BLASTP 7.6.0


Query=fugu4_574094 |jgi|Takru4|574094|e_gw2.426.14.1
        (371 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003zcc |8|AK027888|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|...    226   5e-059
hg18||uc003zcd |8|NM_024531|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531...    226   5e-059
hg18||uc003zce |8|BC071955|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|...    226   5e-059
hg18||uc003zcf |8|CR617610|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|...    226   5e-059
hg18||uc002gao |17|NM_017986|Q9NWF4|PEVR2_HUMAN|GPR172B|NM_01798...    218   1e-056
hg18||uc002gap |17|BC092473|Q9NWF4|PEVR2_HUMAN|GPR172B|NM_017986...    218   1e-056
hg18||uc002wed |20|NM_033409|Q9NQ40|CT054_HUMAN|C20orf54|NM_0334...    116   8e-026
hg18||uc002wee |20|AK074650|Q9NQ40-2|Q9NQ40-2|C20orf54|NM_033409...    116   8e-026
hg18||uc002wee |20|AK074650|Q9NQ40-2|Q9NQ40-2|C20orf54|NM_033409...     74   3e-013
hg18||uc002wed |20|NM_033409|Q9NQ40|CT054_HUMAN|C20orf54|NM_0334...     69   7e-012
hg18||uc002kmt |18|NM_012307|Q9Y2J2|E41L3_HUMAN|EPB41L3|NM_01230...     30   5.750
hg18||uc002kmu |18|BC006141|Q9Y2J2-2|Q9Y2J2-2|EPB41L3|NM_012307|...     30   5.750
hg18||uc004evb |X|NM_021946|Q8TEN3|Q8TEN3_HUMAN|BCORL1|NM_021946...     30   5.750

>hg18||uc003zcc |8|AK027888|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|NP_078807|G
        protein-coupled receptor 172A

          Length = 445

 Score =  226 bits (574), Expect = 5e-059
 Identities = 134/334 (40%), Positives = 177/334 (52%), Gaps = 23/334 (6%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.|.|||.| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||  .|.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||     |||   |.   |
Sbjct: 130 VTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGSERPGEESHP 242
            |||  ||  |  .|  |. .|  |           | | |   |    |.|   ||| |
Sbjct: 190 RFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSP 249

Query: 243 LHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFT 296
           |        |  | |.        |      .  .  || ||| .|||||||||.||||.
Sbjct: 250 LQEPPSQAAGTTPGPD--------PKAYQLLSARSACLLGLLAATNALTNGVLPAVQSFS 301

Query: 297 CLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           |||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 CLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 335

>hg18||uc003zcd |8|NM_024531|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|NP_078807|G
        protein-coupled receptor 172A

          Length = 445

 Score =  226 bits (574), Expect = 5e-059
 Identities = 134/334 (40%), Positives = 177/334 (52%), Gaps = 23/334 (6%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.|.|||.| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||  .|.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||     |||   |.   |
Sbjct: 130 VTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGSERPGEESHP 242
            |||  ||  |  .|  |. .|  |           | | |   |    |.|   ||| |
Sbjct: 190 RFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSP 249

Query: 243 LHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFT 296
           |        |  | |.        |      .  .  || ||| .|||||||||.||||.
Sbjct: 250 LQEPPSQAAGTTPGPD--------PKAYQLLSARSACLLGLLAATNALTNGVLPAVQSFS 301

Query: 297 CLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           |||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 CLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 335

>hg18||uc003zce |8|BC071955|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|NP_078807|G
        protein-coupled receptor 172A

          Length = 445

 Score =  226 bits (574), Expect = 5e-059
 Identities = 134/334 (40%), Positives = 177/334 (52%), Gaps = 23/334 (6%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.|.|||.| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||  .|.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||     |||   |.   |
Sbjct: 130 VTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGSERPGEESHP 242
            |||  ||  |  .|  |. .|  |           | | |   |    |.|   ||| |
Sbjct: 190 RFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSP 249

Query: 243 LHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFT 296
           |        |  | |.        |      .  .  || ||| .|||||||||.||||.
Sbjct: 250 LQEPPSQAAGTTPGPD--------PKAYQLLSARSACLLGLLAATNALTNGVLPAVQSFS 301

Query: 297 CLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           |||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 CLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 335

>hg18||uc003zcf |8|CR617610|Q9HAB3|PEVR1_HUMAN|GPR172A|NM_024531|NP_078807|G
        protein-coupled receptor 172A

          Length = 445

 Score =  226 bits (574), Expect = 5e-059
 Identities = 134/334 (40%), Positives = 177/334 (52%), Gaps = 23/334 (6%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.|.|||.| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||  .|.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||     |||   |.   |
Sbjct: 130 VTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGSERPGEESHP 242
            |||  ||  |  .|  |. .|  |           | | |   |    |.|   ||| |
Sbjct: 190 RFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSP 249

Query: 243 LHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFT 296
           |        |  | |.        |      .  .  || ||| .|||||||||.||||.
Sbjct: 250 LQEPPSQAAGTTPGPD--------PKAYQLLSARSACLLGLLAATNALTNGVLPAVQSFS 301

Query: 297 CLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           |||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 CLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 335

>hg18||uc002gao |17|NM_017986|Q9NWF4|PEVR2_HUMAN|GPR172B|NM_017986|NP_060456|G
        protein-coupled receptor 172B

          Length = 448

 Score =  218 bits (554), Expect = 1e-056
 Identities = 131/337 (38%), Positives = 179/337 (53%), Gaps = 26/337 (7%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.||||..| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRR 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||   |.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||    ||||   |.   |
Sbjct: 130 VTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGS---ERPGEE 239
            |||  ||  |  .|  |. .|  |           |   |   |  . |.   |.  ||
Sbjct: 190 RFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEE 249

Query: 240 SHPLHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQ 293
           . ||        |  | |.        |     ..    .|| |.| ..|.|||||||||
Sbjct: 250 ALPLQEPPSQAAGTIPGPD--------PEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQ 301

Query: 294 SFTCLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           ||.|||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 SFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 338

>hg18||uc002gap |17|BC092473|Q9NWF4|PEVR2_HUMAN|GPR172B|NM_017986|NP_060456|G
        protein-coupled receptor 172B

          Length = 448

 Score =  218 bits (554), Expect = 1e-056
 Identities = 131/337 (38%), Positives = 179/337 (53%), Gaps = 26/337 (7%)

Query:  11 VSHGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHH 70
           ..| |||.| |||| .|| .|            ||.||.||||..| |||| .|||.   
Sbjct:  11 LTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRQ 70

Query:  71 CAPGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSN 130
            |||   |.. |  .|             | |   . |                    ||
Sbjct:  71 LAPG-KGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSN 129

Query: 131 VTFLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLEC--VNTNGTV-KPIYLQE 187
           ||||||.   || ..|.||.|||  || ||..|| ||||.|||    ||||   |.   |
Sbjct: 130 VTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPE 189

Query: 188 NFPAQNFFGFLCIMLTVSSLSFWALW-----QRQTMTLEDGQAQQSDNSGS---ERPGEE 239
            |||  ||  |  .|  |. .|  |           |   |   |  . |.   |.  ||
Sbjct: 190 RFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEE 249

Query: 240 SHPLHH------GGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQ 293
           . ||        |  | |.        |     ..    .|| |.| ..|.|||||||||
Sbjct: 250 ALPLQEPPSQAAGTIPGPD--------PEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQ 301

Query: 294 SFTCLPFGTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           ||.|||.| . .||.||||. |||||||.||  . |.
Sbjct: 302 SFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRS 338

>hg18||uc002wed
        |20|NM_033409|Q9NQ40|CT054_HUMAN|C20orf54|NM_033409|NP_212134|hypotheti
        cal protein LOC113278

          Length = 469

 Score =  116 bits (288), Expect = 8e-026
 Identities = 59/163 (36%), Positives = 79/163 (48%)

Query:  13 HGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHHCA 72
           | || .| ||||...| ||            || ||.||.|.|   |.||..||. ||  
Sbjct:   6 HLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFR 65

Query:  73 PGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSNVT 132
           |  |.|  .|  |              |. |  .                      |.||
Sbjct:  66 PSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDCTSSVT 125

Query: 133 FLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLECVN 175
           |||||   |  |. |||.|.|   | | .||| || |   |||
Sbjct: 126 FLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVN 168

>hg18||uc002wee
        |20|AK074650|Q9NQ40-2|Q9NQ40-2|C20orf54|NM_033409|NP_212134|hypothetica
        l protein LOC113278

          Length = 415

 Score =  116 bits (288), Expect = 8e-026
 Identities = 59/163 (36%), Positives = 79/163 (48%)

Query:  13 HGLVAMFAMGSWISVNSLWXXXXXXXXXXXXGWNLPAYLSVLIAFGNLGPVVVTITHHCA 72
           | || .| ||||...| ||            || ||.||.|.|   |.||..||. ||  
Sbjct:   6 HLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFR 65

Query:  73 PGLLNERLLIHCLQXXXXXXXXXXXXFWSHTVSIGGTERXXXXXXXXXXXXXXXXXSNVT 132
           |  |.|  .|  |              |. |  .                      |.||
Sbjct:  66 PSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDCTSSVT 125

Query: 133 FLPFMFCYPPEYIRTFFIGQGFGALFPCIVALGQGVGKLECVN 175
           |||||   |  |. |||.|.|   | | .||| || |   |||
Sbjct: 126 FLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVN 168

>hg18||uc002wee
        |20|AK074650|Q9NQ40-2|Q9NQ40-2|C20orf54|NM_033409|NP_212134|hypothetica
        l protein LOC113278

          Length = 415

 Score =  74 bits (180), Expect = 3e-013
 Identities = 53/150 (35%), Positives = 77/150 (51%), Gaps = 6/150 (4%)

Query: 184 YLQENFPAQNFFGFLCIMLTVSSLSFWALWQRQTMTLE---DGQAQQSDNSGSERPGEES 240
           ||  .|    ||  | ||.    ..|. | |||    |   .          | || ||.
Sbjct: 213 YLPAHFSPLVFFLLLSIMMACCLVAFFVL-QRQPRCWEASVEDLLNDQVTLHSIRPREEN 271

Query: 241 HPLHHGGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFTCLPF 300
                |     .||  .||.            .. .|.|  ||||||.|||||...|| .
Sbjct: 272 DLGPAGTVDSSQGQGYLEEK--AAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSY 329

Query: 301 GTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           | | .||.  |  .|||||  |.||   |.
Sbjct: 330 GPVAYHLAATLSIVANPLASLVSMFLPNRS 359

>hg18||uc002wed
        |20|NM_033409|Q9NQ40|CT054_HUMAN|C20orf54|NM_033409|NP_212134|hypotheti
        cal protein LOC113278

          Length = 469

 Score =  69 bits (168), Expect = 7e-012
 Identities = 52/150 (34%), Positives = 76/150 (50%), Gaps = 6/150 (4%)

Query: 184 YLQENFPAQNFFGFLCIMLTVSSLSFWALWQRQTMTLE---DGQAQQSDNSGSERPGEES 240
           ||  .|    ||  | ||.    ..|. | |||    |   .          | |  ||.
Sbjct: 213 YLPAHFSPLVFFLLLSIMMACCLVAFFVL-QRQPRCWEASVEDLLNDQVTLHSIRLREEN 271

Query: 241 HPLHHGGAPVPEGQKPVEEQPLTVTFWTQPNVYLLSLLAVSNALTNGVLPSVQSFTCLPF 300
                |     .||  .||.            .. .|.|  ||||||.|||||...|| .
Sbjct: 272 DLGPAGMVDSSQGQGYLEEK--AAPCCPAHLAFVYTLVAFVNALTNGMLPSVQTYSCLSY 329

Query: 301 GTVTFHLSVVLGNMANPLACFVAMFFVLRA 330
           | | .||.  |  .|||||  |.||   |.
Sbjct: 330 GPVAYHLAATLSIVANPLASLVSMFLPNRS 359

>hg18||uc002kmt
        |18|NM_012307|Q9Y2J2|E41L3_HUMAN|EPB41L3|NM_012307|NP_036439|erythrocyt
        e membrane protein band 4.1-like 3

          Length = 1087

 Score =  30 bits (65), Expect = 5.750
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 218 MTLEDGQAQQSDNSGSERPGEESHPLHHGGAPVPEGQKPVEEQPL 262
           || | |   .|       | | .      ||||||  |  ..| |
Sbjct:   1 MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQAL 45

>hg18||uc002kmu
        |18|BC006141|Q9Y2J2-2|Q9Y2J2-2|EPB41L3|NM_012307|NP_036439|erythrocyte
        membrane protein band 4.1-like 3

          Length = 865

 Score =  30 bits (65), Expect = 5.750
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 218 MTLEDGQAQQSDNSGSERPGEESHPLHHGGAPVPEGQKPVEEQPL 262
           || | |   .|       | | .      ||||||  |  ..| |
Sbjct:   1 MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQAL 45

>hg18||uc004evb |X|NM_021946|Q8TEN3|Q8TEN3_HUMAN|BCORL1|NM_021946|NP_068765|BCL6
        co-repressor-like 1

          Length = 1711

 Score =  30 bits (65), Expect = 5.750
 Identities = 26/67 (38%), Positives = 30/67 (44%), Gaps = 15/67 (22%)

Query: 248 APVPEGQK-PVEEQPLTVTFWTQPNVY--------------LLSLLAVSNALTNGVLPSV 292
           |  |  || |.  || ||   .|| ||              | . | ||. ||  |||| 
Sbjct: 425 AQAPAMQKVPLSFQPGTVLTPSQPLVYIPPPSCGQPLSVATLPTTLGVSSTLTLPVLPSY 484

Query: 293 QSFTCLP 299
               |||
Sbjct: 485 LQDRCLP 491

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,422,265
Number of Sequences: 45480
Number of Extensions: 193422265
Number of Successful Extensions: 11204551
Number of sequences better than 0.0: 0
BLASTP 7.6.0