BLASTP 7.6.0


Query=fugu4_574427 |jgi|Takru4|574427|e_gw2.13.257.1
        (333 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001gfu |1|NM_013330|Q9Y5B8|NDK7_HUMAN|NME7|NM_013330|NP_...    408   5e-114
hg18||uc001gft |1|NM_197972|Q9Y5B8|NDK7_HUMAN|NME7|NM_197972|NP_...    365   7e-101
hg18||uc001gfv |1|AB209049|Q59GR0|Q59GR0_HUMAN|NME7|NM_013330|NP...    312   4e-085
hg18||uc003lce |5|NM_003551|P56597|NDK5_HUMAN|NME5|NM_003551|NP_...    109   5e-024
hg18||uc003cso |3|NM_005793|O75414|NDK6_HUMAN|NME6|NM_005793|NP_...     91   2e-018
hg18||uc003csp |3|AK222555|O75414|NDK6_HUMAN|NME6|NM_005793|NP_0...     91   2e-018
hg18||uc003ese |3|NM_178130|Q86XW9-2|Q86XW9-2|TXNDC6|NM_178130|N...     79   9e-015
hg18||uc003esg |3|AF196568|Q86XW9|TXND6_HUMAN|TXNDC6|NA|NA|Thior...     79   9e-015
hg18||uc003tfn |7|NM_016616|Q8N427|TXND3_HUMAN|TXNDC3|NM_016616|...     78   1e-014
hg18||uc002cgz |16|NM_005009|O00746|NDKM_HUMAN|NME4|NM_005009|NP...     77   4e-014
hg18||uc003tfn |7|NM_016616|Q8N427|TXND3_HUMAN|TXNDC3|NM_016616|...     69   7e-012
hg18||uc002cmm |16|NM_002513|Q13232|NDK3_HUMAN|NME3|NM_002513|NP...     69   1e-011
hg18||uc002itj |17|NM_001018136|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM...     65   1e-010
hg18||uc002itk |17|BC107894|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001...     65   1e-010
hg18||uc002itl |17|NM_001018137|P22392|NDKB_HUMAN|NME2|NM_001018...     65   1e-010
hg18||uc002itm |17|NM_002512|P22392|NDKB_HUMAN|NME2|NM_002512|NP...     65   1e-010
hg18||uc002itn |17|NM_001018139|P22392|NDKB_HUMAN|NME2|NM_001018...     65   1e-010
hg18||uc002ito |17|NM_001018138|P22392|NDKB_HUMAN|NME2|NM_001018...     65   1e-010
hg18||uc002ith |17|NM_198175|Q86XQ2|Q86XQ2_HUMAN|NME1|NM_198175|...     63   4e-010
hg18||uc002iti |17|NM_000269|P15531|NDKA_HUMAN|NME1|NM_000269|NP...     63   4e-010
hg18||uc001gft |1|NM_197972|Q9Y5B8|NDK7_HUMAN|NME7|NM_197972|NP_...     59   8e-009
hg18||uc001gfu |1|NM_013330|Q9Y5B8|NDK7_HUMAN|NME7|NM_013330|NP_...     59   8e-009
hg18||uc002cgy |16|CR595773|Q5U0M9|Q5U0M9_HUMAN|NME4|NM_005009|N...     59   1e-008
hg18||uc003ese |3|NM_178130|Q86XW9-2|Q86XW9-2|TXNDC6|NM_178130|N...     51   2e-006
hg18||uc003esg |3|AF196568|Q86XW9|TXND6_HUMAN|TXNDC6|NA|NA|Thior...     51   2e-006
hg18||uc001tyb |12|NR_001577|O60361|NDK8_HUMAN|NME2P1|NA|NA|Puta...     50   3e-006
hg18||uc002itj |17|NM_001018136|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM...     49   6e-006
hg18||uc002itk |17|BC107894|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001...     49   6e-006

>hg18||uc001gfu
        |1|NM_013330|Q9Y5B8|NDK7_HUMAN|NME7|NM_013330|NP_037462|nucleoside-diph
        osphate kinase 7 isoform a

          Length = 376

 Score =  408 bits (1048), Expect = 5e-114
 Identities = 187/326 (57%), Positives = 250/326 (76%)

Query:   2 ERYAFLTEWFDPIAAVLRCFQLFYYPNDGSVEMFDMKKQQKFLKRIKYDDLDPKDLFIGN 61
           ||. |. ||.|| |..|| ..| .|| |||||| |.|  . |||| |||.|  .||||||
Sbjct:   5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query:  62 RVKVFSRQLNLMDYGDEYTANKLGSKKERTLALIKPDAVTKIGEVLEKIYASNLIVTKAK 121
           .| |||||| |.||||.||| .|||.||.|||||||||..| ||..| |  .   .|| |
Sbjct:  65 KVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLK 124

Query: 122 MTKLTWSQAADFYAEHQSKPFFNNSVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGA 181
           |  |.  .| ||. .|||.||||  . |...||..|||.. |.|.  ||. |||| |  |
Sbjct: 125 MMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVA 184

Query: 182 QREAPQSARAQFGTDGIRNFGHGSDSLXXXXRELEFFFPSTIGYGPPNTATYTDSTCCII 241
           . .| .| || ||||||||  || ||     ||.| ||||. | || ||| .|. ||||.
Sbjct: 185 RTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIV 244

Query: 242 KPHAIAEGLTGKILNTISEAGFEMLALQMFNVDRANAEEFFEVYKGVVPEYNGMVNELCS 301
           ||||..||| ||||  | .||||. |.||||.|| | |||.||||||| ||. || |. |
Sbjct: 245 KPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYS 304

Query: 302 GACMALEILDTDQQQSFRDLCGPADP 327
           | |.|.||   .  ..||. ||||||
Sbjct: 305 GPCVAMEIQQNNATKTFREFCGPADP 330

>hg18||uc001gft
        |1|NM_197972|Q9Y5B8|NDK7_HUMAN|NME7|NM_197972|NP_932076|nucleoside-diph
        osphate kinase 7 isoform b

          Length = 340

 Score =  365 bits (935), Expect = 7e-101
 Identities = 169/294 (57%), Positives = 224/294 (76%)

Query:  34 MFDMKKQQKFLKRIKYDDLDPKDLFIGNRVKVFSRQLNLMDYGDEYTANKLGSKKERTLA 93
           | |.|  . |||| |||.|  .||||||.| |||||| |.||||.||| .|||.||.|||
Sbjct:   1 MHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLA 60

Query:  94 LIKPDAVTKIGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNSVHFLSSG 153
           ||||||..| ||..| |  .   .|| ||  |.  .| ||. .|||.||||  . |...|
Sbjct:  61 LIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTG 120

Query: 154 PVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSDSLXXXXR 213
           |..|||.. |.|.  ||. |||| |  |. .| .| || ||||||||  || ||     |
Sbjct: 121 PIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAR 180

Query: 214 ELEFFFPSTIGYGPPNTATYTDSTCCIIKPHAIAEGLTGKILNTISEAGFEMLALQMFNV 273
           |.| ||||. | || ||| .|. ||||.||||..||| ||||  | .||||. |.||||.
Sbjct: 181 EMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNM 240

Query: 274 DRANAEEFFEVYKGVVPEYNGMVNELCSGACMALEILDTDQQQSFRDLCGPADP 327
           || | |||.||||||| ||. || |. || |.|.||   .  ..||. ||||||
Sbjct: 241 DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADP 294

>hg18||uc001gfv
        |1|AB209049|Q59GR0|Q59GR0_HUMAN|NME7|NM_013330|NP_037462|nucleoside-dip
        hosphate kinase 7 isoform a

          Length = 279

 Score =  312 bits (799), Expect = 4e-085
 Identities = 144/262 (54%), Positives = 196/262 (74%), Gaps = 4/262 (1%)

Query:   2 ERYAFLTEWFDPIAAVLRCFQLFYYPNDGSVEMFDMKKQQKFLKRIKYDDLDPKDLFIGN 61
           ||. |. ||.|| |..|| ..| .|| |||||| |.|  . |||| |||.|  .||||||
Sbjct:   5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query:  62 RVKVFSRQLNLMDYGDEYTANKLGSKKERTLALIKPDAVTKIGEVLEKIYASNLIVTKAK 121
           .| |||||| |.||||.||| .|||.||.|||||||||..| ||..| |  .   .|| |
Sbjct:  65 KVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLK 124

Query: 122 MTKLTWSQAADFYAEHQSKPFFNNSVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGA 181
           |  |.  .| ||. .|||.||||  . |...||..|||.. |.|.  ||. |||| |  |
Sbjct: 125 MMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVA 184

Query: 182 QREAPQSARAQFGTDGIRNFGHGSDSLXXXXRELEFFFPSTIGYGPPNTATYTDSTCCII 241
           . .| .| || ||||||||  || ||     ||.| ||||. | || ||| .|. ||||.
Sbjct: 185 RTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIV 244

Query: 242 KPHAIAEGLTGKILNTISEAGF 263
           ||||..||.    |||.    |
Sbjct: 245 KPHAVSEGM----LNTLYSVHF 262

>hg18||uc003lce
        |5|NM_003551|P56597|NDK5_HUMAN|NME5|NM_003551|NP_003542|non-metastatic
        cells 5, protein expressed in

          Length = 212

 Score =  109 bits (272), Expect = 5e-024
 Identities = 64/163 (39%), Positives = 87/163 (53%), Gaps = 1/163 (0%)

Query:  89 ERTLALIKPDAVTKIGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNSVH 148
           |.|||.|||| | |  |. . |  |   . . .  .|.  | ..|| |   | || |   
Sbjct:  13 EKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTA 72

Query: 149 FLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSDSL 208
           ..||||.||| |   .|.| | . |||  |  |.   | | || .||| .||  |||.  
Sbjct:  73 YMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDF 132

Query: 209 XXXXRELEFFFPSTIGYGPPNTATYTDSTCCIIKPHAIAEGLT 251
               ||. | ||  |    |      |     | |  . ||||
Sbjct: 133 AAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMP-TLLEGLT 174

>hg18||uc003cso
        |3|NM_005793|O75414|NDK6_HUMAN|NME6|NM_005793|NP_005784|nucleoside
        diphosphate kinase type 6

          Length = 194

 Score =  91 bits (223), Expect = 2e-018
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 7/135 (5%)

Query:  91 TLALIKPDAVTK---IGEVLEKIYASNLIVTKAKMTKLTW--SQAADFYAEHQSKPFFNN 145
           ||||||||||     .  | ..| ..  ..   .| .| |       || ||. . |.  
Sbjct:  22 TLALIKPDAVAHPLILEAVHQQILSNKFLI--VRMRELLWRKEDCQRFYREHEGRFFYQR 79

Query: 146 SVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGS 205
            | |..|||. |  |   .|. .|.  .||     |.  || | |  ||    ||  |||
Sbjct:  80 LVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGS 139

Query: 206 DSLXXXXRELEFFFP 220
           ||.    ||.  |||
Sbjct: 140 DSVVSASREIAAFFP 154

>hg18||uc003csp
        |3|AK222555|O75414|NDK6_HUMAN|NME6|NM_005793|NP_005784|nucleoside
        diphosphate kinase type 6

          Length = 186

 Score =  91 bits (223), Expect = 2e-018
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 7/135 (5%)

Query:  91 TLALIKPDAVTK---IGEVLEKIYASNLIVTKAKMTKLTW--SQAADFYAEHQSKPFFNN 145
           ||||||||||     .  | ..| ..  ..   .| .| |       || ||. . |.  
Sbjct:  14 TLALIKPDAVAHPLILEAVHQQILSNKFLI--VRMRELLWRKEDCQRFYREHEGRFFYQR 71

Query: 146 SVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGS 205
            | |..|||. |  |   .|. .|.  .||     |.  || | |  ||    ||  |||
Sbjct:  72 LVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGS 131

Query: 206 DSLXXXXRELEFFFP 220
           ||.    ||.  |||
Sbjct: 132 DSVVSASREIAAFFP 146

>hg18||uc003ese
        |3|NM_178130|Q86XW9-2|Q86XW9-2|TXNDC6|NM_178130|NP_835231|thioredoxin-l
        ike 2

          Length = 263

 Score =  79 bits (192), Expect = 9e-015
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 6/144 (4%)

Query:  84 LGSKKERTLALIKPDAVT--KIGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKP 141
           . |..  |||.||||||   |  |.. ||  .   .   .   .| ..   ||     . 
Sbjct:  93 VSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEE 152

Query: 142 FFNNSVHFLSSGPVVAMELMG----DEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDG 197
            |   || . |||   . |      .. |. |.  .|| . . |.|| |.| |||.||. 
Sbjct: 153 AFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEM 212

Query: 198 IRNFGHGSDSLXXXXRELEFFFPS 221
             |  |||       |||   |||
Sbjct: 213 PFNAVHGSRDREDADRELALLFPS 236

>hg18||uc003esg |3|AF196568|Q86XW9|TXND6_HUMAN|TXNDC6|NA|NA|Thioredoxin
        domain-containing protein 6 (Thioredoxin-like protein 2) (Txl-2)

          Length = 330

 Score =  79 bits (192), Expect = 9e-015
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 6/144 (4%)

Query:  84 LGSKKERTLALIKPDAVT--KIGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKP 141
           . |..  |||.||||||   |  |.. ||  .   .   .   .| ..   ||     . 
Sbjct: 154 VSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEE 213

Query: 142 FFNNSVHFLSSGPVVAMELMG----DEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDG 197
            |   || . |||   . |      .. |. |.  .|| . . |.|| |.| |||.||. 
Sbjct: 214 AFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEM 273

Query: 198 IRNFGHGSDSLXXXXRELEFFFPS 221
             |  |||       |||   |||
Sbjct: 274 PFNAVHGSRDREDADRELALLFPS 297

>hg18||uc003tfn
        |7|NM_016616|Q8N427|TXND3_HUMAN|TXNDC3|NM_016616|NP_057700|NM23-H8

          Length = 588

 Score =  78 bits (191), Expect = 1e-014
 Identities = 48/150 (32%), Positives = 81/150 (54%), Gaps = 4/150 (2%)

Query:  87 KKERTLALIKPDAV-TKIGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNN 145
           | |.||||..|.    .  .||  |   .  . . .   |.  .|     |.... .|| 
Sbjct: 314 KLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNK 373

Query: 146 SVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIR-NFGHG 204
            .  ..||| .|. |. |  .  ||. |||     |    |.|  |||  | .  |  .|
Sbjct: 374 LIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYG 433

Query: 205 SDSLXXXXRELEFFFP--STIGYGPPNTAT 232
           ||||    ||.. |||  ||.|   |.  .
Sbjct: 434 SDSLETAEREIQHFFPLQSTLGLIKPHATS 463

>hg18||uc002cgz
        |16|NM_005009|O00746|NDKM_HUMAN|NME4|NM_005009|NP_005000|nucleoside-dip
        hosphate kinase 4

          Length = 187

 Score =  77 bits (187), Expect = 4e-014
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 5/137 (3%)

Query:  88 KERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNN 145
           .||||  .||| | .  .|.|...       .   || .   |  |. | . . |||.  
Sbjct:  37 RERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPA 96

Query: 146 SVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGS 205
            . ..||||||||   |   |   .  .|  .|. |   || . |  |     ||  | |
Sbjct:  97 LIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEA---APGTIRGDFSVHISRNVIHAS 153

Query: 206 DSLXXXXRELEFFFPST 222
           ||.    ||.. .| |.
Sbjct: 154 DSVEGAQREIQLWFQSS 170

>hg18||uc003tfn
        |7|NM_016616|Q8N427|TXND3_HUMAN|TXNDC3|NM_016616|NP_057700|NM23-H8

          Length = 588

 Score =  69 bits (167), Expect = 7e-012
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 1/120 (0%)

Query:  89 ERTLALIKPDAVTKIGE-VLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNSV 147
           . || |||| | ..  | .|. .  .   .|. |   ||  |    | .   | |. . .
Sbjct: 451 QSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQTEKIYPKVTGKDFYKDLL 510

Query: 148 HFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSDS 207
             || || . | |    ||. |.. .|| .   |.  .| | |||||   ..|  ||. .
Sbjct: 511 EMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASN 570

>hg18||uc002cmm
        |16|NM_002513|Q13232|NDK3_HUMAN|NME3|NM_002513|NP_002504|nucleoside-dip
        hosphate kinase 3

          Length = 169

 Score =  69 bits (166), Expect = 1e-011
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 5/133 (3%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   .||| | .  .||.. .       .   |. . .     . ||| . .||.   
Sbjct:  22 ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 81

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSD 206
           | ...|||||||   | . |   .  .|    . |    | . |  |  .  .|  ||||
Sbjct:  82 VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADA---PPGTIRGDFCIEVGKNLIHGSD 138

Query: 207 SLXXXXRELEFFF 219
           |.    ||.  .|
Sbjct: 139 SVESARREIALWF 151

>hg18||uc002itj
        |17|NM_001018136|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001018136|NP_00101814
        6|NME1-NME2 protein

          Length = 267

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct: 120 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 179

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct: 180 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 233

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 234 GSDSVKSAEKEISLWF 249

>hg18||uc002itk
        |17|BC107894|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001018136|NP_001018146|NM
        E1-NME2 protein

          Length = 292

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct: 145 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 204

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct: 205 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 258

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 259 GSDSVKSAEKEISLWF 274

>hg18||uc002itl
        |17|NM_001018137|P22392|NDKB_HUMAN|NME2|NM_001018137|NP_001018147|non-m
        etastatic cells 2, protein (NM23B)

          Length = 152

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  65 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 118

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 119 GSDSVKSAEKEISLWF 134

>hg18||uc002itm
        |17|NM_002512|P22392|NDKB_HUMAN|NME2|NM_002512|NP_002503|non-metastatic
        cells 2, protein (NM23B)

          Length = 152

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  65 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 118

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 119 GSDSVKSAEKEISLWF 134

>hg18||uc002itn
        |17|NM_001018139|P22392|NDKB_HUMAN|NME2|NM_001018139|NP_001018149|non-m
        etastatic cells 2, protein (NM23B)

          Length = 152

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  65 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 118

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 119 GSDSVKSAEKEISLWF 134

>hg18||uc002ito
        |17|NM_001018138|P22392|NDKB_HUMAN|NME2|NM_001018138|NP_001018148|non-m
        etastatic cells 2, protein (NM23B)

          Length = 152

 Score =  65 bits (157), Expect = 1e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .       | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | ...|||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  65 VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 118

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 119 GSDSVKSAEKEISLWF 134

>hg18||uc002ith
        |17|NM_198175|Q86XQ2|Q86XQ2_HUMAN|NME1|NM_198175|NP_937818|non-metastat
        ic cells 1, protein (NM23A)

          Length = 177

 Score =  63 bits (152), Expect = 4e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .     . | . . .|||   
Sbjct:  30 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 89

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | .. |||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  90 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 143

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 144 GSDSVESAEKEIGLWF 159

>hg18||uc002iti
        |17|NM_000269|P15531|NDKA_HUMAN|NME1|NM_000269|NP_000260|non-metastatic
        cells 1, protein (NM23A)

          Length = 152

 Score =  63 bits (152), Expect = 4e-010
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 11/136 (8%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .     . | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGH 203
           | .. |||||||   |   |   .  ||   ||.|       | . |  |     ||  |
Sbjct:  65 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIH 118

Query: 204 GSDSLXXXXRELEFFF 219
           ||||.    .|.  .|
Sbjct: 119 GSDSVESAEKEIGLWF 134

>hg18||uc001gft
        |1|NM_197972|Q9Y5B8|NDK7_HUMAN|NME7|NM_197972|NP_932076|nucleoside-diph
        osphate kinase 7 isoform b

          Length = 340

 Score =  59 bits (141), Expect = 8e-009
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 3/132 (2%)

Query:  91 TLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQS-KPFFNNSV 147
           |  ..|| ||..  .|..|  |  .   ..  .|  .      .||  ..     ... |
Sbjct: 204 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMV 263

Query: 148 HFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSDS 207
             . ||| ||||.  . |   ...| |||.   |.   | . || ||   |.|  | .| 
Sbjct: 264 TEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDL 323

Query: 208 LXXXXRELEFFF 219
                 |...||
Sbjct: 324 PEDGLLEVQYFF 335

>hg18||uc001gfu
        |1|NM_013330|Q9Y5B8|NDK7_HUMAN|NME7|NM_013330|NP_037462|nucleoside-diph
        osphate kinase 7 isoform a

          Length = 376

 Score =  59 bits (141), Expect = 8e-009
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 3/132 (2%)

Query:  91 TLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQS-KPFFNNSV 147
           |  ..|| ||..  .|..|  |  .   ..  .|  .      .||  ..     ... |
Sbjct: 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMV 299

Query: 148 HFLSSGPVVAMELMGDEAVSVWKKFLGPAESSGAQREAPQSARAQFGTDGIRNFGHGSDS 207
             . ||| ||||.  . |   ...| |||.   |.   | . || ||   |.|  | .| 
Sbjct: 300 TEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDL 359

Query: 208 LXXXXRELEFFF 219
                 |...||
Sbjct: 360 PEDGLLEVQYFF 371

>hg18||uc002cgy
        |16|CR595773|Q5U0M9|Q5U0M9_HUMAN|NME4|NM_005009|NP_005000|nucleoside-di
        phosphate kinase 4

          Length = 117

 Score =  59 bits (140), Expect = 1e-008
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 121 KMTKLTWSQAADFYAEHQSKPFFNNSVHFLSSGPVVAMELMGDEAVSVWKKFLGPAESSG 180
           || .   |  |. | . . |||.   . ..||||||||   |   |   .  .|  .|. 
Sbjct:   2 KMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAE 61

Query: 181 AQREAPQSARAQFGTDGIRNFGHGSDSLXXXXRELEFFFPST 222
           |   || . |  |     ||  | |||.    ||.. .| |.
Sbjct:  62 A---APGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSS 100

>hg18||uc003ese
        |3|NM_178130|Q86XW9-2|Q86XW9-2|TXNDC6|NM_178130|NP_835231|thioredoxin-l
        ike 2

          Length = 263

 Score =  51 bits (121), Expect = 2e-006
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 237 TCCIIKPHAIAEGLTGKILNTISEAGFEMLALQMFNVDRANAEEFFEVYKGVVPEYNGMV 296
           |  |||| |.| | | .|.  | |||||.|  .   .  |    |.. .|     .  .|
Sbjct: 100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQ-HKAGEEAFEKLV 158

Query: 297 NELCSGACMALEILDT----DQQQSFRDLCGPADP 327
           . .|||    | .  |    |   ..| . || ||
Sbjct: 159 HHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDP 193

>hg18||uc003esg |3|AF196568|Q86XW9|TXND6_HUMAN|TXNDC6|NA|NA|Thioredoxin
        domain-containing protein 6 (Thioredoxin-like protein 2) (Txl-2)

          Length = 330

 Score =  51 bits (121), Expect = 2e-006
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 237 TCCIIKPHAIAEGLTGKILNTISEAGFEMLALQMFNVDRANAEEFFEVYKGVVPEYNGMV 296
           |  |||| |.| | | .|.  | |||||.|  .   .  |    |.. .|     .  .|
Sbjct: 161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQ-HKAGEEAFEKLV 219

Query: 297 NELCSGACMALEILDT----DQQQSFRDLCGPADP 327
           . .|||    | .  |    |   ..| . || ||
Sbjct: 220 HHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDP 254

>hg18||uc001tyb |12|NR_001577|O60361|NDK8_HUMAN|NME2P1|NA|NA|Putative nucleoside
        diphosphate kinase (EC 2.7.4.6) (NDK) (NDP kinase)

          Length = 137

 Score =  50 bits (119), Expect = 3e-006
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 9/120 (7%)

Query: 103 IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNSVHFLSSGPVVAMELMG 162
           .|.....       .   |    .       | . . .|||   | ...|||||||   |
Sbjct:   6 VGKIIKRFEQKGFRLVAMKFLPASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEG 65

Query: 163 DEAVSVWKKFLG---PAESSGAQREAPQSARAQFGTDGIRNFGHGSDSLXXXXRELEFFF 219
              |   .  ||   ||.|       | . |  |     ||  |||||.    .|.   |
Sbjct:  66 LNVVKTGRVMLGETNPADSK------PGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLRF 119

>hg18||uc002itj
        |17|NM_001018136|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001018136|NP_00101814
        6|NME1-NME2 protein

          Length = 267

 Score =  49 bits (116), Expect = 6e-006
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .     . | . . .|||   
Sbjct:   5 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAES 178
           | .. |||||||   |   |   .  ||   ||.|
Sbjct:  65 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADS 99

>hg18||uc002itk
        |17|BC107894|Q1WM23|Q1WM23_HUMAN|NME1-NME2|NM_001018136|NP_001018146|NM
        E1-NME2 protein

          Length = 292

 Score =  49 bits (116), Expect = 6e-006
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query:  89 ERTLALIKPDAVTK--IGEVLEKIYASNLIVTKAKMTKLTWSQAADFYAEHQSKPFFNNS 146
           |||   |||| | .  .||....       .   |  . .     . | . . .|||   
Sbjct:  30 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 89

Query: 147 VHFLSSGPVVAMELMGDEAVSVWKKFLG---PAES 178
           | .. |||||||   |   |   .  ||   ||.|
Sbjct:  90 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADS 124

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,252,843
Number of Sequences: 45480
Number of Extensions: 191252843
Number of Successful Extensions: 11153049
Number of sequences better than 0.0: 0
BLASTP 7.6.0