BLASTP 7.6.0


Query=fugu4_574166 |jgi|Takru4|574166|e_gw2.376.29.1
        (334 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004eae |X|NM_052957|Q96QF7|Q96QF7_HUMAN|ACRC|NM_052957|N...     31   2.237
hg18||uc001grt |1|AK131434|Q92954-2|Q92954-2|PRG4|NM_005807|NP_0...     30   2.922
hg18||uc001gru |1|NM_005807|Q92954|PRG4_HUMAN|PRG4|NM_005807|NP_...     30   2.922
hg18||uc002adm |15|NM_022841|Q2KHR2|Q2KHR2_HUMAN|RFXDC2|NM_02284...     30   3.817
hg18||uc002adn |15|AK128045|Q6ZRR1|Q6ZRR1_HUMAN|RFXDC2|NM_022841...     30   3.817

>hg18||uc004eae |X|NM_052957|Q96QF7|Q96QF7_HUMAN|ACRC|NM_052957|NP_443189|ACRC
        protein

          Length = 691

 Score =  31 bits (68), Expect = 2.237
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 231 DEKAPDDQTDTTRGAADASPQEEPGANAQDAXXXXXXXXXXXEDPVDKTASLSNGIDLLM 290
           | .|||| .| .    |.|   |   .. |            | | ||    |.  |.  
Sbjct: 261 DSEAPDDSSDDSEAPDDSSDDSEASDDSSDDSEASDDSSDDSEAPDDK----SDDSDVPE 316

Query: 291 DSTGEEEQNQANS 303
           | . . .    ||
Sbjct: 317 DKSDDSDVPDDNS 329

>hg18||uc001grt
        |1|AK131434|Q92954-2|Q92954-2|PRG4|NM_005807|NP_005798|proteoglycan 4

          Length = 1099

 Score =  30 bits (67), Expect = 2.922
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 5/94 (5%)

Query:  30 QTKNSTGGPFLT--PNVTYKHLKVPCHTDSSQPTPTTLLPSSDAPTKDTVATSTANRTQA 87
           . . .| || ||     |    | |  |   .|||||.     |||       |  ..  
Sbjct: 293 KAETTTKGPALTTPKEPTPTTPKEPASTTPKEPTPTTI---KSAPTTPKEPAPTTTKSAP 349

Query:  88 TTRIQVNFGTTEEVNSGSGFWVTQTTTLPGSPVS 121
           ||  .    ||.|    .      |||   .| .
Sbjct: 350 TTPKEPAPTTTKEPAPTTPKEPAPTTTKEPAPTT 383

>hg18||uc001gru
        |1|NM_005807|Q92954|PRG4_HUMAN|PRG4|NM_005807|NP_005798|proteoglycan 4

          Length = 1404

 Score =  30 bits (67), Expect = 2.922
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 5/94 (5%)

Query:  30 QTKNSTGGPFLT--PNVTYKHLKVPCHTDSSQPTPTTLLPSSDAPTKDTVATSTANRTQA 87
           . . .| || ||     |    | |  |   .|||||.     |||       |  ..  
Sbjct: 334 KAETTTKGPALTTPKEPTPTTPKEPASTTPKEPTPTTI---KSAPTTPKEPAPTTTKSAP 390

Query:  88 TTRIQVNFGTTEEVNSGSGFWVTQTTTLPGSPVS 121
           ||  .    ||.|    .      |||   .| .
Sbjct: 391 TTPKEPAPTTTKEPAPTTPKEPAPTTTKEPAPTT 424

>hg18||uc002adm
        |15|NM_022841|Q2KHR2|Q2KHR2_HUMAN|RFXDC2|NM_022841|NP_073752|regulatory
        factor X domain containing 2

          Length = 1363

 Score =  30 bits (66), Expect = 3.817
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 15/106 (14%)

Query:  29 LQTKNSTGGPFLTPNVTYKHL-------KVPCHTDSSQPTPTTLLPSSDAPTKDTVA--- 78
           ||... | |  .. . .  |          | || .  ||||     .  || . .|   
Sbjct: 817 LQSQSVTPGAPMSSHTSSTHFYHPIHSNGTPIHTPTPTPTPTPTPTPTPTPTSEMIAGSQ 876

Query:  79 ----TSTANRTQATTRIQVNFGTTEEVNSGSGFWVTQTTTLPGSPV 120
                |  .|   || .    |..     |.      ....| |||
Sbjct: 877 SLSRESPCSRLAQTTPVDSALGSSRHTPIGTPH-SNCSSSVPPSPV 921

>hg18||uc002adn
        |15|AK128045|Q6ZRR1|Q6ZRR1_HUMAN|RFXDC2|NM_022841|NP_073752|regulatory
        factor X domain containing 2

          Length = 1192

 Score =  30 bits (66), Expect = 3.817
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 15/106 (14%)

Query:  29 LQTKNSTGGPFLTPNVTYKHL-------KVPCHTDSSQPTPTTLLPSSDAPTKDTVA--- 78
           ||... | |  .. . .  |          | || .  ||||     .  || . .|   
Sbjct: 728 LQSQSVTPGAPMSSHTSSTHFYHPIHSNGTPIHTPTPTPTPTPTPTPTPTPTSEMIAGSQ 787

Query:  79 ----TSTANRTQATTRIQVNFGTTEEVNSGSGFWVTQTTTLPGSPV 120
                |  .|   || .    |..     |.      ....| |||
Sbjct: 788 SLSRESPCSRLAQTTPVDSALGSSRHTPIGTPH-SNCSSSVPPSPV 832

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,198,093
Number of Sequences: 45480
Number of Extensions: 193198093
Number of Successful Extensions: 11050774
Number of sequences better than 0.0: 0
BLASTP 7.6.0