score =  32 bits (70), Expect = 4.427
 Identities = 19/77 (24%), Positives = 39/77 (50%)

Query:  488 EQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQTRRVQSEEQQERLQQGQATRLAEIE 547
            . || . .. |     .  |.|.|  | | ||||.  |.  | .  .|.         .|
Sbjct: 1020 DDLHMEEEKLSSLSKANLKLEQQVDELEGALEQERKARMNCERELHKLEGNLKLNRESME 1079

Query:  548 LLLSTLAARTQEVQQRQ 564
             | |.     .|.....
Sbjct: 1080 NLESSQRHLAEELRKKE 1096

>hg18||uc002fze
        |17|NM_170663|Q8N4C8-3|Q8N4C8-3|MINK1|NM_170663|NP_733763|misshapen/NIK
        -related kinase isoform 2

          Length = 1303

 Score =  30 bits (67), Expect = 9.861
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 472 QDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQTRRVQSEEQ 531
           | |   |   |    . |   | | |.    .  || ||       .|...  | . |||
Sbjct: 359 QQENKSNSEALKQQQQLQQQQQRDPEA---HIKHLLHQR----QRRIEEQKEERRRVEEQ 411

Query: 532 QERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQ 569
           | | .. .  .  | .  |  . |  .| ..||   ||
Sbjct: 412 QRREREQRKLQEKEQQRRLEDMQALRREEERRQAEREQ 449

>hg18||uc002fzf
        |17|NM_153827|Q8N4C8|MINK1_HUMAN|MINK1|NM_153827|NP_722549|misshapen/NI
        K-related kinase isoform 3

          Length = 1332

 Score =  30 bits (67), Expect = 9.861
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 472 QDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQTRRVQSEEQ 531
           | |   |   |    . |   | | |.    .  || ||       .|...  | . |||
Sbjct: 359 QQENKSNSEALKQQQQLQQQQQRDPEA---HIKHLLHQR----QRRIEEQKEERRRVEEQ 411

Query: 532 QERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQ 569
           | | .. .  .  | .  |  . |  .| ..||   ||
Sbjct: 412 QRREREQRKLQEKEQQRRLEDMQALRREEERRQAEREQ 449

>hg18||uc002fzg
        |17|NM_001024937|Q5U8Z0|Q5U8Z0_HUMAN|MINK1|NM_001024937|NP_001020108|mi
        sshapen/NIK-related kinase isoform 4

          Length = 1312

 Score =  30 bits (67), Expect = 9.861
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 472 QDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQTRRVQSEEQ 531
           | |   |   |    . |   | | |.    .  || ||       .|...  | . |||
Sbjct: 359 QQENKSNSEALKQQQQLQQQQQRDPEA---HIKHLLHQR----QRRIEEQKEERRRVEEQ 411

Query: 532 QERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQ 569
           | | .. .  .  | .  |  . |  .| ..||   ||
Sbjct: 412 QRREREQRKLQEKEQQRRLEDMQALRREEERRQAEREQ 449

>hg18||uc002fzh
        |17|NM_015716|Q8N4C8-2|Q8N4C8-2|MINK1|NM_015716|NP_056531|misshapen/NIK
        -related kinase isoform 1

          Length = 1295

 Score =  30 bits (67), Expect = 9.861
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 472 QDERHGNILGLYNTLKEQLHTQTDRESLGLWVSSLLDQRVGVLHGELEQEQTRRVQSEEQ 531
           | |   |   |    . |   | | |.    .  || ||       .|...  | . |||
Sbjct: 359 QQENKSNSEALKQQQQLQQQQQRDPEA---HIKHLLHQR----QRRIEEQKEERRRVEEQ 411

Query: 532 QERLQQGQATRLAEIELLLSTLAARTQEVQQRQKLSEQ 569
           | | .. .  .  | .  |  . |  .| ..||   ||
Sbjct: 412 QRREREQRKLQEKEQQRRLEDMQALRREEERRQAEREQ 449

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,198,093
Number of Sequences: 45480
Number of Extensions: 193198093
Number of Successful Extensions: 11050774
Number of sequences better than 0.0: 0
BLASTP 7.6.0