BLASTP 7.6.0


Query=fugu4_574569 |jgi|Takru4|574569|e_gw2.13.152.1
        (1152 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hbi |4|NM_025009|Q66GS9|CP135_HUMAN|CEP135|NM_025009|...    994   1e-289
hg18||uc003hbj |4|AB014535|Q66GS9-3|Q66GS9-3|CEP135|NA|NA|Centro...    658   2e-188
hg18||uc003hbj |4|AB014535|Q66GS9-3|Q66GS9-3|CEP135|NA|NA|Centro...    529   1e-149
hg18||uc002szg |2|NM_025244|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244...    425   2e-118
hg18||uc002szi |2|BX647157|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|...    425   2e-118
hg18||uc002szh |2|NM_182911|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_182911...    424   3e-118
hg18||uc003hbh |4|AK023683|Q66GS9-2|Q66GS9-2|CEP135|NA|NA|Centro...    287   6e-077
hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP...    126   2e-028
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...    125   4e-028
hg18||uc002ddv |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001...    114   7e-025
hg18||uc002ddw |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844...    114   7e-025
hg18||uc002ddx |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001...    114   7e-025
hg18||uc002ddy |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|...    114   7e-025
hg18||uc001azt |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|N...    114   1e-024
hg18||uc002szg |2|NM_025244|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244...     99   2e-020
hg18||uc002szi |2|BX647157|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|...     99   2e-020
hg18||uc002szh |2|NM_182911|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_182911...     99   4e-020
hg18||uc001orn |11|Z14227|Q59HB8|Q59HB8_HUMAN|NUMA1|NM_006185|NP...     96   2e-019
hg18||uc002xcn |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_0010...     93   2e-018
hg18||uc001eyj |1|NM_020770|Q9P2M7|CING_HUMAN|CGN|NM_020770|NP_0...     92   3e-018
hg18||uc001orl |11|NM_006185|Q14980|NUMA1_HUMAN|NUMA1|NM_006185|...     89   4e-017
hg18||uc001orm |11|Z11584|Q14980-2|Q14980-2|NUMA1|NM_006185|NP_0...     89   4e-017
hg18||uc001oro |11|BC103765|NA|NA|NUMA1|NM_006185|NP_006176|nucl...     89   4e-017
hg18||uc002gmk |17|NM_003802|Q9UKX3|MYH13_HUMAN|MYH13|NM_003802|...     88   5e-017
hg18||uc002gmq |17|NM_002470|P11055|MYH3_HUMAN|MYH3|NM_002470|NP...     87   9e-017
hg18||uc003ulf |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP...     87   1e-016
hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP...     87   2e-016
hg18||uc003ulg |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP...     87   2e-016
hg18||uc003ulh |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|N...     87   2e-016
hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_...     87   2e-016
hg18||uc001wjv |14|NM_002471|P13533|MYH6_HUMAN|MYH6|NM_002471|NP...     86   3e-016
hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_...     85   4e-016
hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1...     84   7e-016
hg18||uc001wjw |14|M58018|P12883|MYH7_HUMAN|MYH7|NM_000257|NP_00...     83   2e-015
hg18||uc001wjx |14|NM_000257|P12883|MYH7_HUMAN|MYH7|NM_000257|NP...     83   2e-015
hg18||uc001wjv |14|NM_002471|P13533|MYH6_HUMAN|MYH6|NM_002471|NP...     79   3e-014
hg18||uc002prq |19|NM_001077186|Q7Z406-2|Q7Z406-2|MYH14|NM_00107...     72   3e-012
hg18||uc002prr |19|NM_024729|Q7Z406-2|Q7Z406-2|MYH14|NM_024729|N...     72   3e-012
hg18||uc003jir |5|NM_015577|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|N...     71   9e-012
hg18||uc003jis |5|AY317139|Q9P0K7-2|Q9P0K7-2|RAI14|NA|NA|Ankycor...     71   9e-012
hg18||uc003jit |5|BC028681|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|NP...     71   9e-012
hg18||uc003zab |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|...     70   1e-011
hg18||uc003zac |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|...     70   1e-011
hg18||uc003zad |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|...     70   1e-011
hg18||uc003zae |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|...     70   1e-011
hg18||uc003zaf |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|...     70   1e-011
hg18||uc003zag |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|...     70   1e-011
hg18||uc003zah |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|...     70   1e-011
hg18||uc003zai |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|...     70   1e-011
hg18||uc003zaj |8|U53204|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_...     70   1e-011
hg18||uc003jir |5|NM_015577|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|N...     67   1e-010
hg18||uc003jis |5|AY317139|Q9P0K7-2|Q9P0K7-2|RAI14|NA|NA|Ankycor...     67   1e-010
hg18||uc003jit |5|BC028681|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|NP...     67   1e-010
hg18||uc001kgr |10|NM_016195|Q96Q89-3|Q96Q89-3|MPHOSPH1|NM_01619...     66   2e-010
hg18||uc001kgs |10|AB033337|Q96Q89|MPPH1_HUMAN|MPHOSPH1|NM_01619...     66   2e-010
hg18||uc001orl |11|NM_006185|Q14980|NUMA1_HUMAN|NUMA1|NM_006185|...     66   3e-010
hg18||uc001orm |11|Z11584|Q14980-2|Q14980-2|NUMA1|NM_006185|NP_0...     66   3e-010
hg18||uc001orn |11|Z14227|Q59HB8|Q59HB8_HUMAN|NUMA1|NM_006185|NP...     66   3e-010
hg18||uc001oro |11|BC103765|NA|NA|NUMA1|NM_006185|NP_006176|nucl...     66   3e-010
hg18||uc003eei |3|NM_004487|Q14789|GOGB1_HUMAN|GOLGB1|NM_004487|...     66   3e-010
hg18||uc003eej |3|D25542|NA|NA|GOLGB1|NA|NA|Homo sapiens cDNA cl...     66   3e-010
hg18||uc001kgt |10|AL137392|NA|NA|MPHOSPH1|NM_016195|NP_057279|M...     64   8e-010
hg18||uc002kde |17|NM_144999|Q96CN5|LRC45_HUMAN|LRRC45|NM_144999...     62   3e-009
hg18||uc002zzv |22|AK097129|Q59GT7|Q59GT7_HUMAN|SPECC1L|NM_01533...     60   1e-008
hg18||uc002zzw |22|NM_015330|Q69YQ0|CYTSA_HUMAN|SPECC1L|NM_01533...     60   1e-008
hg18||uc002gmm |17|NM_002472|P13535|MYH8_HUMAN|MYH8|NM_002472|NP...     60   2e-008
hg18||uc003zxr |9|CR590682|Q5TCU8|Q5TCU8_HUMAN|TPM2|NA|NA|Tropom...     58   7e-008
hg18||uc002kde |17|NM_144999|Q96CN5|LRC45_HUMAN|LRRC45|NM_144999...     57   2e-007
hg18||uc002gmq |17|NM_002470|P11055|MYH3_HUMAN|MYH3|NM_002470|NP...     56   3e-007
hg18||uc002gmo |17|NM_005963|Q14CA4|Q14CA4_HUMAN|MYH1|NM_005963|...     55   4e-007
hg18||uc003djf |3|BC114627|Q14BN4-2|Q14BN4-2|SLMAP|NM_007159|NP_...     54   1e-006
hg18||uc003zxs |9|NM_003289|P07951|TPM2_HUMAN|TPM2|NM_003289|NP_...     54   1e-006
hg18||uc004cqa |X|NM_005088|Q5JQ74|Q5JQ74_HUMAN|CXYorf3|NM_00508...     53   2e-006
hg18||uc004fpn |Y|NM_005088|Q5JQ74|Q5JQ74_HUMAN|CXYorf3|NM_00508...     53   2e-006
hg18||uc003zxq |9|NM_213674|P07951-2|P07951-2|TPM2|NM_213674|NP_...     51   7e-006
hg18||uc002alo |15|AY640414|Q6DV90|Q6DV90_HUMAN|TPM1|NM_00101800...     50   2e-005
hg18||uc002alj |15|NM_001018007|Q9Y427|Q9Y427_HUMAN|TPM1|NM_0010...     49   3e-005
hg18||uc003dje |3|BC115701|Q14BN4|SLMAP_HUMAN|SLMAP|NM_007159|NP...     49   3e-005
hg18||uc001usl |13|NM_001033602|O94872|O94872_HUMAN|KIAA0774|NM_...     49   5e-005
hg18||uc001usm |13|NM_015233|Q8N5E2|Q8N5E2_HUMAN|KIAA0774|NM_015...     49   5e-005
hg18||uc003djc |3|AK124200|Q14BN4-6|Q14BN4-6|SLMAP|NM_007159|NP_...     48   6e-005
hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KI...     48   6e-005
hg18||uc003djd |3|NM_007159|Q14BN4-3|Q14BN4-3|SLMAP|NM_007159|NP...     47   2e-004
hg18||uc001csp |1|BX647676|NA|NA|EPS15|NM_001981|NP_001972|epide...     46   2e-004
hg18||uc001uci |12|NM_198240|P30622-2|P30622-2|CLIP1|NM_198240|N...     46   2e-004
hg18||uc003kfy |5|NM_004272|Q86YM7|HOME1_HUMAN|HOMER1|NM_004272|...     45   5e-004
hg18||uc001csq |1|NM_001981|P42566|EP15_HUMAN|EPS15|NM_001981|NP...     45   7e-004
hg18||uc002all |15|NM_001018020|P09493-3|P09493-3|TPM1|NM_001018...     45   7e-004
hg18||uc001csq |1|NM_001981|P42566|EP15_HUMAN|EPS15|NM_001981|NP...     44   0.001
hg18||uc001xzk |14|NM_001080414|NA|NA|KIAA1509|NM_001080414|NP_0...     44   0.001
hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP...     44   0.001
hg18||uc001eyj |1|NM_020770|Q9P2M7|CING_HUMAN|CGN|NM_020770|NP_0...     42   0.004
hg18||uc001fdy |1|NM_001043351|Q5VU66|Q5VU66_HUMAN|TPM3|NM_00104...     42   0.004
hg18||uc001fdz |1|NM_001043353|Q5VU72|Q5VU72_HUMAN|TPM3|NM_00104...     42   0.004
hg18||uc002hvm |17|NM_015515|Q8TC04|Q8TC04_HUMAN|KRT23|NM_015515...     41   0.007
hg18||uc001csp |1|BX647676|NA|NA|EPS15|NM_001981|NP_001972|epide...     41   0.009
hg18||uc002min |19|NM_145245|Q96CN4|EVI5L_HUMAN|EVI5L|NM_145245|...     41   0.009
hg18||uc003oef |6|NM_002263|Q6P4A5|Q6P4A5_HUMAN|KIFC1|NM_002263|...     41   0.009
hg18||uc003shy |6_qbl_hap2|NM_002263|Q6P4A5|Q6P4A5_HUMAN|KIFC1|N...     41   0.009
hg18||uc001dox |1|NM_005665|O60447|EVI5_HUMAN|EVI5|NM_005665|NP_...     39   0.036

>hg18||uc003hbi
        |4|NM_025009|Q66GS9|CP135_HUMAN|CEP135|NM_025009|NP_079285|centrosome
        protein 4

          Length = 1140

 Score =  994 bits (2569), Expect = 1e-289
 Identities = 541/1156 (46%), Positives = 790/1156 (68%), Gaps = 49/1156 (4%)

Query:    5 ERKFVNLRKRLDQLGYRQPLGTESLPLVEKLFNDLVHTTDSLRNAKLSVGKTEKESRNVD 64
            |||..|.||||||||||| |  | ||||||||.||||||.||| .|||  | |||| | |
Sbjct:    6 ERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFD 65

Query:   65 ALVEPYRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYV 124
             ..|||. ||||. |.||.|. .|.. .|  |.  .|||  ..|   |  ||||||||| 
Sbjct:   66 FVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYA 125

Query:  125 HKVRCLEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAY 184
            ||.. |||. | |.||||||||||. |||||||||| || |||||||||| .||.  |.|
Sbjct:  126 HKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSY 185

Query:  185 PVTQPDDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNTQVELRDQEIERLN 244
            || ||||||.|||||.|| || |||... .|.  |   .  |.  . |.|||..|||||.
Sbjct:  186 PVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQIELREREIERLS 245

Query:  245 HALKGGRPHDVISLEAQNLSNEK*AGSVLDVQQIEYLQETNRTLEEKVKGLQQRKEDVST 304
             || |||  ||.|||..| .|||     |.. |...||. |. ||.... | . || |..
Sbjct:  246 VALDGGRSPDVLSLESRNKTNEKLIAH-LNI-QVDFLQQANKDLEKRIRELMETKETVTS 303

Query:  305 EVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELED 364
            || ||| ||..||.||| ||.||..||  |. |||||| || |||||..|.   ...||.
Sbjct:  304 EVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKLSEMQDLEE 363

Query:  365 IVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEKVDKAMGAERE 424
             .   .   .    ||| | ..||        .| ||  .|.|| || .||.     ||.
Sbjct:  364 TMAKLQLELNLCQKEKERLSDELL----VKSDLETVVHQLEQEKQRLSKKVESFAVTERQ 419

Query:  425 LVLELESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRV------------ 472
            | ||.| || ..|.  |.||||||| |.. .|.|||||..| || . .            
Sbjct:  420 LTLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYSA 479

Query:  473 RGAASPNLSPSRGRKTELLHALT-ERDELKAALKGLERRLDEVQDTVKSLSTERDHLKML 531
            |  .|   .| .|     .| .| |||||.  |.  |. ....|  || |. ||| | .|
Sbjct:  480 REKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVL 539

Query:  532 LKVFFFPQAQEDLRLAKTKDASGDL---------KQAELT---IQQMSAEIEALMEKLKV 579
                 . .|||.|   . .               |. ||    .... || ||| |||. 
Sbjct:  540 -----YNEAQEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKEALREKLEH 594

Query:  580 TQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQ 639
             .  .|  .   |. |  |      || |. . .|.| ..||  |.|| .|| |.     
Sbjct:  595 IEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENKLKVQAQKFSH 654

Query:  640 NAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQH 699
             | . . .. | |.|||. ||..... | |||||.|  || .|   |  ||... ||.  
Sbjct:  655 VAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQIKILEEKIDELNLK 714

Query:  700 GSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNL 759
             .   |.   ....|  .|.||| ||. ||.||||.  |||  . ||| .  ... .   
Sbjct:  715 MTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIMISEC 774

Query:  760 ESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTREN 819
            |||. ||.  | .|.||| ||||||||  .||  .            |||||| || |||
Sbjct:  775 ESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMAREN 834

Query:  820 QVVHAEMEDVLHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAH 879
            | .  |.|  . |..|.| ||| || |||. | |.|||       |.|| |||.||.| |
Sbjct:  835 QEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAK-------EKENQDLLDRFQMLH 887

Query:  880 SEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLS 939
            .  |. | |  |||| ..|.|||||| ||||| ||. .   |||||.|| |  ||| |.|
Sbjct:  888 NRAEDWEVKAHQAEGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQIS 947

Query:  940 SLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTA 999
            |.|.|||||||||   ...| ..|.||.|.||||.||||||..  .|| ..... |||  
Sbjct:  948 SMAKAMSRLEEELRHQEDEKATVLNDLSSLRELCIKLDSGKDIMTQQLNSKNLEFERVVV 1007

Query: 1000 ELEDVRAEAELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNF 1059
            |||.|..|..||||||. || ||.||||||. || ||| . | . |.. |..||...|  
Sbjct: 1008 ELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLTSHEKDTEIQLLKEKLTL 1067

Query: 1060 ADSKILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSLSSLHTP 1119
            ..||.   .|. | |. ||.||.|. | |.||..|||.|||||.||||| |     | ||
Sbjct: 1068 SESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHG-----LATP 1122

Query: 1120 TSLNVSGSPHHVSPDH 1135
               .   || | ||.|
Sbjct: 1123 PLSSTLRSPSH-SPEH 1137

>hg18||uc003hbj |4|AB014535|Q66GS9-3|Q66GS9-3|CEP135|NA|NA|Centrosomal protein
        of 135 kDa (Cep135 protein) (Centrosomal protein 4)

          Length = 846

 Score =  658 bits (1696), Expect = 2e-188
 Identities = 369/859 (42%), Positives = 562/859 (65%), Gaps = 42/859 (4%)

Query:  297 QRKEDVSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQ 356
            . || |..|| ||| ||..||.||| ||.||..||  |. |||||| || |||||..|. 
Sbjct:    2 ETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKL 61

Query:  357 KIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEKVD 416
              ...||. .   .   .    ||| | ..||        .| ||  .|.|| || .||.
Sbjct:   62 SEMQDLEETMAKLQLELNLCQKEKERLSDELL----VKSDLETVVHQLEQEKQRLSKKVE 117

Query:  417 KAMGAERELVLELESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRV---- 472
                 ||.| ||.| || ..|.  |.||||||| |.. .|.|||||..| || . .    
Sbjct:  118 SFAVTERQLTLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRR 177

Query:  473 --------RGAASPNLSPSRGRKTELLHALT-ERDELKAALKGLERRLDEVQDTVKSLST 523
                    |  .|   .| .|     .| .| |||||.  |.  |. ....|  || |. 
Sbjct:  178 SCSTSYSAREKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTA 237

Query:  524 ERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDL---------KQAELT---IQQMSAEIE 571
            ||| | .|     . .|||.|   . .               |. ||    .... || |
Sbjct:  238 ERDKLSVL-----YNEAQEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKE 292

Query:  572 ALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKERREALEQELK 631
            || |||.  .  .|  .   |. |  |      || |. . .|.| ..||  |.|| .||
Sbjct:  293 ALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKETIESLENKLK 352

Query:  632 SQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLED 691
             |.      | . . .. | |.|||. ||..... | |||||.|  || .|   |  ||.
Sbjct:  353 VQAQKFSHVAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQIKILEE 412

Query:  692 RLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLED 751
            .. ||.   .   |.   ....|  .|.||| ||. ||.||||.  |||  . ||| .  
Sbjct:  413 KIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQ 472

Query:  752 VRLTVKNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDD 811
            ... .   |||. ||.  | .|.||| ||||||||  .||  .            |||||
Sbjct:  473 MKIMISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDD 532

Query:  812 LTTMTRENQVVHAEMEDVLHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDL 871
            | || |||| .  |.|  . |..|.| ||| || |||. | |.|||       |.|| ||
Sbjct:  533 LATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAK-------EKENQDL 585

Query:  872 LNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQAL 931
            |.||.| |.  |. | |  |||| ..|.|||||| ||||| ||. .   |||||.|| | 
Sbjct:  586 LDRFQMLHNRAEDWEVKAHQAEGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAH 645

Query:  932 QAYEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRS 991
             ||| |.||.|.|||||||||   ...| ..|.||.|.||||.||||||..  .|| ...
Sbjct:  646 HAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLRELCIKLDSGKDIMTQQLNSKN 705

Query:  992 MDVERVTAELEDVRAEAELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELK 1051
            .. |||  |||.|..|..||||||. || ||.||||||. || ||| . | . |.. |..
Sbjct:  706 LEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLTSHEKDTEIQ 765

Query: 1052 LLRDRLNFADSKILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGV 1111
            ||...|  ..||.   .|. | |. ||.||.|. | |.||..|||.|||||.||||| |.
Sbjct:  766 LLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGL 825

Query: 1112 SLSSLHTPTSLNVSGSPHH 1130
            .   | . |  . | || |
Sbjct:  826 ATPPL-SSTLRSPSHSPEH 843

>hg18||uc003hbj |4|AB014535|Q66GS9-3|Q66GS9-3|CEP135|NA|NA|Centrosomal protein
        of 135 kDa (Cep135 protein) (Centrosomal protein 4)

          Length = 846

 Score =  529 bits (1361), Expect = 1e-149
 Identities = 326/871 (37%), Positives = 517/871 (59%), Gaps = 55/871 (6%)

Query:  283 ETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQEL----CEELTHIDKLAKRLEMDKDRVL 338
            ||  |.  .|  |  . | .  |.  .    |.|     | |   ||     . .  | |
Sbjct:    2 ETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKL 61

Query:  339 ETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKM- 397
                 .|.|   .|| .  . .. .. ..     .|. .     | ..   | .| |   
Sbjct:   62 SEMQ-DLEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFA 120

Query:  398 --EGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDAFVRSL 455
              |  .|| | |..||.  . .   .   |   |. .         ||     | . . |
Sbjct:  121 VTERQLTL-EVERMRLEHGIKRRDRSPSRLDTFLKGIE-------EER-----DYYKKEL 167

Query:  456 EQ-ERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALT-ERDELKAALKGLERRLDE 513
            |. .    |.        |  .|   .| .|     .| .| |||||.  |.  |. ...
Sbjct:  168 ERLQHIIQRRSCSTSYSAREKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYMED 227

Query:  514 VQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDL---------KQAELT-- 562
            .|  || |. ||| | .|     . .|||.|   . .               |. ||   
Sbjct:  228 IQSNVKLLTAERDKLSVL-----YNEAQEELSALRKESTQTTAPHNIVSLMEKEKELALS 282

Query:  563 -IQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKE 621
             .... || ||| |||.  .  .|  .   |. |  |      || |. . .|.| ..||
Sbjct:  283 DLRRIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSKVLIMKE 342

Query:  622 RREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHA 681
              |.|| .|| |.      | . . .. | |.|||. ||..... | |||||.|  || .
Sbjct:  343 TIESLENKLKVQAQKFSHVAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELES 402

Query:  682 AHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEE 741
            |   |  ||... ||.   .   |.   ....|  .|.||| ||. ||.||||.  ||| 
Sbjct:  403 AQAQIKILEEKIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQEN 462

Query:  742 NSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXX 801
             . ||| .  ... .   |||. ||.  | .|.||| ||||||||  .||  .       
Sbjct:  463 LANKEKAVAQMKIMISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIA 522

Query:  802 XXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLRVHSYIIEVSKIEKLVAAKARGN 861
                 |||||| || |||| .  |.|  . |..|.| ||| || |||. | |.|||    
Sbjct:  523 FKENRRLQDDLATMARENQEISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAK---- 578

Query:  862 TRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSINNKE 921
               |.|| |||.||.| |.  |. | |  |||| ..|.|||||| ||||| ||. .   |
Sbjct:  579 ---EKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLELLSIDTERRHLRERVELLE 635

Query:  922 KEIQQHIQALQAYEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKE 981
            ||||.|| |  ||| |.||.|.|||||||||   ...| ..|.||.|.||||.||||||.
Sbjct:  636 KEIQEHINAHHAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLRELCIKLDSGKD 695

Query:  982 LTARQLTTRSMDVERVTAELEDVRAEAELLKKQLAGERLTVRNLESLLSANRQKEFQTQL 1041
            .  .|| ..... |||  |||.|..|..||||||. || ||.||||||. || ||| . |
Sbjct:  696 IMTQQLNSKNLEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHL 755

Query: 1042 AATEREAELKLLRDRLNFADSKILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERFERER 1101
             . |.. |..||...|  ..||.   .|. | |. ||.||.|. | |.||..|||.||||
Sbjct:  756 TSHEKDTEIQLLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERER 815

Query: 1102 AVQEMRRQGVSLSSL--------HTPTSLNV 1124
            |.||||| |..   |        |.|   ||
Sbjct:  816 AIQEMRRHGLATPPLSSTLRSPSHSPEHRNV 846

>hg18||uc002szg
        |2|NM_025244|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|NP_079520|testis
        specific, 10

          Length = 698

 Score =  425 bits (1092), Expect = 2e-118
 Identities = 238/681 (34%), Positives = 414/681 (60%), Gaps = 33/681 (4%)

Query:  489 ELLHALT-ERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDL--- 544
            |||   | .|.|||  |.  || | |.|  || | .||| . .|     . ||||..   
Sbjct:   24 ELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLL-----YEQAQEEITRL 78

Query:  545 --------RLAKTKDASGDLKQAE-------LTIQQMSAEIEALMEKLKVTQTSALSDRQ 589
                    .  |.  |   |.. |         ...|. | ..| |.||. | .| ... 
Sbjct:   79 RREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKA 138

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERA 649
              |.|| .||  | .|. ||..| | . |.||    .|.|.|| .  |.    |. ...|
Sbjct:  139 HLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKA 198

Query:  650 ESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSA 709
            |.|.||.| |  |. |||||  |. |  ||    | |  |....   ..     .|..| 
Sbjct:  199 ENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISI 258

Query:  710 LQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGA 769
            |  ..  | .||. ||  .|.|.| .  | |  . ||| .  ..  .  .| .  |   |
Sbjct:  259 LGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEA 318

Query:  770 LNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDV 829
            |   |...  .|||||   .||| .             ||.      .||| .  .. | 
Sbjct:  319 LIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDT 378

Query:  830 LHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKL 889
             .| ...| .|    .||.|.. .. ..       | ||  .. . | |. . |  | | 
Sbjct:  379 HNELNDIKQKVQDTNLEVNKLKNILKSE-------ESENRQMMEQLRKANEDAENWENKA 431

Query:  890 QQAEGLNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLE 949
            .|.|  ||...|||.... |  .|.. ...  .|..||. | ..|. |.|.| ... ..|
Sbjct:  432 RQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKME 491

Query:  950 EELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAE 1009
            ||| | | .| | |.||.| ||||.|||| |||  |||  .  ..|    ||.   .| |
Sbjct:  492 EELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIE 551

Query: 1010 LLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTR 1069
            ||. |.| ||....|||.|| ||| ||.|.|.|  |.|.|..||.. |  |..|.   .|
Sbjct:  552 LLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSR 611

Query: 1070 DVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSLSSLHTPTSLNVSGSPH 1129
            || | .  |.||| ..|. .||| ||||||||||||.|||  | .. |  ...  .   |
Sbjct:  612 DVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCH 671

Query: 1130 HVSPDHSILRSVTRSADKSAD 1150
              ||. .  ||  |  |.| .
Sbjct:  672 --SPERAHHRSPDRGLDRSLE 690

>hg18||uc002szi
        |2|BX647157|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|NP_079520|testis
        specific, 10

          Length = 698

 Score =  425 bits (1092), Expect = 2e-118
 Identities = 238/681 (34%), Positives = 414/681 (60%), Gaps = 33/681 (4%)

Query:  489 ELLHALT-ERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDL--- 544
            |||   | .|.|||  |.  || | |.|  || | .||| . .|     . ||||..   
Sbjct:   24 ELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLL-----YEQAQEEITRL 78

Query:  545 --------RLAKTKDASGDLKQAE-------LTIQQMSAEIEALMEKLKVTQTSALSDRQ 589
                    .  |.  |   |.. |         ...|. | ..| |.||. | .| ... 
Sbjct:   79 RREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKA 138

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERA 649
              |.|| .||  | .|. ||..| | . |.||    .|.|.|| .  |.    |. ...|
Sbjct:  139 HLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKA 198

Query:  650 ESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSA 709
            |.|.||.| |  |. |||||  |. |  ||    | |  |....   ..     .|..| 
Sbjct:  199 ENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISI 258

Query:  710 LQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGA 769
            |  ..  | .||. ||  .|.|.| .  | |  . ||| .  ..  .  .| .  |   |
Sbjct:  259 LGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEA 318

Query:  770 LNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDV 829
            |   |...  .|||||   .||| .             ||.      .||| .  .. | 
Sbjct:  319 LIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDT 378

Query:  830 LHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKL 889
             .| ...| .|    .||.|.. .. ..       | ||  .. . | |. . |  | | 
Sbjct:  379 HNELNDIKQKVQDTNLEVNKLKNILKSE-------ESENRQMMEQLRKANEDAENWENKA 431

Query:  890 QQAEGLNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLE 949
            .|.|  ||...|||.... |  .|.. ...  .|..||. | ..|. |.|.| ... ..|
Sbjct:  432 RQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKME 491

Query:  950 EELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAE 1009
            ||| | | .| | |.||.| ||||.|||| |||  |||  .  ..|    ||.   .| |
Sbjct:  492 EELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIE 551

Query: 1010 LLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTR 1069
            ||. |.| ||....|||.|| ||| ||.|.|.|  |.|.|..||.. |  |..|.   .|
Sbjct:  552 LLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSR 611

Query: 1070 DVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSLSSLHTPTSLNVSGSPH 1129
            || | .  |.||| ..|. .||| ||||||||||||.|||  | .. |  ...  .   |
Sbjct:  612 DVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCH 671

Query: 1130 HVSPDHSILRSVTRSADKSAD 1150
              ||. .  ||  |  |.| .
Sbjct:  672 --SPERAHHRSPDRGLDRSLE 690

>hg18||uc002szh
        |2|NM_182911|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_182911|NP_878915|testis
        specific, 10

          Length = 698

 Score =  424 bits (1090), Expect = 3e-118
 Identities = 237/681 (34%), Positives = 414/681 (60%), Gaps = 33/681 (4%)

Query:  489 ELLHALT-ERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDL--- 544
            |||   | .|.|||  |.  || | |.|  || | .||| . .|     . ||||..   
Sbjct:   24 ELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLL-----YEQAQEEITRL 78

Query:  545 --------RLAKTKDASGDLKQAE-------LTIQQMSAEIEALMEKLKVTQTSALSDRQ 589
                    .  |.  |   |.. |         ...|. | ..| |.||. | .| ... 
Sbjct:   79 RREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKA 138

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERA 649
              |.|| .||  | .|. ||..| | . |.||    .|.|.|| .  |.    |. ...|
Sbjct:  139 HLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKA 198

Query:  650 ESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSA 709
            |.|.||.| |  |. |||||  |. |  ||    | |  |....   ..     .|..| 
Sbjct:  199 ENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISI 258

Query:  710 LQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGA 769
            |  ..  | .||. .|  .|.|.| .  | |  . ||| .  ..  .  .| .  |   |
Sbjct:  259 LGGTLNDLAKEKECMQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEA 318

Query:  770 LNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDV 829
            |   |...  .|||||   .||| .             ||.      .||| .  .. | 
Sbjct:  319 LIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDT 378

Query:  830 LHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKL 889
             .| ...| .|    .||.|.. .. ..       | ||  .. . | |. . |  | | 
Sbjct:  379 HNELNDIKQKVQDTNLEVNKLKNILKSE-------ESENRQMMEQLRKANEDAENWENKA 431

Query:  890 QQAEGLNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLE 949
            .|.|  ||...|||.... |  .|.. ...  .|..||. | ..|. |.|.| ... ..|
Sbjct:  432 RQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKME 491

Query:  950 EELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAE 1009
            ||| | | .| | |.||.| ||||.|||| |||  |||  .  ..|    ||.   .| |
Sbjct:  492 EELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIE 551

Query: 1010 LLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTR 1069
            ||. |.| ||....|||.|| ||| ||.|.|.|  |.|.|..||.. |  |..|.   .|
Sbjct:  552 LLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSR 611

Query: 1070 DVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSLSSLHTPTSLNVSGSPH 1129
            || | .  |.||| ..|. .||| ||||||||||||.|||  | .. |  ...  .   |
Sbjct:  612 DVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCH 671

Query: 1130 HVSPDHSILRSVTRSADKSAD 1150
              ||. .  ||  |  |.| .
Sbjct:  672 --SPERAHHRSPDRGLDRSLE 690

>hg18||uc003hbh |4|AK023683|Q66GS9-2|Q66GS9-2|CEP135|NA|NA|Centrosomal protein
        of 135 kDa (Cep135 protein) (Centrosomal protein 4)

          Length = 249

 Score =  287 bits (734), Expect = 6e-077
 Identities = 140/229 (61%), Positives = 179/229 (78%)

Query:   5 ERKFVNLRKRLDQLGYRQPLGTESLPLVEKLFNDLVHTTDSLRNAKLSVGKTEKESRNVD 64
           |||..|.||||||||||| |  | ||||||||.||||||.||| .|||  | |||| | |
Sbjct:   6 ERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFD 65

Query:  65 ALVEPYRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYV 124
            ..|||. ||||. |.||.|. .|.. .|  |.  .|||  ..|   |  ||||||||| 
Sbjct:  66 FVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYA 125

Query: 125 HKVRCLEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAY 184
           ||.. |||. | |.||||||||||. |||||||||| || |||||||||| .||.  |.|
Sbjct: 126 HKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSY 185

Query: 185 PVTQPDDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNTQV 233
           || ||||||.|||||.|| || |||... .|.  |   .  |.  . ||
Sbjct: 186 PVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQV 234

>hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP_003557|early
        endosome antigen 1, 162kD

          Length = 1411

 Score =  126 bits (316), Expect = 2e-028
 Identities = 185/977 (18%), Positives = 423/977 (43%), Gaps = 81/977 (8%)

Query:  208 LQEDIIK-----LRLDLENAQECVKHLNTQVEL--RDQEIERLNHALKGGRP--HDV-IS 257
            | |...|      .|. .. .| |   | |  |  .| . ..|   |       | . . 
Sbjct:  307 LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVE 366

Query:  258 LEAQNLSNEK*AGSVLDVQ-QIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQEL 316
            |  .  . .|    . .|. . ..|.   . |... .  .|    . .|.  |  |  | 
Sbjct:  367 LSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLET 426

Query:  317 CEELTHI-DKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSE 375
              .|     .| .. ..  ....   | | | |  .| .  .. |.|.. || .   | .
Sbjct:  427 ERQLGEAHGRLKEQRQLSSEKLM---DKEQQVADLQL-KLSRLEEQLKEKVTNSTELQHQ 482

Query:  376 ADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESM--R 433
             |  |.  .||        . ..   |    |     |.| . .| . . .  ||..  .
Sbjct:  483 LDKTKQQHQEQ--------QALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQK 534

Query:  434 TKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAAS------PNLSPSRGRK 487
            .|  .   |.    | | ... | |     |  |..  ..   .       | | |  . 
Sbjct:  535 SKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQA 594

Query:  488 TELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLK-MLLKVFFFPQAQEDLRL 546
             | ||   .  | || |.  . |.  .. .|  |... .  |  . ..    .|. .| |
Sbjct:  595 QENLH--DQVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLL 652

Query:  547 -------AKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLE 599
                   |.  |    |  |.  .|    |.  .  .|    |. | |.|        ||
Sbjct:  653 SAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQV-TAKLQDKQ---EHCSQLE 708

Query:  600 SAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERAESNALRILKE 659
            | .|  . . |        |... | || ..|   | .|.      |   .    | |  
Sbjct:  709 SHLKEYKEKYLS-------LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNT 761

Query:  660 QMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDR 719
             .|   ..   .| ..   . .    . |  . |  . |  .  .|.   |..    | .
Sbjct:  762 DLELRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKQILKQDFETLSQ 821

Query:  720 EKDVLQDEVDQKTE-KLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIG 778
            |  .  .|.. . .  . |||.   .|| .. ..      |      |. . .  |.|  
Sbjct:  822 ETKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKE-- 879

Query:  779 SLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKL 838
                     |.  ||.            .||  .    .| . .   .|       .|||
Sbjct:  880 --------NQKGKAAILDLEKTCKELKHQLQVQMENTLKEQKELKKSLEKEKEASHQLKL 931

Query:  839 RVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQ----QAEG 894
             ..|   .. . .  .    .   . .    .|         ..|  . .|.    |   
Sbjct:  932 ELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQKTE 991

Query:  895 LNNSIRLELLSSDTERRQLRDSI----NNKEKEIQQHIQALQA----YEGQLSSLARAMS 946
            | | .. .|  .  |    .. |    || ||  |.  . ||.     | .| .  . . 
Sbjct:  992 LENKLQQQLTQAAQELAAEKEKISVLQNNYEKS-QETFKQLQSDFYGRESELLATRQDLK 1050

Query:  947 RLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRA 1006
             .||.|  ||||  |  . . .  .|  .| . |    .    .   ..     |.|.. 
Sbjct: 1051 SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQK 1110

Query: 1007 EAELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILE 1066
            |  | .|.|  |.  .  .| .    ||..  |.|    .  .|. ...  |  |.| | 
Sbjct: 1111 EKSLKEKELVNEKSKLAEIEEIKC--RQEKEITKLNEELKSHKLESIKEITNLKDAKQL- 1167

Query: 1067 HTRDVTQLQGKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSL-SSLHTPTSLNVS 1125
              .   .||||   |.  ..  .|     . . ..  .|.... .   . ||.       
Sbjct: 1168 LIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEV 1227

Query: 1126 GSPHHVSPDHSILRSVT 1142
            |   |   .  .   .|
Sbjct: 1228 GMKKHEENEAKLTMQIT 1244

>hg18||uc002xcm
        |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186|NP_009117|centrosomal
        protein 2 isoform 1

          Length = 2442

 Score =  125 bits (313), Expect = 4e-028
 Identities = 141/658 (21%), Positives = 282/658 (42%), Gaps = 61/658 (9%)

Query:  455 LEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTEL---LH-ALTERDELKAALKGLERR 510
            | |. .   ||| | |||          ..|.| |    || |. ||. |.  | ||| .
Sbjct:  475 LRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAK 534

Query:  511 LDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEI 570
              |    . .|    .   .  ..    | .    ||. . .  .|  .| |..   |..
Sbjct:  535 QSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADL 594

Query:  571 EALMEKLKVTQTSALSDRQVEERRILDLE-------SAVKSLERERLDQRSEVHLLKERR 623
             |   ||     .   |.    ...| ||       | ... |. |   . ..   ..||
Sbjct:  595 RAAAVKLSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRR 654

Query:  624 EALEQELKSQSAAALQNAEEVAQE-RAESNALRILKEQMEQALSDTQHRLSVKTNELHAA 682
            |||  |  .   | || |||   | .|.   ..  ||.... ||...|.    | .|   
Sbjct:  655 EAL-WEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQL 713

Query:  683 HETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEV-------DQKTEKL 735
            |.   . |. |    |       . .||.  . |..|..  | ...       .     |
Sbjct:  714 HQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSL 773

Query:  736 FELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQL----DACQEEL 791
            || |..||  |     . . .. .  .   .|| .   . |. . | |     ||   .|
Sbjct:  774 FEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQL 833

Query:  792 AALXXXXXXXXXXXXRLQDDLTTMTRE---------NQVVHAEMEDVLHERDELKLRVHS 842
            |                 .      ||          | .   .| .  |. ||..|.  
Sbjct:  834 AQAEQEGKTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALESLEREKMELEMRLKE 893

Query:  843 YIIEVSKIE--------KLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEG 894
               |.  |.        .  .|  .     |.| . ||        |. .  |.|   | 
Sbjct:  894 QQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQL---ER 950

Query:  895 LNNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLEEELHK 954
            |   .... |        |.  .   ..|..   .| . .   |..       |.||   
Sbjct:  951 LRQDMKVQKLKEQETTGILQTQLQEAQRELK---EAARQHRDDLAA-------LQEESSS 1000

Query:  955 AQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTR---SMDVERVTAELEDVRAEAELL 1011
              .||  |   .  ..   |  |  . |  ...  .   . .  |.  |||  .|   | 
Sbjct: 1001 LLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQEKLRETQEYNRIQKELEREKASLTLS 1060

Query: 1012 KKQLAGERLTVRNLESL----LSANRQKEFQTQLAATEREAELKLLRDRLNFADSKIL 1065
              .     | ..  .|.    ||| ||   . |    |  |...|||  .   ..  |
Sbjct: 1061 LMEKEQRLLVLQEADSIRQQELSALRQDMQEAQGEQKELSAQMELLRQEVKEKEADFL 1118

>hg18||uc002ddv
        |16|NM_001040113|Q3MNF0|Q3MNF0_HUMAN|MYH11|NM_001040113|NP_001035202|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1945

 Score =  114 bits (285), Expect = 7e-025
 Identities = 183/850 (21%), Positives = 355/850 (41%), Gaps = 113/850 (13%)

Query:   21 RQPLGTESLPLVEKLFNDLVHTTDSL---------RNAKLSVGK--TEKESRNVDALVEP 69
            .. || |    .| |  .|  | ||          |  ...| |   ..|.|. .| |. 
Sbjct: 1148 KRDLGEE----LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQE 1203

Query:   70 YRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYVHKVRC 129
             | ..|. | .  .  .|  | |   |.  . |.     |  |   |     .  || . 
Sbjct: 1204 MRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKK 1263

Query:  130 LEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAYPVTQP 189
            ||        ..|.|| |                   | | .... .           | 
Sbjct: 1264 LE-------AQVQELQSKCSDG--------------ERARAELNDKVHK--------LQN 1294

Query:  190 DDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKH-----LNTQVELRDQEIERLN 244
            .   |  .|  |.|.  .| .|.  |   |.. || ..      ||   .||  | ||  
Sbjct: 1295 EVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEER-- 1352

Query:  245 HALKGGRPHDVISLEAQNLSNEK*AGSVLDVQQIEYLQETNRTLEE---KVKGLQQRKED 301
                     | .  | .   | .   | |..|    | .. . |..    |. |.. |. 
Sbjct: 1353 -----NSLQDQLDEEMEAKQNLERHISTLNIQ----LSDSKKKLQDFASTVEALEEGKKR 1403

Query:  302 VSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEE 361
               |. ||. . .|       ..|   ||. . | ..   | . |      ..|.|  . 
Sbjct: 1404 FQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQL 1463

Query:  362 LEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEE--EKVRLQEKVDKAM 419
            | .    . .   | |  .   |       ||  |   .   .||  |     |. .| .
Sbjct: 1464 LAEEKNISSKYADERDRAEAEAR-------EKETKALSLARALEEALEAKEELERTNKML 1516

Query:  420 GAERELVLELESMRTKYG--VCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAAS 477
             || |   .| | .   |  |   |.|   |.  .  .. . .    | .     .    
Sbjct: 1517 KAEME---DLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLE 1573

Query:  478 PNLSPSRGRKTELLHALTERDELKAALKGLERRL----DEVQDTVKSLSTERDHLKMLLK 533
             |.   .|.    | |  |..| |   . |.|.|     |..|  |  .      | |  
Sbjct: 1574 VNMQALKGQFERDLQARDEQNEEKR--RQLQRQLHEYETELEDERKQRALAAAAKKKLEG 1631

Query:  534 VFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIE-ALMEKLKVTQTSALSDRQVE- 591
                 . | |  .   ..|   |.. .  ..    |.| |   . ..  |.  .... . 
Sbjct: 1632 DLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKS 1691

Query:  592 -ERRILDLESAVKSLERERLDQRSEVHLLKER-------REALEQELKSQSAAALQNAEE 643
             |  .. |.  . . || |     |   | |        | ||. | .   |   |  ||
Sbjct: 1692 LEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE 1751

Query:  644 VAQER----AESNALRILKEQMEQALSD--TQHRLSVKTNELHAAHETINK-LEDRLGEL 696
            . .|.    | |. .|   .| ||  ..  |.   . |        |  || |  .| |.
Sbjct: 1752 LEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEM 1811

Query:  697 SQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTV 756
               |.|     |  . .||||. .   |...|.|.  .     .   .|.| |... | |
Sbjct: 1812 --EGAVK----SKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQV 1865

Query:  757 KNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMT 816
            ..      | .         .  |.|||.  .||   .            .|| .|   |
Sbjct: 1866 EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRI-------NANRRKLQRELDEAT 1918

Query:  817 RENQVVHAEM 826
              |. .  |.
Sbjct: 1919 ESNEAMGREV 1928

>hg18||uc002ddw
        |16|NM_022844|Q3MIV8|Q3MIV8_HUMAN|MYH11|NM_022844|NP_074035|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1938

 Score =  114 bits (285), Expect = 7e-025
 Identities = 183/850 (21%), Positives = 355/850 (41%), Gaps = 113/850 (13%)

Query:   21 RQPLGTESLPLVEKLFNDLVHTTDSL---------RNAKLSVGK--TEKESRNVDALVEP 69
            .. || |    .| |  .|  | ||          |  ...| |   ..|.|. .| |. 
Sbjct: 1141 KRDLGEE----LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQE 1196

Query:   70 YRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYVHKVRC 129
             | ..|. | .  .  .|  | |   |.  . |.     |  |   |     .  || . 
Sbjct: 1197 MRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKK 1256

Query:  130 LEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAYPVTQP 189
            ||        ..|.|| |                   | | .... .           | 
Sbjct: 1257 LE-------AQVQELQSKCSDG--------------ERARAELNDKVHK--------LQN 1287

Query:  190 DDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKH-----LNTQVELRDQEIERLN 244
            .   |  .|  |.|.  .| .|.  |   |.. || ..      ||   .||  | ||  
Sbjct: 1288 EVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEER-- 1345

Query:  245 HALKGGRPHDVISLEAQNLSNEK*AGSVLDVQQIEYLQETNRTLEE---KVKGLQQRKED 301
                     | .  | .   | .   | |..|    | .. . |..    |. |.. |. 
Sbjct: 1346 -----NSLQDQLDEEMEAKQNLERHISTLNIQ----LSDSKKKLQDFASTVEALEEGKKR 1396

Query:  302 VSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEE 361
               |. ||. . .|       ..|   ||. . | ..   | . |      ..|.|  . 
Sbjct: 1397 FQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQL 1456

Query:  362 LEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEE--EKVRLQEKVDKAM 419
            | .    . .   | |  .   |       ||  |   .   .||  |     |. .| .
Sbjct: 1457 LAEEKNISSKYADERDRAEAEAR-------EKETKALSLARALEEALEAKEELERTNKML 1509

Query:  420 GAERELVLELESMRTKYG--VCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAAS 477
             || |   .| | .   |  |   |.|   |.  .  .. . .    | .     .    
Sbjct: 1510 KAEME---DLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLE 1566

Query:  478 PNLSPSRGRKTELLHALTERDELKAALKGLERRL----DEVQDTVKSLSTERDHLKMLLK 533
             |.   .|.    | |  |..| |   . |.|.|     |..|  |  .      | |  
Sbjct: 1567 VNMQALKGQFERDLQARDEQNEEKR--RQLQRQLHEYETELEDERKQRALAAAAKKKLEG 1624

Query:  534 VFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIE-ALMEKLKVTQTSALSDRQVE- 591
                 . | |  .   ..|   |.. .  ..    |.| |   . ..  |.  .... . 
Sbjct: 1625 DLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKS 1684

Query:  592 -ERRILDLESAVKSLERERLDQRSEVHLLKER-------REALEQELKSQSAAALQNAEE 643
             |  .. |.  . . || |     |   | |        | ||. | .   |   |  ||
Sbjct: 1685 LEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE 1744

Query:  644 VAQER----AESNALRILKEQMEQALSD--TQHRLSVKTNELHAAHETINK-LEDRLGEL 696
            . .|.    | |. .|   .| ||  ..  |.   . |        |  || |  .| |.
Sbjct: 1745 LEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEM 1804

Query:  697 SQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTV 756
               |.|     |  . .||||. .   |...|.|.  .     .   .|.| |... | |
Sbjct: 1805 --EGAVK----SKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQV 1858

Query:  757 KNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMT 816
            ..      | .         .  |.|||.  .||   .            .|| .|   |
Sbjct: 1859 EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRI-------NANRRKLQRELDEAT 1911

Query:  817 RENQVVHAEM 826
              |. .  |.
Sbjct: 1912 ESNEAMGREV 1921

>hg18||uc002ddx
        |16|NM_001040114|Q3MNF1|Q3MNF1_HUMAN|MYH11|NM_001040114|NP_001035203|sm
        ooth muscle myosin heavy chain 11 isoform

          Length = 1979

 Score =  114 bits (285), Expect = 7e-025
 Identities = 183/850 (21%), Positives = 355/850 (41%), Gaps = 113/850 (13%)

Query:   21 RQPLGTESLPLVEKLFNDLVHTTDSL---------RNAKLSVGK--TEKESRNVDALVEP 69
            .. || |    .| |  .|  | ||          |  ...| |   ..|.|. .| |. 
Sbjct: 1148 KRDLGEE----LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQE 1203

Query:   70 YRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYVHKVRC 129
             | ..|. | .  .  .|  | |   |.  . |.     |  |   |     .  || . 
Sbjct: 1204 MRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKK 1263

Query:  130 LEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAYPVTQP 189
            ||        ..|.|| |                   | | .... .           | 
Sbjct: 1264 LE-------AQVQELQSKCSDG--------------ERARAELNDKVHK--------LQN 1294

Query:  190 DDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKH-----LNTQVELRDQEIERLN 244
            .   |  .|  |.|.  .| .|.  |   |.. || ..      ||   .||  | ||  
Sbjct: 1295 EVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEER-- 1352

Query:  245 HALKGGRPHDVISLEAQNLSNEK*AGSVLDVQQIEYLQETNRTLEE---KVKGLQQRKED 301
                     | .  | .   | .   | |..|    | .. . |..    |. |.. |. 
Sbjct: 1353 -----NSLQDQLDEEMEAKQNLERHISTLNIQ----LSDSKKKLQDFASTVEALEEGKKR 1403

Query:  302 VSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEE 361
               |. ||. . .|       ..|   ||. . | ..   | . |      ..|.|  . 
Sbjct: 1404 FQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQL 1463

Query:  362 LEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEE--EKVRLQEKVDKAM 419
            | .    . .   | |  .   |       ||  |   .   .||  |     |. .| .
Sbjct: 1464 LAEEKNISSKYADERDRAEAEAR-------EKETKALSLARALEEALEAKEELERTNKML 1516

Query:  420 GAERELVLELESMRTKYG--VCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAAS 477
             || |   .| | .   |  |   |.|   |.  .  .. . .    | .     .    
Sbjct: 1517 KAEME---DLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLE 1573

Query:  478 PNLSPSRGRKTELLHALTERDELKAALKGLERRL----DEVQDTVKSLSTERDHLKMLLK 533
             |.   .|.    | |  |..| |   . |.|.|     |..|  |  .      | |  
Sbjct: 1574 VNMQALKGQFERDLQARDEQNEEKR--RQLQRQLHEYETELEDERKQRALAAAAKKKLEG 1631

Query:  534 VFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIE-ALMEKLKVTQTSALSDRQVE- 591
                 . | |  .   ..|   |.. .  ..    |.| |   . ..  |.  .... . 
Sbjct: 1632 DLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKS 1691

Query:  592 -ERRILDLESAVKSLERERLDQRSEVHLLKER-------REALEQELKSQSAAALQNAEE 643
             |  .. |.  . . || |     |   | |        | ||. | .   |   |  ||
Sbjct: 1692 LEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE 1751

Query:  644 VAQER----AESNALRILKEQMEQALSD--TQHRLSVKTNELHAAHETINK-LEDRLGEL 696
            . .|.    | |. .|   .| ||  ..  |.   . |        |  || |  .| |.
Sbjct: 1752 LEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEM 1811

Query:  697 SQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTV 756
               |.|     |  . .||||. .   |...|.|.  .     .   .|.| |... | |
Sbjct: 1812 --EGAVK----SKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQV 1865

Query:  757 KNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMT 816
            ..      | .         .  |.|||.  .||   .            .|| .|   |
Sbjct: 1866 EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRI-------NANRRKLQRELDEAT 1918

Query:  817 RENQVVHAEM 826
              |. .  |.
Sbjct: 1919 ESNEAMGREV 1928

>hg18||uc002ddy
        |16|NM_002474|P35749|MYH11_HUMAN|MYH11|NM_002474|NP_002465|smooth
        muscle myosin heavy chain 11 isoform

          Length = 1972

 Score =  114 bits (285), Expect = 7e-025
 Identities = 183/850 (21%), Positives = 355/850 (41%), Gaps = 113/850 (13%)

Query:   21 RQPLGTESLPLVEKLFNDLVHTTDSL---------RNAKLSVGK--TEKESRNVDALVEP 69
            .. || |    .| |  .|  | ||          |  ...| |   ..|.|. .| |. 
Sbjct: 1141 KRDLGEE----LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQE 1196

Query:   70 YRAENARIVRQNNDLHQQLLRQKEEKDRETRELKARVRKLDHEANDLKFLNNQYVHKVRC 129
             | ..|. | .  .  .|  | |   |.  . |.     |  |   |     .  || . 
Sbjct: 1197 MRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKK 1256

Query:  130 LEKDGKTKSERIQQLQEKNMQAVVQTPGGKKHSIPFRRQRMQIDELIPPAFTSAYPVTQP 189
            ||        ..|.|| |                   | | .... .           | 
Sbjct: 1257 LE-------AQVQELQSKCSDG--------------ERARAELNDKVHK--------LQN 1287

Query:  190 DDPYVADLLQLADGRIHELQEDIIKLRLDLENAQECVKH-----LNTQVELRDQEIERLN 244
            .   |  .|  |.|.  .| .|.  |   |.. || ..      ||   .||  | ||  
Sbjct: 1288 EVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEER-- 1345

Query:  245 HALKGGRPHDVISLEAQNLSNEK*AGSVLDVQQIEYLQETNRTLEE---KVKGLQQRKED 301
                     | .  | .   | .   | |..|    | .. . |..    |. |.. |. 
Sbjct: 1346 -----NSLQDQLDEEMEAKQNLERHISTLNIQ----LSDSKKKLQDFASTVEALEEGKKR 1396

Query:  302 VSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEE 361
               |. ||. . .|       ..|   ||. . | ..   | . |      ..|.|  . 
Sbjct: 1397 FQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQL 1456

Query:  362 LEDIVTTARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEE--EKVRLQEKVDKAM 419
            | .    . .   | |  .   |       ||  |   .   .||  |     |. .| .
Sbjct: 1457 LAEEKNISSKYADERDRAEAEAR-------EKETKALSLARALEEALEAKEELERTNKML 1509

Query:  420 GAERELVLELESMRTKYG--VCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAAS 477
             || |   .| | .   |  |   |.|   |.  .  .. . .    | .     .    
Sbjct: 1510 KAEME---DLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLE 1566

Query:  478 PNLSPSRGRKTELLHALTERDELKAALKGLERRL----DEVQDTVKSLSTERDHLKMLLK 533
             |.   .|.    | |  |..| |   . |.|.|     |..|  |  .      | |  
Sbjct: 1567 VNMQALKGQFERDLQARDEQNEEKR--RQLQRQLHEYETELEDERKQRALAAAAKKKLEG 1624

Query:  534 VFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIE-ALMEKLKVTQTSALSDRQVE- 591
                 . | |  .   ..|   |.. .  ..    |.| |   . ..  |.  .... . 
Sbjct: 1625 DLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKS 1684

Query:  592 -ERRILDLESAVKSLERERLDQRSEVHLLKER-------REALEQELKSQSAAALQNAEE 643
             |  .. |.  . . || |     |   | |        | ||. | .   |   |  ||
Sbjct: 1685 LEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE 1744

Query:  644 VAQER----AESNALRILKEQMEQALSD--TQHRLSVKTNELHAAHETINK-LEDRLGEL 696
            . .|.    | |. .|   .| ||  ..  |.   . |        |  || |  .| |.
Sbjct: 1745 LEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEM 1804

Query:  697 SQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTV 756
               |.|     |  . .||||. .   |...|.|.  .     .   .|.| |... | |
Sbjct: 1805 --EGAVK----SKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQV 1858

Query:  757 KNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMT 816
            ..      | .         .  |.|||.  .||   .            .|| .|   |
Sbjct: 1859 EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRI-------NANRRKLQRELDEAT 1911

Query:  817 RENQVVHAEM 826
              |. .  |.
Sbjct: 1912 ESNEAMGREV 1921

>hg18||uc001azt
        |1|NM_014675|Q5TZA2|CROCC_HUMAN|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 2017

 Score =  114 bits (283), Expect = 1e-024
 Identities = 183/807 (22%), Positives = 329/807 (40%), Gaps = 70/807 (8%)

Query:  345 LQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEKN---------- 394
            | . . ..|  .   |  .|.. | |.  |... |.  | |||  |..|           
Sbjct:  528 LHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDA 587

Query:  395 ----EKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDA 450
                ...     |.  ||  |   .  |     ||  | | ..       |.|       
Sbjct:  588 QREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRD------ 641

Query:  451 FVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALTE-RDELKAAL---KG 506
                ||.|..   |.  | ||    .   |    |... |   | | |. |  |      
Sbjct:  642 ---RLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDM 698

Query:  507 LERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQM 566
            |.    || . .      |  |.. .      .|     |.|    .  | | .| . ..
Sbjct:  699 LQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRL 758

Query:  567 SAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKERREAL 626
             |..|     |.  |  |  .  |       ||      |  |      . . .. .|||
Sbjct:  759 VAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEAL 818

Query:  627 EQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETI 686
            ||.| .      |  |..||    |  |   ....|||  . | ..        || |  
Sbjct:  819 EQQLPTLRHERSQLQEQLAQ---LSRQLSGREQELEQARREAQRQVEALE---RAAREKE 872

Query:  687 NKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKE 746
               ..  |   |  .  .|    |      |  ||. |.  . .   .| .|.    . |
Sbjct:  873 ALAKEHAGLAVQLVAAEREG-RTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLE 931

Query:  747 KVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQL------DACQEELAALXXXXXX 800
               . . |  . |   |  |.  . . . |  || ..|       | .|  |.|      
Sbjct:  932 AEGQALLLAKETLTGELAGLRQQIIATQ-EKASLDKELMAQKLVQAEREAQASLREQRAA 990

Query:  801 XXXXXXRLQDDLTTMTRENQVVHAEMEDVL-HERDELKLRVHSYIIEVS-KIEKLVAAKA 858
                  ||| .     || .   |...  |  |..||  |. .   |.| .|  |   . 
Sbjct:  991 HEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERD 1050

Query:  859 RGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSIN 918
             |    | |    |.   .  ||     .||        .| ||.       || ||. .
Sbjct: 1051 EGLLLAESEKQQALS---LKESEKTALSEKLMGTRHSLATISLEM------ERQKRDAQS 1101

Query:  919 NKEKE------IQQHIQALQAY-EGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRE 971
             .|..      .   .. |.|  |   .. |. . ||.|.     . . | | .   .| 
Sbjct: 1102 RQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRT 1161

Query:  972 LCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAELLKKQLAGERLTVRNLESLLSA 1031
                |.  ..   |.|      .       |  | ||  |.. | ||    |  |.|  .
Sbjct: 1162 QLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSL-GEGAKER--EALRRS 1218

Query: 1032 NRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTRDVTQLQGKVSQLETEMDVLRRQ 1091
            | .     . | .||   |||  .        .||  |  | .  .  .| | .  . | 
Sbjct: 1219 NEELRSAVKKAESER-ISLKLANEDKE-QKLALLEEAR--TAVGKEAGELRTGLQEVER- 1273

Query: 1092 LTTERFERERAVQEMRRQGVSLSSLHT 1118
                | |  | .||.|||   | | .|
Sbjct: 1274 ---SRLEARRELQELRRQMKMLDSENT 1297

>hg18||uc002szg
        |2|NM_025244|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|NP_079520|testis
        specific, 10

          Length = 698

 Score =  99 bits (246), Expect = 2e-020
 Identities = 116/548 (21%), Positives = 225/548 (41%), Gaps = 43/548 (7%)

Query:  488 TELLHALTERDELKAALK-----------GLERRLDEVQDTVKSLSTER----DHLKMLL 532
            |.|    |||| |.  ||            ||.|..|.. || .|  ||     .. .. 
Sbjct:  110 TDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMK 169

Query:  533 KVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDR---Q 589
            .     . .      |  |   .| . .     .    |   . |  ||      .   |
Sbjct:  170 ETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQ 229

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHL-------LKERREALEQELKSQSAAALQNAE 642
            . . .|. |.  . .  |. . || |. .       | . .| |.  |  .|       |
Sbjct:  230 LTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGE 289

Query:  643 EVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSV 702
             .| .    . .. .  .||||       | |   ..      ...  | | ....   .
Sbjct:  290 SLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDI 349

Query:  703 HKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESS 762
               |   ||   |   .|   |  ...    .| .....       .  ..  .|. || 
Sbjct:  350 LAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESE 409

Query:  763 LLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRE-NQV 821
              |.   |     .  .   .    . .   |            ||.. . .. ||  | 
Sbjct:  410 NRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQH 469

Query:  822 VHAEMEDVLHERDELKLRVHSYIIEVSKI--EKLVAAKARGNTRPEQENLD----LLNRF 875
            ..||      .   |   |     |. |.  ||. |     .||     ||    |||| 
Sbjct:  470 LNAE-RSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQ 528

Query:  876 RMA-HSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRD-SINNKEKEIQQHIQALQA 933
             .|   |.|  | .|  |      .| .. .     . |    . |..|| |  | ||| 
Sbjct:  529 LVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQI-ALQE 587

Query:  934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMD 993
             | ..         |.| |  |.        |.|  | .  .|..  ..| ||| |   .
Sbjct:  588 KESEI-------QLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFE 640

Query:  994 VERVTAEL 1001
             ||   ||
Sbjct:  641 RERAVQEL 648

>hg18||uc002szi
        |2|BX647157|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_025244|NP_079520|testis
        specific, 10

          Length = 698

 Score =  99 bits (246), Expect = 2e-020
 Identities = 116/548 (21%), Positives = 225/548 (41%), Gaps = 43/548 (7%)

Query:  488 TELLHALTERDELKAALK-----------GLERRLDEVQDTVKSLSTER----DHLKMLL 532
            |.|    |||| |.  ||            ||.|..|.. || .|  ||     .. .. 
Sbjct:  110 TDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMK 169

Query:  533 KVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDR---Q 589
            .     . .      |  |   .| . .     .    |   . |  ||      .   |
Sbjct:  170 ETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQ 229

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHL-------LKERREALEQELKSQSAAALQNAE 642
            . . .|. |.  . .  |. . || |. .       | . .| |.  |  .|       |
Sbjct:  230 LTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGE 289

Query:  643 EVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSV 702
             .| .    . .. .  .||||       | |   ..      ...  | | ....   .
Sbjct:  290 SLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDI 349

Query:  703 HKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESS 762
               |   ||   |   .|   |  ...    .| .....       .  ..  .|. || 
Sbjct:  350 LAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESE 409

Query:  763 LLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRE-NQV 821
              |.   |     .  .   .    . .   |            ||.. . .. ||  | 
Sbjct:  410 NRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQH 469

Query:  822 VHAEMEDVLHERDELKLRVHSYIIEVSKI--EKLVAAKARGNTRPEQENLD----LLNRF 875
            ..||      .   |   |     |. |.  ||. |     .||     ||    |||| 
Sbjct:  470 LNAE-RSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQ 528

Query:  876 RMA-HSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRD-SINNKEKEIQQHIQALQA 933
             .|   |.|  | .|  |      .| .. .     . |    . |..|| |  | ||| 
Sbjct:  529 LVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQI-ALQE 587

Query:  934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMD 993
             | ..         |.| |  |.        |.|  | .  .|..  ..| ||| |   .
Sbjct:  588 KESEI-------QLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFE 640

Query:  994 VERVTAEL 1001
             ||   ||
Sbjct:  641 RERAVQEL 648

>hg18||uc002szh
        |2|NM_182911|Q9BZW7|Q9BZW7_HUMAN|TSGA10|NM_182911|NP_878915|testis
        specific, 10

          Length = 698

 Score =  99 bits (244), Expect = 4e-020
 Identities = 115/548 (20%), Positives = 225/548 (41%), Gaps = 43/548 (7%)

Query:  488 TELLHALTERDELKAALK-----------GLERRLDEVQDTVKSLSTER----DHLKMLL 532
            |.|    |||| |.  ||            ||.|..|.. || .|  ||     .. .. 
Sbjct:  110 TDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMK 169

Query:  533 KVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDR---Q 589
            .     . .      |  |   .| . .     .    |   . |  ||      .   |
Sbjct:  170 ETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQ 229

Query:  590 VEERRILDLESAVKSLERERLDQRSEVHL-------LKERREALEQELKSQSAAALQNAE 642
            . . .|. |.  . .  |. . || |. .       | . .| ..  |  .|       |
Sbjct:  230 LTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECMQACLDKKSENIASLGE 289

Query:  643 EVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSV 702
             .| .    . .. .  .||||       | |   ..      ...  | | ....   .
Sbjct:  290 SLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDI 349

Query:  703 HKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESS 762
               |   ||   |   .|   |  ...    .| .....       .  ..  .|. || 
Sbjct:  350 LAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESE 409

Query:  763 LLQLQGALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRE-NQV 821
              |.   |     .  .   .    . .   |            ||.. . .. ||  | 
Sbjct:  410 NRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQH 469

Query:  822 VHAEMEDVLHERDELKLRVHSYIIEVSKI--EKLVAAKARGNTRPEQENLD----LLNRF 875
            ..||      .   |   |     |. |.  ||. |     .||     ||    |||| 
Sbjct:  470 LNAE-RSYKSQISTLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQ 528

Query:  876 RMA-HSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRD-SINNKEKEIQQHIQALQA 933
             .|   |.|  | .|  |      .| .. .     . |    . |..|| |  | ||| 
Sbjct:  529 LVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQI-ALQE 587

Query:  934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMD 993
             | ..         |.| |  |.        |.|  | .  .|..  ..| ||| |   .
Sbjct:  588 KESEI-------QLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFE 640

Query:  994 VERVTAEL 1001
             ||   ||
Sbjct:  641 RERAVQEL 648

>hg18||uc001orn |11|Z14227|Q59HB8|Q59HB8_HUMAN|NUMA1|NM_006185|NP_006176|nuclear
        mitotic apparatus protein 1

          Length = 1326

 Score =  96 bits (238), Expect = 2e-019
 Identities = 142/644 (22%), Positives = 258/644 (40%), Gaps = 55/644 (8%)

Query:  494 LTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDAS 553
            | ||   .   . |   . ..| .. .||  .. |.         ||      |.    .
Sbjct:   14 LAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQA------SQAHGARLTAQVASLT 67

Query:  554 GDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQR 613
             .|     ||||   |.  | .. |  |       | .|.    |   |. |      . 
Sbjct:   68 SELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLRHQVEQLSSSLKQKE 127

Query:  614 SEVHLLKERREALEQELKSQSAAALQNAEEVAQER-AESNALRILKEQMEQALSDTQHRL 672
             ..  . |..||  |.   | | | .  |   .|| |    |  |...    |   | .|
Sbjct:  128 QQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALEKEKAAKLEILQQQL 187

Query:  673 SVKTNELHAAHETINKLEDRLGELSQH-------GSVHKEDLSALQRSIAALDREKDVLQ 725
             |      .|  .. . .    |||.            ...    |  .| |. .   |.
Sbjct:  188 QVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQAQVAELELQ---LR 244

Query:  726 DEVDQKTEKLFELQEENSKKEK---VLEDVRLTVKNLESSLLQLQGALNSREREIGSLRR 782
             |  . |||    ||..  .|.   . | ...|  .||    .   ||  ..| |  |. 
Sbjct:  245 SEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAADALEEQQRCISELKA 304

Query:  783 QLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLRVHS 842
            .  .  |.                 |.  |  .   .|   || | .  |  |     |.
Sbjct:  305 ETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQ---AETEVLRRELAEAMAAQHT 361

Query:  843 YIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR----MAHSEVEEHEQKLQQAE----G 894
               |  .. | |||        .||       |.        | |.  |.||.|.    |
Sbjct:  362 AESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKEECEKARQELQEAKEKVAG 421

Query:  895 LNNSIRLELLSSDTERRQLR-------DSINNKEKEIQQHIQALQAYEGQLSSLARAMSR 947
            . .   |..     |  .|          .  ||   |.    |   . .... .. ..|
Sbjct:  422 IESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLSTLQEKMAATSKEVAR 481

Query:  948 LEEELHKAQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||  . || | . .   .|  |.|     |   |    |   .    .   | |. .  |
Sbjct:  482 LETLVRKAGEQQETASREL--VKEPARAGDRQPEWLEEQQGRQFCSTQ---AALQAMERE 536

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATERE-AELKLLRDRLNFADSKILE 1066
            || .  .|  |||    .||      | . | .    ||| | |   | |   ||  . .
Sbjct:  537 AEQMGNEL--ERLRAALMES------QGQQQEERGQQEREVARLTQERGRAQ-ADLALEK 587

Query: 1067 HTRDVTQ--LQGKVSQLETEMDVLRRQLTTERFERERAVQEMRR 1108
              |   .  ||  ...   |   |.  |     |.|   ||. .
Sbjct:  588 AARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAK 631

>hg18||uc002xcn
        |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_001035518|NP_001030595|cen
        trosomal protein 2 isoform 2

          Length = 2386

 Score =  93 bits (230), Expect = 2e-018
 Identities = 100/462 (21%), Positives = 206/462 (44%), Gaps = 33/462 (7%)

Query: 455 LEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTEL---LH-ALTERDELKAALKGLERR 510
           | |. .   ||| | |||          ..|.| |    || |. ||. |.  | ||| .
Sbjct: 475 LRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAK 534

Query: 511 LDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEI 570
             |    . .|    .   .  ..    | .    ||. . .  .|  .| |..   |..
Sbjct: 535 QSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADL 594

Query: 571 EALMEKLKVTQTSALSDRQVEERRILDLE-------SAVKSLERERLDQRSEVHLLKERR 623
            |   ||     .   |.    ...| ||       | ... |. |   . ..   ..||
Sbjct: 595 RAAAVKLSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRR 654

Query: 624 EALEQELKSQSAAALQNAEEVAQE-RAESNALRILKEQMEQALSDTQHRLSVKTNELHAA 682
           |||  |  .   | || |||   | .|.   ..  ||.... ||...|.    | .|   
Sbjct: 655 EAL-WEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQL 713

Query: 683 HETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEV-------DQKTEKL 735
           |.   . |. |    |       . .||.  . |..|..  | ...       .     |
Sbjct: 714 HQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSL 773

Query: 736 FELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQLDACQEELAALX 795
           || |..||  |     . . .. .  .   .|| .   . |. . | | .  ||  ||  
Sbjct: 774 FEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAE--QERDAAAR 831

Query: 796 XXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERD-----ELKLRVHSYIIEVSKI 850
                       |.       .|   .  .   .  |..     |  |.    . . |. 
Sbjct: 832 QLAQAEQEGKTALEQQKAAHEKEVNQLREKWMQLETEKERVSLLETLLQTQKELADASQQ 891

Query: 851 EKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQA 892
            . .    .     |||   .|       ....| ...|..|
Sbjct: 892 LERLRQDMKVQKLKEQETTGIL------QTQLQEAQRELKEA 927

>hg18||uc001eyj |1|NM_020770|Q9P2M7|CING_HUMAN|CGN|NM_020770|NP_065821|cingulin

          Length = 1203

 Score =  92 bits (228), Expect = 3e-018
 Identities = 160/795 (20%), Positives = 307/795 (38%), Gaps = 72/795 (9%)

Query:  389 GLKEKNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGR-----ER 443
            |  |   |.| .   ..||  . |.     .| ||.|  . |       .  |     ..
Sbjct:  360 GQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLERRKGEAQQ 419

Query:  444 SPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALTERDELKAA 503
            |   |    | |.|  |       .   ..        |   ..  |   |  |. |.  
Sbjct:  420 SNKELQNMKRLLDQGEDLRHGLETQVMELQNKLKHVQGPEPAKEVLLKDLLETRELLEEV 479

Query:  504 LKGLER-----RLDE---------VQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKT 549
            |.| .|     || |         ... | |   | .|..       . .  | ||    
Sbjct:  480 LEGKQRVEEQLRLRERELTALKGALKEEVASRDQEVEHVRQQ-----YQRDTEQLR-RSM 533

Query:  550 KDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERER 609
            .||. |    |   |.||| .  |  .|. |       . . ..   || .  . | . |
Sbjct:  534 QDATQDHAVLEAERQKMSALVRGLQRELEETSEETGHWQSMFQKNKEDLRATKQELLQLR 593

Query:  610 LDQRSEVHLLKERREALEQELKSQSAAALQNAE------EVAQERAESNALRILKEQMEQ 663
            ...      | |. | |..||.   |.|    .      |. . . |   |.  ..  | 
Sbjct:  594 MEKEEMEEELGEKIEVLQRELEQARASAGDTRQVEVLKKELLRTQEELKELQAERQSQEV 653

Query:  664 ALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDV 723
            |       |  .   |    .   .||..  .| .     ..|     ..    . |  |
Sbjct:  654 AGRHRDRELEKQLAVLRVEADRGRELEEQNLQLQKTLQQLRQDCEEASKAKMVAEAEATV 713

Query:  724 LQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQ 783
            |          | | ||||       .. |  .  ||  | . .| ..  |     || .
Sbjct:  714 LGQRRAAVETTLRETQEEN-------DEFRRRILGLEQQLKETRGLVDGGEAVEARLRDK 766

Query:  784 LDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDEL--KLRVH 841
            |   . |   |              |..  ..    . . | .|.       |  . .  
Sbjct:  767 LQRLEAEKQQLEEALNAS-------QEEEGSLAAAKRALEARLEEAQRGLARLGQEQQTL 819

Query:  842 SYIIEVSKIEKLVAAKARGNTRPEQENLD-LLNRFRMAHSEV-EEHEQKLQ----QAEGL 895
            .  .|    .. |  . .     ..  ||  ..|      .. |. .| ||    | |  
Sbjct:  820 NRALEEEGKQREVLRRGKAELEEQKRLLDRTVDRLNKELEKIGEDSKQALQQLQAQLEDY 879

Query:  896 NNSIRLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLEEELHKA 955
                | |.  .   .|| .|  .  ||        |   . ..  | .|.   . |   |
Sbjct:  880 KEKARREVADA---QRQAKDWASEAEKT----SGGLSRLQDEIQRLRQALQASQAERDTA 932

Query:  956 QEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAELLKKQL 1015
            . ||  |   |  . .        ..  ||||      | |.  ||.. .   |||  ..
Sbjct:  933 RLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEEKVSRLETELDEEKNTVELLTDRV 992

Query: 1016 AGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTRDVTQLQ 1075
               |  |  | . |   |      .      | . | |. ||  ..           .  
Sbjct:  993 NRGRDQVDQLRTELMQERSARQDLECDKISLERQNKDLKTRLASSEG--------FQKPS 1044

Query: 1076 GKVSQLETEMDVLRRQLTTERFERERAVQEMRRQGVSLSSLHTPTSLNVSGSPHHVSPDH 1135
              .||||..  .|. .|  |  |||. | .   .   |       |. .     ||.   
Sbjct: 1045 ASLSQLESQNQLLQERLQAE--EREKTVLQSTNR--KLERKVKELSIQIEDERQHVNDQK 1100

Query: 1136 SILRSVTRSADKSAD 1150
              |    ..  .  |
Sbjct: 1101 DQLSLRVKALKRQVD 1115

>hg18||uc001orl
        |11|NM_006185|Q14980|NUMA1_HUMAN|NUMA1|NM_006185|NP_006176|nuclear
        mitotic apparatus protein 1

          Length = 2115

 Score =  89 bits (218), Expect = 4e-017
 Identities = 109/513 (21%), Positives = 207/513 (40%), Gaps = 40/513 (7%)

Query: 480 LSPSRGRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQ 539
           |   ||..   |  | ||   .   . |   . ..| .. .||  .. |.         |
Sbjct: 439 LETERGQQEAKL--LAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQA------SQ 490

Query: 540 AQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLE 599
           |      |.    . .|     ||||   |.  | .. |  |       | .|.    | 
Sbjct: 491 AHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLR 550

Query: 600 SAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQER-AESNALRILK 658
             |. |      .  ..  . |..||  |.   | | | .  |   .|| |    |  |.
Sbjct: 551 HQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALE 610

Query: 659 EQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQH-------GSVHKEDLSALQ 711
           ..    |   | .| |      .|  .. . .    |||.            ...    |
Sbjct: 611 KEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQ 670

Query: 712 RSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEK---VLEDVRLTVKNLESSLLQLQG 768
             .| |. .   |. |  . |||    ||..  .|.   . | ...|  .||    .   
Sbjct: 671 AQVAELELQ---LRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAAD 727

Query: 769 ALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMED 828
           ||  ..| |  |. .  .  |.                 |.  |  .   .|   || | 
Sbjct: 728 ALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQ---AETEV 784

Query: 829 VLHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR----MAHSEVEE 884
           .  |  |     |.   |  .. | |||        .||       |.        | |.
Sbjct: 785 LRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKEECEK 844

Query: 885 HEQKLQQAE----GLNNSIRLELLSSDTERRQLR-------DSINNKEKEIQQHIQALQA 933
             |.||.|.    |. .   |..     |  .|          .  ||   |.    |  
Sbjct: 845 ARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLST 904

Query: 934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDL 966
            . .... .. ..|||  . || | . .   .|
Sbjct: 905 LQEKMAATSKEVARLETLVRKAGEQQETASREL 937

>hg18||uc001orm |11|Z11584|Q14980-2|Q14980-2|NUMA1|NM_006185|NP_006176|nuclear
        mitotic apparatus protein 1

          Length = 2101

 Score =  89 bits (218), Expect = 4e-017
 Identities = 109/513 (21%), Positives = 207/513 (40%), Gaps = 40/513 (7%)

Query: 480 LSPSRGRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQ 539
           |   ||..   |  | ||   .   . |   . ..| .. .||  .. |.         |
Sbjct: 439 LETERGQQEAKL--LAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQA------SQ 490

Query: 540 AQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLE 599
           |      |.    . .|     ||||   |.  | .. |  |       | .|.    | 
Sbjct: 491 AHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLR 550

Query: 600 SAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQER-AESNALRILK 658
             |. |      .  ..  . |..||  |.   | | | .  |   .|| |    |  |.
Sbjct: 551 HQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALE 610

Query: 659 EQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQH-------GSVHKEDLSALQ 711
           ..    |   | .| |      .|  .. . .    |||.            ...    |
Sbjct: 611 KEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQ 670

Query: 712 RSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEK---VLEDVRLTVKNLESSLLQLQG 768
             .| |. .   |. |  . |||    ||..  .|.   . | ...|  .||    .   
Sbjct: 671 AQVAELELQ---LRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAAD 727

Query: 769 ALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMED 828
           ||  ..| |  |. .  .  |.                 |.  |  .   .|   || | 
Sbjct: 728 ALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQ---AETEV 784

Query: 829 VLHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR----MAHSEVEE 884
           .  |  |     |.   |  .. | |||        .||       |.        | |.
Sbjct: 785 LRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKEECEK 844

Query: 885 HEQKLQQAE----GLNNSIRLELLSSDTERRQLR-------DSINNKEKEIQQHIQALQA 933
             |.||.|.    |. .   |..     |  .|          .  ||   |.    |  
Sbjct: 845 ARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLST 904

Query: 934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDL 966
            . .... .. ..|||  . || | . .   .|
Sbjct: 905 LQEKMAATSKEVARLETLVRKAGEQQETASREL 937

>hg18||uc001oro |11|BC103765|NA|NA|NUMA1|NM_006185|NP_006176|nuclear mitotic
        apparatus protein 1

          Length = 1536

 Score =  89 bits (218), Expect = 4e-017
 Identities = 109/513 (21%), Positives = 207/513 (40%), Gaps = 40/513 (7%)

Query: 480 LSPSRGRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQ 539
           |   ||..   |  | ||   .   . |   . ..| .. .||  .. |.         |
Sbjct: 439 LETERGQQEAKL--LAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQA------SQ 490

Query: 540 AQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLE 599
           |      |.    . .|     ||||   |.  | .. |  |       | .|.    | 
Sbjct: 491 AHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLR 550

Query: 600 SAVKSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQER-AESNALRILK 658
             |. |      .  ..  . |..||  |.   | | | .  |   .|| |    |  |.
Sbjct: 551 HQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALE 610

Query: 659 EQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQH-------GSVHKEDLSALQ 711
           ..    |   | .| |      .|  .. . .    |||.            ...    |
Sbjct: 611 KEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQ 670

Query: 712 RSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEK---VLEDVRLTVKNLESSLLQLQG 768
             .| |. .   |. |  . |||    ||..  .|.   . | ...|  .||    .   
Sbjct: 671 AQVAELELQ---LRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAAD 727

Query: 769 ALNSREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMED 828
           ||  ..| |  |. .  .  |.                 |.  |  .   .|   || | 
Sbjct: 728 ALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQ---AETEV 784

Query: 829 VLHERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR----MAHSEVEE 884
           .  |  |     |.   |  .. | |||        .||       |.        | |.
Sbjct: 785 LRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKEECEK 844

Query: 885 HEQKLQQAE----GLNNSIRLELLSSDTERRQLR-------DSINNKEKEIQQHIQALQA 933
             |.||.|.    |. .   |..     |  .|          .  ||   |.    |  
Sbjct: 845 ARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLST 904

Query: 934 YEGQLSSLARAMSRLEEELHKAQEDKTSLLSDL 966
            . .... .. ..|||  . || | . .   .|
Sbjct: 905 LQEKMAATSKEVARLETLVRKAGEQQETASREL 937

>hg18||uc002gmk
        |17|NM_003802|Q9UKX3|MYH13_HUMAN|MYH13|NM_003802|NP_003793|myosin,
        heavy polypeptide 13, skeletal muscle

          Length = 1938

 Score =  88 bits (217), Expect = 5e-017
 Identities = 119/531 (22%), Positives = 231/531 (43%), Gaps = 34/531 (6%)

Query:  276 QQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLAKRLE---- 331
            |...  .|   |   |   |.. |. .  || .|    .        .||  .  .    
Sbjct: 1399 QRLQEAEENTETANSKCASLEKTKQRLQGEVEDLMRDLERSHTACATLDKKQRNFDKVLA 1458

Query:  332 -----MDKDRV-LETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLRE 385
                 .|. .  || |  | .    || . .   ||. | . | ||       |   | |
Sbjct: 1459 EWKQKLDESQAELEAAQKESRSLSTELFKMRNAYEEVVDQLETLRRENKNLQEEISDLTE 1518

Query:  386 QLLGLKEKNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSP 445
            |.    .  .. |    |||.||  ||  ...  |.     || |  .         .  
Sbjct: 1519 QIAETGKNLQEAEKTKKLVEQEKSDLQVALEEVEGS-----LEHEESKILRVQLELSQVK 1573

Query:  446 SRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALT-ERDELKAAL 504
            | ||  |   ..| .  .. ..|      .       ||     |   .  . .|..  |
Sbjct: 1574 SELDRKVIEKDEEIEQLKRNSQRAAEALQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQL 1633

Query:  505 KGLERRLDEVQDTVKSLSTERDHLK-MLLKVFFFPQAQEDLR--LAKTKDASGDLKQAEL 561
                |.. | |   | | | .  ||   | .    .. |||.  ||  .  .| | . ||
Sbjct: 1634 GHSNRQMAETQ---KHLRTVQGQLKDSQLHLDDALRSNEDLKEQLAIVERRNGLLLE-EL 1689

Query:  562 TIQQMSAEIEALMEKLKVTQTSALSDR-QVEERRILDLESAVKSLERERLDQRSEV-HLL 619
               ... |      .|   .    ||| |.   .   | .  | || .    ..|| . .
Sbjct: 1690 EEMKVALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEADIAQCQAEVENSI 1749

Query:  620 KERREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRL-SVKTNE 678
            .| | | |.  |. . ||.  |||. .|.  |  |  .|. .|| . | ||||   .   
Sbjct: 1750 QESRNAEEKAKKAITDAAMM-AEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLA 1808

Query:  679 LHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFEL 738
            |    . | |||.|. ||     | ..  .   .     .|.   .  . ..  . .  |
Sbjct: 1809 LKGGKKQIQKLENRVRELENELDVEQKRGAEALKGAHKYERKVKEMTYQAEEDHKNILRL 1868

Query:  739 QEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQLDACQE 789
            |.       ... ..  ||. .    . .   |..      .. .|.   |
Sbjct: 1869 QD-------LVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAAE 1912

>hg18||uc002gmq |17|NM_002470|P11055|MYH3_HUMAN|MYH3|NM_002470|NP_002461|myosin,
        heavy chain 3, skeletal muscle,

          Length = 1940

 Score =  87 bits (215), Expect = 9e-017
 Identities = 108/501 (21%), Positives = 209/501 (41%), Gaps = 49/501 (9%)

Query:  275 VQQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHI-------DKLA 327
            .|. | |.|  . | ....  ... | |. . |.|    | |  |.  .       . ||
Sbjct: 1381 IQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLA 1440

Query:  328 KRLEMDK---DRVLETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLR 384
              |.  .   |.||    |. .|.. ||.   |    |   .   . |  ||  . | ..
Sbjct: 1441 AALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK 1500

Query:  385 EQLLGLKEK-----NEKMEGVVTLVEEEKVRLQEKVDKA----MGAERELVLELESMRTK 435
             .   |...      .  |   |. | || | | ...||       | |  || |  .  
Sbjct: 1501 RENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEAALEHEEAKIL 1560

Query:  436 YGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALT 495
                   .  | .|  .   ..| .  ..  .|      .|      ||     |   . 
Sbjct: 1561 RIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQSALDAEVRSRNEAIRLKKKME 1620

Query:  496 -ERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASG 554
             . .|..  |    |   .  .|.| | . .  ||              | |        
Sbjct: 1621 GDLNEIEIQLSHANR---QAAETLKHLRSVQGQLK-----------DTQLHLDDALRGQE 1666

Query:  555 DLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAV------------ 602
            |||.    ... .  ..| .|.|. |       |.. |. .||    |            
Sbjct: 1667 DLKEQLAIVERRANLLQAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIH 1726

Query:  603 --KSLERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQ 660
              | || . .  .|||          |.. |     |   |||. .|.  |  |  .|. 
Sbjct: 1727 TKKKLETDLMQLQSEVEDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKN 1786

Query:  661 MEQALSDTQHRL-SVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDR 719
            .|| . | ||||   .   |    . | ||| |. ||       ..  .   . .   .|
Sbjct: 1787 LEQTVKDLQHRLDEAEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYER 1846

Query:  720 EKDVLQDEVDQKTEKLFELQE 740
                |  . ..  . .  ||.
Sbjct: 1847 RVKELTYQSEEDRKNVLRLQD 1867

>hg18||uc003ulf
        |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP_671714|A-kinase
        anchor protein 9 isoform 3

          Length = 3899

 Score =  87 bits (214), Expect = 1e-016
 Identities = 137/617 (22%), Positives = 273/617 (44%), Gaps = 45/617 (7%)

Query:  195 ADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNT---QVELRDQEIERLNHALK--G 249
            ||   | . .| |  . | .|  .|  |   .. |     |..   . . |   |.|   
Sbjct: 1928 ADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQKEAMKAEA 1987

Query:  250 GRPHDVISLEAQNLSNEK*AGSVLDVQ-QIEYLQETNRTLEEKVKGLQQRKEDVSTEVAN 308
            |     .  | . |  ||     |.|| | | ...    |...|| |.    ||  .|. 
Sbjct: 1988 GPVEQQLLQETEKLMKEK-----LEVQCQAEKVRD---DLQKQVKALE---IDVEEQVSR 2036

Query:  309 LSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELEDIVTT 368
                 ||   ||  . .  . ||   ... .  | .  . . |    |. |..||  .  
Sbjct: 2037 FIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKV 2096

Query:  369 ARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEK---VDKAMGAEREL 425
              | |  .. .   . .    |||| .|   ..   |. .  .||.   ..|     |||
Sbjct: 2097 VPRFQPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVREL 2156

Query:  426 VLELESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRG 485
               |     |.   |   .   |   |. |. |||   .. .    .             
Sbjct: 2157 EQALLVEDRKH--FGAVEAKPELSLEVQ-LQAERDAIDRKEKEITNLEEQLEQFREELEN 2213

Query:  486 RKTEL--LHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQED 543
            .  |.  ||      .|.   |    || |..   |    . . | . .|      . .|
Sbjct: 2214 KNEEVQQLHM-----QLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKE-SDAMSTQD 2267

Query:  544 LRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVK 603
              .   | |   ... |. | |.. ..  | ..||.|  . . . . |   | |||. ..
Sbjct: 2268 QHVLFGKFAQ-IIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNE--LIRDLETQIE 2324

Query:  604 SL----ERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQE----RAESNALR 655
             |    |  . ..  |.  | |  | |.||| .       ||  ...|    . . . . 
Sbjct: 2325 CLMSDQECVKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDVVI 2384

Query:  656 ILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSI- 714
              |  .|| .      ..   | |   .  .|.|   |  | .     ..  |  . |. 
Sbjct: 2385 AEKLALEQQVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENSVN 2444

Query:  715 AALDR-EKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSR 773
             |.|   ||  . ||   ||   .  |  .  .   |. . .. |||. ||||.  ....
Sbjct: 2445 VAIDHLSKDKPELEV-VLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVSAK 2503

Query:  774 EREIGSLRRQLDACQEE 790
            . |.    .|.   ||.
Sbjct: 2504 DLELTQCYKQIKDMQEQ 2520

>hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP_003557|early
        endosome antigen 1, 162kD

          Length = 1411

 Score =  87 bits (213), Expect = 2e-016
 Identities = 145/686 (21%), Positives = 294/686 (42%), Gaps = 110/686 (16%)

Query:  207 ELQEDIIKLRLDLENAQECVKHLNTQVELRDQ-------EIERLNHAL-----KGGRPHD 254
            .|.|.. ..    .. .   | |  | | ..|       || .|.  |     . |  | 
Sbjct:  376 KLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHG 435

Query:  255 VISLEAQNLSNEK*AGSVLD-VQQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKN 313
             .  | . ||.||    ..|  ||.  ||     |||..|       ..  ..     ..
Sbjct:  436 RLK-EQRQLSSEK----LMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQH 490

Query:  314 QE-----------LCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEEL 362
            ||           | |    .... ...  |||. ..  .  ||..|. .   .|   | 
Sbjct:  491 QEQQALQQSTTAKLREAQNDLEQVLRQIG-DKDQKIQNLEALLQKSKENISLLEK---ER 546

Query:  363 EDIVTTARRAQSEADFEKEL------LREQLLGLKEK--------NEKMEGVVTLVEEEK 408
            ||.    .  . |     .|      |.||.  | ||         .  | .   |.|.|
Sbjct:  547 EDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQK 606

Query:  409 VRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDAFVRS-----LEQERDYYR 463
              |.   |. .  |   | || |   .      .   |.||  ...     |  |     
Sbjct:  607 AHLRAAQDRVLSLETS-VNELNSQLNE-----SKEKVSQLDIQIKAKTELLLSAEAAKTA 660

Query:  464 QEAERHRRVRGAASPNLSPSRGRKTELLHALTERDELKAALKG-------LERRLDEVQD 516
            | |.    .  |     .  . .. ||    |. |.. | |.        ||  | | ..
Sbjct:  661 QRADLQNHLDTAQ----NALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKE 716

Query:  517 TVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEK 576
               ||  . . |.  .|     .|      |  . |  ||.|     .|.. ..|     
Sbjct:  717 KYLSLEQKTEELEGQIKKL---EADSLEVKASKEQALQDLQQQ----RQLNTDLE----- 764

Query:  577 LKVTQTSAL--SDRQVEERRILDLE---SAVKSLERERLDQRSEVHLLKERREALEQELK 631
            |. |. |     ....     |||.    |..|....   |  |  .||.  | | || |
Sbjct:  765 LRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKQILKQDFETLSQETK 824

Query:  632 SQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLED 691
             |         |    | ..    . | .||.    |.  ||   ..|    ...   . 
Sbjct:  825 IQ--------HEELNNRIQTTVTELQKVKMEKEALMTE--LSTVKDKLSKVSDSLKNSKS 874

Query:  692 RLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKEKVLED 751
               . .| |     ||    . .      |  || ...   ..  ||..   |...    
Sbjct:  875 EFEKENQKGKAAILDLEKTCKEL------KHQLQVQMENTLKEQKELKKSLEKEKEASHQ 928

Query:  752 VRLTVKNLESSLLQLQGALNSRERE-------IGSLRRQLDACQEELAALXXXXXXXXXX 804
            ..| . ...  |.| |  |   |.|       |  |..  .  .... ||          
Sbjct:  929 LKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQ 988

Query:  805 XXRLQDDL-TTMTRENQVVHAEMEDV 829
               |.. |   .|.  | . || | .
Sbjct:  989 KTELENKLQQQLTQAAQELAAEKEKI 1014

>hg18||uc003ulg
        |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3907

 Score =  87 bits (213), Expect = 2e-016
 Identities = 153/705 (21%), Positives = 300/705 (42%), Gaps = 62/705 (8%)

Query:  195 ADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNT---QVELRDQEIERLNHALK--G 249
            ||   | . .| |  . | .|  .|  |   .. |     |..   . . |   |.|   
Sbjct: 1928 ADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQKEAMKAEA 1987

Query:  250 GRPHDVISLEAQNLSNEK*AGSVLDVQ-QIEYLQETNRTLEEKVKGLQQRKEDVSTEVAN 308
            |     .  | . |  ||     |.|| | | ...    |...|| |.    ||  .|. 
Sbjct: 1988 GPVEQQLLQETEKLMKEK-----LEVQCQAEKVRD---DLQKQVKALE---IDVEEQVSR 2036

Query:  309 LSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELEDIVTT 368
                 ||   ||  . .  . ||   ... .  | .  . . |    |. |..||  .  
Sbjct: 2037 FIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKV 2096

Query:  369 ARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEK---VDKAMGAEREL 425
              | |  .. .   . .    |||| .|   ..   |. .  .||.   ..|     |||
Sbjct: 2097 VPRFQPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVREL 2156

Query:  426 VLE-LESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSR 484
                | |  |   |  |.   .       ||| .    |   .|  .        |   |
Sbjct: 2157 EQALLVSADTFQKVEDRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNLEEQLEQFR 2216

Query:  485 ---GRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQ 541
                 | | .  |    .|.   |    || |..   |    . . | . .|      . 
Sbjct: 2217 EELENKNEEVQQL--HMQLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKE-SDAMST 2273

Query:  542 EDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESA 601
            .|  .   | |   ... |. | |.. ..  | ..||.|  . . . . |   | |||. 
Sbjct: 2274 QDQHVLFGKFAQ-IIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNE--LIRDLETQ 2330

Query:  602 VKSL----ERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQE----RAESNA 653
            .. |    |  . ..  |.  | |  | |.||| .       ||  ...|    . . . 
Sbjct: 2331 IECLMSDQECVKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDV 2390

Query:  654 LRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRS 713
            .   |  .|| .      ..   | |   .  .|.|   |  | .     ..  |  . |
Sbjct: 2391 VIAEKLALEQQVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENS 2450

Query:  714 I-AALDR-EKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALN 771
            .  |.|   ||  . ||   ||   .  |  .  .   |. . .. |||. ||||.  ..
Sbjct: 2451 VNVAIDHLSKDKPELEV-VLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVS 2509

Query:  772 SREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLH 831
            ... |.    .|.   ||                   |    |   . ..|.  .. .. 
Sbjct: 2510 AKDLELTQCYKQIKDMQE-------------------QGQFETEMLQKKIVN--LQKIVE 2548

Query:  832 ERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR 876
            |.    |     .  | .  |        .. ||. |.  ||. |
Sbjct: 2549 EKVAAALVSQIQLEAVQEYAKFCQDNQTISSEPERTNIQNLNQLR 2593

>hg18||uc003ulh
        |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|NP_671700|A-kinase
        anchor protein 9 isoform 1

          Length = 3911

 Score =  87 bits (213), Expect = 2e-016
 Identities = 153/705 (21%), Positives = 300/705 (42%), Gaps = 62/705 (8%)

Query:  195 ADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNT---QVELRDQEIERLNHALK--G 249
            ||   | . .| |  . | .|  .|  |   .. |     |..   . . |   |.|   
Sbjct: 1940 ADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQKEAMKAEA 1999

Query:  250 GRPHDVISLEAQNLSNEK*AGSVLDVQ-QIEYLQETNRTLEEKVKGLQQRKEDVSTEVAN 308
            |     .  | . |  ||     |.|| | | ...    |...|| |.    ||  .|. 
Sbjct: 2000 GPVEQQLLQETEKLMKEK-----LEVQCQAEKVRD---DLQKQVKALE---IDVEEQVSR 2048

Query:  309 LSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELEDIVTT 368
                 ||   ||  . .  . ||   ... .  | .  . . |    |. |..||  .  
Sbjct: 2049 FIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKV 2108

Query:  369 ARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEK---VDKAMGAEREL 425
              | |  .. .   . .    |||| .|   ..   |. .  .||.   ..|     |||
Sbjct: 2109 VPRFQPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVREL 2168

Query:  426 VLE-LESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSR 484
                | |  |   |  |.   .       ||| .    |   .|  .        |   |
Sbjct: 2169 EQALLVSADTFQKVEDRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNLEEQLEQFR 2228

Query:  485 ---GRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQ 541
                 | | .  |    .|.   |    || |..   |    . . | . .|      . 
Sbjct: 2229 EELENKNEEVQQL--HMQLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKE-SDAMST 2285

Query:  542 EDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESA 601
            .|  .   | |   ... |. | |.. ..  | ..||.|  . . . . |   | |||. 
Sbjct: 2286 QDQHVLFGKFAQ-IIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNE--LIRDLETQ 2342

Query:  602 VKSL----ERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQE----RAESNA 653
            .. |    |  . ..  |.  | |  | |.||| .       ||  ...|    . . . 
Sbjct: 2343 IECLMSDQECVKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDV 2402

Query:  654 LRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRS 713
            .   |  .|| .      ..   | |   .  .|.|   |  | .     ..  |  . |
Sbjct: 2403 VIAEKLALEQQVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENS 2462

Query:  714 I-AALDR-EKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALN 771
            .  |.|   ||  . ||   ||   .  |  .  .   |. . .. |||. ||||.  ..
Sbjct: 2463 VNVAIDHLSKDKPELEV-VLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVS 2521

Query:  772 SREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLH 831
            ... |.    .|.   ||                   |    |   . ..|.  .. .. 
Sbjct: 2522 AKDLELTQCYKQIKDMQE-------------------QGQFETEMLQKKIVN--LQKIVE 2560

Query:  832 ERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR 876
            |.    |     .  | .  |        .. ||. |.  ||. |
Sbjct: 2561 EKVAAALVSQIQLEAVQEYAKFCQDNQTISSEPERTNIQNLNQLR 2605

>hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3530

 Score =  87 bits (213), Expect = 2e-016
 Identities = 153/705 (21%), Positives = 300/705 (42%), Gaps = 62/705 (8%)

Query:  195 ADLLQLADGRIHELQEDIIKLRLDLENAQECVKHLNT---QVELRDQEIERLNHALK--G 249
            ||   | . .| |  . | .|  .|  |   .. |     |..   . . |   |.|   
Sbjct: 1551 ADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQKEAMKAEA 1610

Query:  250 GRPHDVISLEAQNLSNEK*AGSVLDVQ-QIEYLQETNRTLEEKVKGLQQRKEDVSTEVAN 308
            |     .  | . |  ||     |.|| | | ...    |...|| |.    ||  .|. 
Sbjct: 1611 GPVEQQLLQETEKLMKEK-----LEVQCQAEKVRD---DLQKQVKALE---IDVEEQVSR 1659

Query:  309 LSLKNQELCEELTHIDKLAKRLEMDKDRVLETADTELQEAKKELQRQQKIIEELEDIVTT 368
                 ||   ||  . .  . ||   ... .  | .  . . |    |. |..||  .  
Sbjct: 1660 FIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKV 1719

Query:  369 ARRAQSEADFEKELLREQLLGLKEKNEKMEGVVTLVEEEKVRLQEK---VDKAMGAEREL 425
              | |  .. .   . .    |||| .|   ..   |. .  .||.   ..|     |||
Sbjct: 1720 VPRFQPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVREL 1779

Query:  426 VLE-LESMRTKYGVCGRERSPSRLDAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSR 484
                | |  |   |  |.   .       ||| .    |   .|  .        |   |
Sbjct: 1780 EQALLVSADTFQKVEDRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNLEEQLEQFR 1839

Query:  485 ---GRKTELLHALTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQ 541
                 | | .  |    .|.   |    || |..   |    . . | . .|      . 
Sbjct: 1840 EELENKNEEVQQL--HMQLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKE-SDAMST 1896

Query:  542 EDLRLAKTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESA 601
            .|  .   | |   ... |. | |.. ..  | ..||.|  . . . . |   | |||. 
Sbjct: 1897 QDQHVLFGKFAQ-IIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNE--LIRDLETQ 1953

Query:  602 VKSL----ERERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQE----RAESNA 653
            .. |    |  . ..  |.  | |  | |.||| .       ||  ...|    . . . 
Sbjct: 1954 IECLMSDQECVKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDV 2013

Query:  654 LRILKEQMEQALSDTQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRS 713
            .   |  .|| .      ..   | |   .  .|.|   |  | .     ..  |  . |
Sbjct: 2014 VIAEKLALEQQVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENS 2073

Query:  714 I-AALDR-EKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALN 771
            .  |.|   ||  . ||   ||   .  |  .  .   |. . .. |||. ||||.  ..
Sbjct: 2074 VNVAIDHLSKDKPELEV-VLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVS 2132

Query:  772 SREREIGSLRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLH 831
            ... |.    .|.   ||                   |    |   . ..|.  .. .. 
Sbjct: 2133 AKDLELTQCYKQIKDMQE-------------------QGQFETEMLQKKIVN--LQKIVE 2171

Query:  832 ERDELKLRVHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFR 876
            |.    |     .  | .  |        .. ||. |.  ||. |
Sbjct: 2172 EKVAAALVSQIQLEAVQEYAKFCQDNQTISSEPERTNIQNLNQLR 2216

>hg18||uc001wjv |14|NM_002471|P13533|MYH6_HUMAN|MYH6|NM_002471|NP_002462|myosin
        heavy chain 6

          Length = 1939

 Score =  86 bits (210), Expect = 3e-016
 Identities = 116/481 (24%), Positives = 210/481 (43%), Gaps = 32/481 (6%)

Query:  276 QQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLA---KRLEM 332
            . .| .     .||.    ||   ||.  .|   .     | ..  . ||.    |.   
Sbjct: 1404 EAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYE 1463

Query:  333 DKDRVLETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKE 392
            .    ||..  | .    || . .   ||  . . | .|       |   | |||    .
Sbjct: 1464 ESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGK 1523

Query:  393 KNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDAFV 452
               ..| |   .| ||. ||  ...|     |  || |  .    .   .   ... | .
Sbjct: 1524 NVHELEKVRKQLEVEKLELQSALEEA-----EASLEHEEGK----ILRAQLEFNQIKAEI 1574

Query:  453 RSLEQERDYYRQEAER-HRRVRGAASPNLSPSRGRKTELLHALTERD----ELKAALKGL 507
                 |.|   ..|.| |.||  .   .|      . |.|    . .    |..  |   
Sbjct: 1575 ERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHA 1634

Query:  508 ERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLR-LAKTKDASGDLKQAELTIQQM 566
             |   | |  |||| .     .. |      .| .||.      .   .| ||||   . 
Sbjct: 1635 NRMAAEAQKQVKSLQSLLKDTQIQLDDAV--RANDDLKENIAIVERRNNLLQAELEELRA 1692

Query:  567 SAEIEALMEKLKVTQTSALSDR-QVEERRILDLESAVKSLERERLDQRSEV-HLLKERRE 624
              |      ||   .    |.| |.   .   | .  | .| .    .|||   ..| | 
Sbjct: 1693 VVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRN 1752

Query:  625 ALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRL-SVKTNELHAAH 683
            | |.  |. . ||.  |||. .|.  |  |  .|. ||| . | ||||   .   |    
Sbjct: 1753 AEEKAKKAITDAAMM-AEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGK 1811

Query:  684 ETINKLEDRL----GELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQ 739
            . . ||| |.    |||      . | .  ...|    .|    |  . ..  . |  ||
Sbjct: 1812 KQLQKLEARVRELEGELEAEQKRNAESVKGMRKS----ERRIKELTYQTEEDKKNLLRLQ 1867

Query:  740 E 740
            .
Sbjct: 1868 D 1868

>hg18||uc001azu |1|DQ139275|Q5TZA2-2|Q5TZA2-2|CROCC|NM_014675|NP_055490|ciliary
        rootlet coiled-coil, rootletin

          Length = 1313

 Score =  85 bits (209), Expect = 4e-016
 Identities = 143/627 (22%), Positives = 257/627 (40%), Gaps = 43/627 (6%)

Query:  507 LERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAELTIQQM 566
            |.    || . .      |  |.. .      .|     |.|    .  | | .| . ..
Sbjct:    2 LQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRL 61

Query:  567 SAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKERREAL 626
             |..|     |.  |  |  .  |       ||      |  |      . . .. .|||
Sbjct:   62 VAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEAL 121

Query:  627 EQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHAAHETI 686
            ||.| .      |  |..||    |  |   ....|||  . | ..        || |  
Sbjct:  122 EQQLPTLRHERSQLQEQLAQ---LSRQLSGREQELEQARREAQRQVEALE---RAAREKE 175

Query:  687 NKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSKKE 746
               ..  |   |  .  .|    |      |  ||. |.  . .   .| .|.    . |
Sbjct:  176 ALAKEHAGLAVQLVAAEREG-RTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLE 234

Query:  747 KVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQL------DACQEELAALXXXXXX 800
               . . |  . |   |  |.  . . . |  || ..|       | .|  |.|      
Sbjct:  235 AEGQALLLAKETLTGELAGLRQQIIATQ-EKASLDKELMAQKLVQAEREAQASLREQRAA 293

Query:  801 XXXXXXRLQDDLTTMTRENQVVHAEMEDVL-HERDELKLRVHSYIIEVS-KIEKLVAAKA 858
                  ||| .     || .   |...  |  |..||  |. .   |.| .|  |   . 
Sbjct:  294 HEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERD 353

Query:  859 RGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSIN 918
             |    | |    |.   .  ||     .||        .| ||.       || ||. .
Sbjct:  354 EGLLLAESEKQQALS---LKESEKTALSEKLMGTRHSLATISLEM------ERQKRDAQS 404

Query:  919 NKEKE------IQQHIQALQAY-EGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRE 971
             .|..      .   .. |.|  |   .. |. . ||.|.     . . | | .   .| 
Sbjct:  405 RQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRT 464

Query:  972 LCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAELLKKQLAGERLTVRNLESLLSA 1031
                |.  ..   |.|      .       |  | ||  |.. | ||    |  |.|  .
Sbjct:  465 QLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSL-GEGAKER--EALRRS 521

Query: 1032 NRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTRDVTQLQGKVSQLETEMDVLRRQ 1091
            | .     . | .||   |||  .        .||  |  | .  .  .| | .  . | 
Sbjct:  522 NEELRSAVKKAESER-ISLKLANEDKE-QKLALLEEAR--TAVGKEAGELRTGLQEVER- 576

Query: 1092 LTTERFERERAVQEMRRQGVSLSSLHT 1118
                | |  | .||.|||   | | .|
Sbjct:  577 ---SRLEARRELQELRRQMKMLDSENT 600

>hg18||uc003dxa |3|AB023217|Q9Y2K3|Q9Y2K3_HUMAN|MYH15|NA|NA|KIAA1000 protein
        (Fragment)

          Length = 1946

 Score =  84 bits (207), Expect = 7e-016
 Identities = 124/576 (21%), Positives = 245/576 (42%), Gaps = 58/576 (10%)

Query:  556 LKQAELTIQQMSAEIEALMEKLKVTQTSALSDR-------QVEERRILDLESAVKSLERE 608
            ||.    .|.   . |   |.||  | |   ..       | |.  . ..|   . | . 
Sbjct:  864 LKEECAQLQKALEKSEFQREELKAKQVSLTQEKNDLILQLQAEQETLANVEEQCEWLIKS 923

Query:  609 RLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQE-RAESNALRILKEQMEQALSD 667
            ..   . |  | || |  |.|. |.  |  .  |.   | . | . |  .  . |.    
Sbjct:  924 KIQLEARVKELSERVEE-EEEINSELTARGRKLEDECFELKKEIDDLETMLVKSEKEKRT 982

Query:  668 TQHRLSVKTNELHAAHETINKLEDRLGELSQHG--------SVHKEDLSALQRSIAALDR 719
            |.|..   | |.   .| |.|| .|  .. |           . .| ||.| ..   |..
Sbjct:  983 TEHKVKNLTEEVEFLNEDISKL-NRAAKVVQEAHQQTLDDLHMEEEKLSSLSKANLKLEQ 1041

Query:  720 EKDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGS 779
            . | |.  ..|. .     . |  | |  |.  | ...|||||   |   |  .| |.  
Sbjct: 1042 QVDELEGALEQERKARMNCERELHKLEGNLKLNRESMENLESSQRHLAEELRKKELELSQ 1101

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            .  ...  .  .| |             |.. |         .  |  |.  .  .|  |
Sbjct: 1102 MNSKVENEKGLVAQLQKTVKELQTQIKDLKEKLEAERTTRAKMERERADLTQDLADLNER 1161

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
            .    .  | . .|   |       .||      .|.  | ..||             ..
Sbjct: 1162 LEE--VGGSSLAQLEITK-------KQE-----TKFQKLHRDMEE------------ATL 1195

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA----RAMSRLEEELH-K 954
              |  |.  ..|   ||.   | ...   |  |  |   | |       ..|.|.    |
Sbjct: 1196 HFETTSASLKKRH-ADSLAELEGQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAK 1254

Query:  955 AQEDKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAELLKKQ 1014
            |  .|   | .   . |   |||   .| |  |  .   .   . |      | | |  |
Sbjct: 1255 ANAEKLCTLYE-ERLHEATAKLDKVTQL-ANDLAAQKTKLWSESGEFLRRLEEKEALINQ 1312

Query: 1015 LAGERLTVRNLESLLSANRQKEFQTQLAAT----EREAELKLLRDRLNFADSKILEHTRD 1070
            |. |.         |    .|| ..| |      . . .  |||..         |  | 
Sbjct: 1313 LSREKSNFTRQIEDLRGQLEKETKSQSALAHALQKAQRDCDLLREQYEEEQEVKAELHRT 1372

Query: 1071 VTQLQGKVSQ--LETEMDVLRRQLTTERFERERAVQ 1104
            ....  .. |  .. | .|..|    |  ..| |..
Sbjct: 1373 LSKVNAEMVQWRMKYENNVIQRTEDLEDAKKELAIR 1408

>hg18||uc001wjw |14|M58018|P12883|MYH7_HUMAN|MYH7|NM_000257|NP_000248|myosin,
        heavy chain 7, cardiac muscle, beta

          Length = 1935

 Score =  83 bits (203), Expect = 2e-015
 Identities = 111/477 (23%), Positives = 205/477 (42%), Gaps = 24/477 (5%)

Query:  276 QQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLA---KRLEM 332
            . .| .     .||.    ||   ||.  .|   .     | ..  . ||.    |.   
Sbjct: 1402 EAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYE 1461

Query:  333 DKDRVLETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKE 392
            .    ||..  | .    || . .   ||  . . | .|       |   | |||    .
Sbjct: 1462 ESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGK 1521

Query:  393 KNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDAFV 452
               ..| |   .| ||. ||  ...|     |  || |  .    .   .   ... | .
Sbjct: 1522 TIHELEKVRKQLEAEKMELQSALEEA-----EASLEHEEGK----ILRAQLEFNQIKAEI 1572

Query:  453 RSLEQERDYYRQEAER-HRRVRGAASPNLSPSRGRKTELLHALTERD----ELKAALKGL 507
                 |.|   ..|.| | ||  .   .|      . | |    . .    |..  |   
Sbjct: 1573 ERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHA 1632

Query:  508 ERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLR-LAKTKDASGDLKQAELTIQQM 566
             |   | |  |||| .     .. |      .| .||.      .   .| ||||   . 
Sbjct: 1633 NRMAAEAQKQVKSLQSLLKDTQIQLDDAV--RANDDLKENIAIVERRNNLLQAELEELRA 1690

Query:  567 SAEIEALMEKLKVTQTSALSDR-QVEERRILDLESAVKSLERERLDQRSEV-HLLKERRE 624
              |      ||   .    |.| |.   .   | .  | .. .    ..||   ..| | 
Sbjct: 1691 VVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRN 1750

Query:  625 ALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRL-SVKTNELHAAH 683
            | |.  |. . ||.  |||. .|.  |  |  .|. ||| . | ||||   .   |    
Sbjct: 1751 AEEKAKKAITDAAMM-AEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGK 1809

Query:  684 ETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQE 740
            . . ||| |. ||       ..  .   . .   .|    |  . ..  . |  ||.
Sbjct: 1810 KQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQD 1866

>hg18||uc001wjx |14|NM_000257|P12883|MYH7_HUMAN|MYH7|NM_000257|NP_000248|myosin,
        heavy chain 7, cardiac muscle, beta

          Length = 1935

 Score =  83 bits (203), Expect = 2e-015
 Identities = 111/477 (23%), Positives = 205/477 (42%), Gaps = 24/477 (5%)

Query:  276 QQIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLA---KRLEM 332
            . .| .     .||.    ||   ||.  .|   .     | ..  . ||.    |.   
Sbjct: 1402 EAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYE 1461

Query:  333 DKDRVLETADTELQEAKKELQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKE 392
            .    ||..  | .    || . .   ||  . . | .|       |   | |||    .
Sbjct: 1462 ESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGK 1521

Query:  393 KNEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVLELESMRTKYGVCGRERSPSRLDAFV 452
               ..| |   .| ||. ||  ...|     |  || |  .    .   .   ... | .
Sbjct: 1522 TIHELEKVRKQLEAEKMELQSALEEA-----EASLEHEEGK----ILRAQLEFNQIKAEI 1572

Query:  453 RSLEQERDYYRQEAER-HRRVRGAASPNLSPSRGRKTELLHALTERD----ELKAALKGL 507
                 |.|   ..|.| | ||  .   .|      . | |    . .    |..  |   
Sbjct: 1573 ERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHA 1632

Query:  508 ERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLR-LAKTKDASGDLKQAELTIQQM 566
             |   | |  |||| .     .. |      .| .||.      .   .| ||||   . 
Sbjct: 1633 NRMAAEAQKQVKSLQSLLKDTQIQLDDAV--RANDDLKENIAIVERRNNLLQAELEELRA 1690

Query:  567 SAEIEALMEKLKVTQTSALSDR-QVEERRILDLESAVKSLERERLDQRSEV-HLLKERRE 624
              |      ||   .    |.| |.   .   | .  | .. .    ..||   ..| | 
Sbjct: 1691 VVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRN 1750

Query:  625 ALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRL-SVKTNELHAAH 683
            | |.  |. . ||.  |||. .|.  |  |  .|. ||| . | ||||   .   |    
Sbjct: 1751 AEEKAKKAITDAAMM-AEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGK 1809

Query:  684 ETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQE 740
            . . ||| |. ||       ..  .   . .   .|    |  . ..  . |  ||.
Sbjct: 1810 KQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQD 1866

>hg18||uc001wjv |14|NM_002471|P13533|MYH6_HUMAN|MYH6|NM_002471|NP_002462|myosin
        heavy chain 6

          Length = 1939

 Score =  79 bits (193), Expect = 3e-014
 Identities = 125/629 (19%), Positives = 262/629 (41%), Gaps = 52/629 (8%)

Query:  494 LTERDELKAALKGLERRLDEVQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLA------ 547
            | .  | .  .  ..     ...|..     |  |.   |.    | . ||.|       
Sbjct:  841 LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEE--KMVSLLQEKNDLQLQVQAEQD 898

Query:  548 KTKDASGDLKQAELTIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLER 607
               ||     |      |. |... . |.|.  .    ..   ..|.   ||     |..
Sbjct:  899 NLNDAEERCDQLIKNKIQLEAKVKEMNERLE-DEEEMNAELTAKKRK---LEDECSELKK 954

Query:  608 ERLDQRSEVHLLKERREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSD 667
            .  |    .  ... . | | ..|. .       | .|.   |  |   |.|  .||| |
Sbjct:  955 DIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKA---LQEAHQQALDD 1011

Query:  668 TQHRLSVKTNELHAAHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDE 727
                | |. .....  ..  ||| .. .|       |.    |.|.   |. .  . |. 
Sbjct: 1012 ----LQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQES 1067

Query:  728 V-DQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREIGSLRRQLDA 786
            . | . .|| .|.|.  |||  .      ... ..  ||||  |   .  |  |  .|.|
Sbjct: 1068 IMDLENDKL-QLEEKLKKKEFDINQQNSKIEDEQALALQLQKKLKENQARIEELEEELEA 1126

Query:  787 CQEELAALXXXXXXXXXXXXRLQDDL-------TTMTRENQVVHAEMEDVLHERDELKLR 839
             .   | .             . . |       .     |.   || . .  . .|  |.
Sbjct: 1127 ERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQ 1186

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              .    . |       |   .     | .| | | .    | |. | ||.  .  .|  
Sbjct: 1187 HEATAAALRK-------KHADSVAELGEQIDNLQRVKQ-KLEKEKSEFKLELDDVTSNME 1238

Query:  900 RLELLSSDTER--RQLRDSINNKEKEIQQHIQALQAYEGQLSSLARAMSRLEEELHKAQE 957
            ..    .. |.  | | |  |    ....  ..|  .  | . |      |  .|    |
Sbjct: 1239 QIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQL----E 1294

Query:  958 DKTSLLSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAEAELLKKQLAG 1017
            .| .|.| |   .   .      |   |||         .   |.  | . .||..|   
Sbjct: 1295 EKEALISQLTRGK---LSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEE 1351

Query: 1018 ERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFADSKILEHTRD----VTQ 1073
            |      |. .||    .  | .   |. | .     . |  |  |. .  .|    |  
Sbjct: 1352 ETEAKAELQRVLSKANSEVAQWR---TKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEA 1408

Query: 1074 LQGKVSQLETEMDVLRRQLTTERFERERA 1102
            .  | | ||     |. ..     . ||.
Sbjct: 1409 VNAKCSSLEKTKHRLQNEIEDLMVDVERS 1437

>hg18||uc002prq
        |19|NM_001077186|Q7Z406-2|Q7Z406-2|MYH14|NM_001077186|NP_001070654|myos
        in, heavy chain 14 isoform 1

          Length = 2003

 Score =  72 bits (176), Expect = 3e-012
 Identities = 105/480 (21%), Positives = 202/480 (42%), Gaps = 36/480 (7%)

Query:  633 QSAAALQNAEEVAQER-AESNALRILKEQMEQALSDTQH----RLSVKTNELHAAHETIN 687
            |.||    |    |.|  . .|||...      |   .|    ||  |   |        
Sbjct:  819 QAAARGYLARRAFQKRQQQQSALRVMQRNCAAYLK-LRHWQWWRLFTKVKPLLQVTRQDE 877

Query:  688 KLEDRLGELSQHGSVHKE---DLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSK 744
             |. |  || .   . ..   ..  ||  .| |. |.  | ...  . |   | .|   .
Sbjct:  878 VLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERARLAEQLRAEAELCAEAEETRGR 937

Query:  745 KEKVLEDVRLTVKNLESSL-------LQLQGALNSREREIGSLRRQLDACQEELAALXXX 797
                 ... | |  ||. .        |.|      .. |  |   |.| .     |   
Sbjct:  938 LAARKQELELVVSELEARVGEEEECSRQMQTEKKRLQQHIQELEAHLEAEEGARQKLQLE 997

Query:  798 XXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLRVHSYIIEVSKIEKLVAAK 857
                     . ..||  .  .|         .  ||  |. |.  .  . .. |. | . 
Sbjct:  998 KVTTEAKMKKFEEDLLLLEDQN-------SKLSKERKLLEDRLAEFSSQAAEEEEKVKSL 1050

Query:  858 ARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSI 917
             .   . |    |. .| |      .| |.  .. .| .. .. ...       .||  .
Sbjct: 1051 NKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGESSELQEQMVEQQQRAEELRAQL 1110

Query:  918 NNKEKEIQQHIQALQAYEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLD 977
              ||.|.|  .   .   |  . | ...   .  | .||||  |    .|  .    . |
Sbjct: 1111 GRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEAQEDLES--ERVARTKAEKQRRD 1168

Query:  978 SGKELTA-RQLTTRSMDVERVTAELEDVR-AEAELLKKQLAGERLTVRNLESLLSANRQK 1035
             |.|| | |     ..|      ||   |  |   ||| |  |    |  |. .   ||.
Sbjct: 1169 LGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTLEEE---TRIHEAAVQELRQR 1225

Query: 1036 EFQTQLAATEREAELKLLRDRLNFADSKILEHTRDVTQLQGKVSQLET---EMDVLRRQL 1092
              |   |  |   .|.  |      .   |    .|..|. ..| |.|   | .  ||.|
Sbjct: 1226 HGQ---ALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSLQTARQEGEQRRRRL 1282

>hg18||uc002prr
        |19|NM_024729|Q7Z406-2|Q7Z406-2|MYH14|NM_024729|NP_079005|myosin, heavy
        chain 14 isoform 2

          Length = 1995

 Score =  72 bits (176), Expect = 3e-012
 Identities = 105/480 (21%), Positives = 202/480 (42%), Gaps = 36/480 (7%)

Query:  633 QSAAALQNAEEVAQER-AESNALRILKEQMEQALSDTQH----RLSVKTNELHAAHETIN 687
            |.||    |    |.|  . .|||...      |   .|    ||  |   |        
Sbjct:  811 QAAARGYLARRAFQKRQQQQSALRVMQRNCAAYLK-LRHWQWWRLFTKVKPLLQVTRQDE 869

Query:  688 KLEDRLGELSQHGSVHKE---DLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEENSK 744
             |. |  || .   . ..   ..  ||  .| |. |.  | ...  . |   | .|   .
Sbjct:  870 VLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERARLAEQLRAEAELCAEAEETRGR 929

Query:  745 KEKVLEDVRLTVKNLESSL-------LQLQGALNSREREIGSLRRQLDACQEELAALXXX 797
                 ... | |  ||. .        |.|      .. |  |   |.| .     |   
Sbjct:  930 LAARKQELELVVSELEARVGEEEECSRQMQTEKKRLQQHIQELEAHLEAEEGARQKLQLE 989

Query:  798 XXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLRVHSYIIEVSKIEKLVAAK 857
                     . ..||  .  .|         .  ||  |. |.  .  . .. |. | . 
Sbjct:  990 KVTTEAKMKKFEEDLLLLEDQN-------SKLSKERKLLEDRLAEFSSQAAEEEEKVKSL 1042

Query:  858 ARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSIRLELLSSDTERRQLRDSI 917
             .   . |    |. .| |      .| |.  .. .| .. .. ...       .||  .
Sbjct: 1043 NKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGESSELQEQMVEQQQRAEELRAQL 1102

Query:  918 NNKEKEIQQHIQALQAYEGQLSSLARAMSRLEEELHKAQEDKTSLLSDLASVRELCVKLD 977
              ||.|.|  .   .   |  . | ...   .  | .||||  |    .|  .    . |
Sbjct: 1103 GRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEAQEDLES--ERVARTKAEKQRRD 1160

Query:  978 SGKELTA-RQLTTRSMDVERVTAELEDVR-AEAELLKKQLAGERLTVRNLESLLSANRQK 1035
             |.|| | |     ..|      ||   |  |   ||| |  |    |  |. .   ||.
Sbjct: 1161 LGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTLEEE---TRIHEAAVQELRQR 1217

Query: 1036 EFQTQLAATEREAELKLLRDRLNFADSKILEHTRDVTQLQGKVSQLET---EMDVLRRQL 1092
              |   |  |   .|.  |      .   |    .|..|. ..| |.|   | .  ||.|
Sbjct: 1218 HGQ---ALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSLQTARQEGEQRRRRL 1274

>hg18||uc003jir
        |5|NM_015577|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|NP_056392|retinoic acid
        induced 14

          Length = 980

 Score =  71 bits (172), Expect = 9e-012
 Identities = 97/539 (17%), Positives = 223/539 (41%), Gaps = 61/539 (11%)

Query: 277 QIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDR 336
           .|. |||  . |.....  .  .. .  |.   | . . .|   | | . .     |  .
Sbjct: 430 RIQQLQEILQDLQKRLESSEAERKQLQVELQ--SRRAELVCLNNTEISENSS----DLSQ 483

Query: 337 VLETADTELQEAKKE---LQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEK 393
            |.   .. .|| ||   .|.| |.      .|.           |  .  |..  ||  
Sbjct: 484 KLKETQSKYEEAMKEVLSVQKQMKL-----GLVSPESMDNYSHFHELRVTEEEINVLK-- 536

Query: 394 NEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVL-----ELESMRTKYGVCGRERSPSRL 448
            . ..  .   |  | ...|  .| .  |.  |.     | | |.. |       .  . 
Sbjct: 537 -QDLQNALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKA 595

Query: 449 DAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALTER-DELKAALKGL 507
             | .  | . .  . .     ..   ||      .     ..  | ..  ||    |  
Sbjct: 596 FLFEKYQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEA 655

Query: 508 ERRLDE------VQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAEL 561
           .  |..      ..|       . .| |..           ..  || .||  ..|    
Sbjct: 656 QAELEDYRKRKSLEDVTAEYIHKAEHEKLM--------QLTNVSRAKAEDALSEMKSQYS 707

Query: 562 TIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKE 621
            .     ... |..  |    |     ||    |  | .| | .|              |
Sbjct: 708 KVLNELTQLKQLVDAQKENSVSITEHLQV----ITTLRTAAKEME--------------E 749

Query: 622 RREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHA 681
           .   |.. | |.     .  ... .|.|      . .   |.  |  .  .||  ..|  
Sbjct: 750 KISNLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKE 809

Query: 682 AHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEE 741
           . .   |.   . ..    |  | .   .|  . . ..| . |  .  |  |.| |..  
Sbjct: 810 SVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRY 869

Query: 742 NSKKEKVLEDVRLTVKNLESSLLQLQGALNSRER---EIGSLRR---QLDACQEELAAL 794
                |. ||    .  .   . .|. ||||  .      | .|   ||.| |...  |
Sbjct: 870 AESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSSSKRQSQQLEALQQQVKQL 928

>hg18||uc003jis |5|AY317139|Q9P0K7-2|Q9P0K7-2|RAI14|NA|NA|Ankycorbin (Ankyrin
        repeat and coiled-coil structure-containing protein) (Retinoic
        acid-induced protein 14) (Novel retinal pigment epithelial cell
        protein)

          Length = 983

 Score =  71 bits (172), Expect = 9e-012
 Identities = 97/539 (17%), Positives = 223/539 (41%), Gaps = 61/539 (11%)

Query: 277 QIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDR 336
           .|. |||  . |.....  .  .. .  |.   | . . .|   | | . .     |  .
Sbjct: 433 RIQQLQEILQDLQKRLESSEAERKQLQVELQ--SRRAELVCLNNTEISENSS----DLSQ 486

Query: 337 VLETADTELQEAKKE---LQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEK 393
            |.   .. .|| ||   .|.| |.      .|.           |  .  |..  ||  
Sbjct: 487 KLKETQSKYEEAMKEVLSVQKQMKL-----GLVSPESMDNYSHFHELRVTEEEINVLK-- 539

Query: 394 NEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVL-----ELESMRTKYGVCGRERSPSRL 448
            . ..  .   |  | ...|  .| .  |.  |.     | | |.. |       .  . 
Sbjct: 540 -QDLQNALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKA 598

Query: 449 DAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALTER-DELKAALKGL 507
             | .  | . .  . .     ..   ||      .     ..  | ..  ||    |  
Sbjct: 599 FLFEKYQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEA 658

Query: 508 ERRLDE------VQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAEL 561
           .  |..      ..|       . .| |..           ..  || .||  ..|    
Sbjct: 659 QAELEDYRKRKSLEDVTAEYIHKAEHEKLM--------QLTNVSRAKAEDALSEMKSQYS 710

Query: 562 TIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKE 621
            .     ... |..  |    |     ||    |  | .| | .|              |
Sbjct: 711 KVLNELTQLKQLVDAQKENSVSITEHLQV----ITTLRTAAKEME--------------E 752

Query: 622 RREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHA 681
           .   |.. | |.     .  ... .|.|      . .   |.  |  .  .||  ..|  
Sbjct: 753 KISNLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKE 812

Query: 682 AHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEE 741
           . .   |.   . ..    |  | .   .|  . . ..| . |  .  |  |.| |..  
Sbjct: 813 SVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRY 872

Query: 742 NSKKEKVLEDVRLTVKNLESSLLQLQGALNSRER---EIGSLRR---QLDACQEELAAL 794
                |. ||    .  .   . .|. ||||  .      | .|   ||.| |...  |
Sbjct: 873 AESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSSSKRQSQQLEALQQQVKQL 931

>hg18||uc003jit
        |5|BC028681|Q9P0K7|RAI14_HUMAN|RAI14|NM_015577|NP_056392|retinoic acid
        induced 14

          Length = 980

 Score =  71 bits (172), Expect = 9e-012
 Identities = 97/539 (17%), Positives = 223/539 (41%), Gaps = 61/539 (11%)

Query: 277 QIEYLQETNRTLEEKVKGLQQRKEDVSTEVANLSLKNQELCEELTHIDKLAKRLEMDKDR 336
           .|. |||  . |.....  .  .. .  |.   | . . .|   | | . .     |  .
Sbjct: 430 RIQQLQEILQDLQKRLESSEAERKQLQVELQ--SRRAELVCLNNTEISENSS----DLSQ 483

Query: 337 VLETADTELQEAKKE---LQRQQKIIEELEDIVTTARRAQSEADFEKELLREQLLGLKEK 393
            |.   .. .|| ||   .|.| |.      .|.           |  .  |..  ||  
Sbjct: 484 KLKETQSKYEEAMKEVLSVQKQMKL-----GLVSPESMDNYSHFHELRVTEEEINVLK-- 536

Query: 394 NEKMEGVVTLVEEEKVRLQEKVDKAMGAERELVL-----ELESMRTKYGVCGRERSPSRL 448
            . ..  .   |  | ...|  .| .  |.  |.     | | |.. |       .  . 
Sbjct: 537 -QDLQNALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKA 595

Query: 449 DAFVRSLEQERDYYRQEAERHRRVRGAASPNLSPSRGRKTELLHALTER-DELKAALKGL 507
             | .  | . .  . .     ..   ||      .     ..  | ..  ||    |  
Sbjct: 596 FLFEKYQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEA 655

Query: 508 ERRLDE------VQDTVKSLSTERDHLKMLLKVFFFPQAQEDLRLAKTKDASGDLKQAEL 561
           .  |..      ..|       . .| |..           ..  || .||  ..|    
Sbjct: 656 QAELEDYRKRKSLEDVTAEYIHKAEHEKLM--------QLTNVSRAKAEDALSEMKSQYS 707

Query: 562 TIQQMSAEIEALMEKLKVTQTSALSDRQVEERRILDLESAVKSLERERLDQRSEVHLLKE 621
            .     ... |..  |    |     ||    |  | .| | .|              |
Sbjct: 708 KVLNELTQLKQLVDAQKENSVSITEHLQV----ITTLRTAAKEME--------------E 749

Query: 622 RREALEQELKSQSAAALQNAEEVAQERAESNALRILKEQMEQALSDTQHRLSVKTNELHA 681
           .   |.. | |.     .  ... .|.|      . .   |.  |  .  .||  ..|  
Sbjct: 750 KISNLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKE 809

Query: 682 AHETINKLEDRLGELSQHGSVHKEDLSALQRSIAALDREKDVLQDEVDQKTEKLFELQEE 741
           . .   |.   . ..    |  | .   .|  . . ..| . |  .  |  |.| |..  
Sbjct: 810 SVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRY 869

Query: 742 NSKKEKVLEDVRLTVKNLESSLLQLQGALNSRER---EIGSLRR---QLDACQEELAAL 794
                |. ||    .  .   . .|. ||||  .      | .|   ||.| |...  |
Sbjct: 870 AESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSSSKRQSQQLEALQQQVKQL 928

>hg18||uc003zab
        |8|NM_201384|Q6S376|Q6S376_HUMAN|PLEC1|NM_201384|NP_958786|plectin 1
        isoform 11

          Length = 4547

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1310 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1368

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1369 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1426

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1427 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1478

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1479 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1538

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1539 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1593

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1594 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1648

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1649 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1697

>hg18||uc003zac
        |8|NM_201383|Q6S377|Q6S377_HUMAN|PLEC1|NM_201383|NP_958785|plectin 1
        isoform 10

          Length = 4551

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1314 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1372

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1373 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1430

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1431 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1482

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1483 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1542

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1543 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1597

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1598 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1652

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1653 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1701

>hg18||uc003zad
        |8|NM_201382|Q6S378|Q6S378_HUMAN|PLEC1|NM_201382|NP_958784|plectin 1
        isoform 8

          Length = 4547

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1310 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1368

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1369 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1426

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1427 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1478

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1479 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1538

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1539 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1593

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1594 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1648

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1649 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1697

>hg18||uc003zae
        |8|NM_201381|Q6S379|Q6S379_HUMAN|PLEC1|NM_201381|NP_958783|plectin 1
        isoform 7

          Length = 4515

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1278 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1336

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1337 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1394

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1395 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1446

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1447 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1506

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1507 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1561

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1562 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1616

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1617 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1665

>hg18||uc003zaf
        |8|NM_201380|Q6S380|Q6S380_HUMAN|PLEC1|NM_201380|NP_958782|plectin 1
        isoform 6

          Length = 4684

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1447 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1505

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1506 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1563

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1564 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1615

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1616 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1675

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1676 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1730

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1731 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1785

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1786 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1834

>hg18||uc003zag
        |8|NM_201379|Q6S381|Q6S381_HUMAN|PLEC1|NM_201379|NP_958781|plectin 1
        isoform 3

          Length = 4525

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1288 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1346

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1347 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1404

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1405 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1456

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1457 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1516

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1517 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1571

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1572 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1626

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1627 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1675

>hg18||uc003zah
        |8|NM_201378|Q6S382|Q6S382_HUMAN|PLEC1|NM_201378|NP_958780|plectin 1
        isoform 2

          Length = 4533

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1296 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1354

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1355 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1412

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1413 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1464

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1465 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1524

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1525 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1579

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1580 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1634

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1635 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1683

>hg18||uc003zai
        |8|NM_000445|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_000436|plectin 1
        isoform 1

          Length = 4574

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1337 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1395

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1396 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1453

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1454 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1505

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1506 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1565

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1566 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1620

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1621 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1675

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1676 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1724

>hg18||uc003zaj |8|U53204|Q6S383|Q6S383_HUMAN|PLEC1|NM_000445|NP_000436|plectin
        1 isoform 1

          Length = 4574

 Score =  70 bits (171), Expect = 1e-011
 Identities = 86/409 (21%), Positives = 170/409 (41%), Gaps = 41/409 (10%)

Query:  721 KDVLQDEVDQKTEKLFELQEENSKKEKVLEDVRLTVKNLESSLLQLQGALNSREREI-GS 779
            . |.|. || .|    ||    |.  | . .    ..  |    | .     |  |.  .
Sbjct: 1337 ESVIQEYVDLRTH-YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAA 1395

Query:  780 LRRQLDACQEELAALXXXXXXXXXXXXRLQDDLTTMTRENQVVHAEMEDVLHERDELKLR 839
            | .|    .    |             |.|...  . ||   | |. .    . .  .||
Sbjct: 1396 LEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV--VRREEAAVDAQQQKRSIQEELQQLR 1453

Query:  840 VHSYIIEVSKIEKLVAAKARGNTRPEQENLDLLNRFRMAHSEVEEHEQKLQQAEGLNNSI 899
              |        |  . ||||     |.  | .    |.   ..|  |..   |||   ..
Sbjct: 1454 QSS--------EAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQAL 1505

Query:  900 RLELLSSDTERRQLRDSINNKEKEIQQHIQALQAYEGQLSSLA-----------RAMSRL 948
            |     .. ..|| ..      ...|   |  .  | .|.|             ||.  |
Sbjct: 1506 RARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQAL 1565

Query:  949 EEELHKAQEDKTSL-LSDLASVRELCVKLDSGKELTARQLTTRSMDVERVTAELEDVRAE 1007
            ||   .|.| .  |  ...   |.. | |.. .     .| ..       ||.||     
Sbjct: 1566 EELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLE----- 1620

Query: 1008 AELLKKQLAGERLTVRNLESLLSANRQKEFQTQLAATEREAELKLLRDRLNFA-----DS 1062
                 . |  | . |  |        |.. . . |  | | ||.  . . | |      .
Sbjct: 1621 -----RSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA 1675

Query: 1063 KILEHTRDVTQLQGKVSQLETEMDVLRRQLTTERF--ERERAVQEMRRQ 1109
            . .   . . | . .  . | | .  ||    |.   .|| | ||. .|
Sbjct: 1676 EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQ 1724

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,654,518
Number of Sequences: 45480
Number of Extensions: 191654518
Number of Successful Extensions: 10949811
Number of sequences better than 0.0: 0
BLASTP 7.6.0