BLASTP 7.6.0


Query=fugu4_573903 |jgi|Takru4|573903|e_gw2.499.8.1
        (114 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002vol |2|NM_000092|NA|NA|COL4A4|NM_000092|NP_000083|alp...    129   5e-031
hg18||uc001vqx |13|NM_001846|P08572|CO4A2_HUMAN|COL4A2|NM_001846...    129   9e-031
hg18||uc004env |X|NM_033641|Q5JYH8|Q5JYH8_HUMAN|COL4A6|NM_033641...    128   1e-030
hg18||uc004enw |X|NM_001847|Q14031|CO4A6_HUMAN|COL4A6|NM_001847|...    128   1e-030
hg18||uc001vqw |13|NM_001845|P02462|CO4A1_HUMAN|COL4A1|NM_001845...    115   1e-026
hg18||uc004enz |X|NM_033380|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033380...    113   4e-026
hg18||uc004eoa |X|NM_033381|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033381...    113   4e-026
hg18||uc002vom |2|NM_000091|Q01955|CO4A3_HUMAN|COL4A3|NM_000091|...     99   9e-022
hg18||uc004env |X|NM_033641|Q5JYH8|Q5JYH8_HUMAN|COL4A6|NM_033641...     62   1e-010
hg18||uc004enw |X|NM_001847|Q14031|CO4A6_HUMAN|COL4A6|NM_001847|...     62   1e-010
hg18||uc001vqx |13|NM_001846|P08572|CO4A2_HUMAN|COL4A2|NM_001846...     59   6e-010
hg18||uc002vol |2|NM_000092|NA|NA|COL4A4|NM_000092|NP_000083|alp...     57   2e-009
hg18||uc001vqw |13|NM_001845|P02462|CO4A1_HUMAN|COL4A1|NM_001845...     56   7e-009
hg18||uc002vom |2|NM_000091|Q01955|CO4A3_HUMAN|COL4A3|NM_000091|...     52   8e-008
hg18||uc002von |2|NM_031362|Q01955-2|Q01955-2|COL4A3|NM_031362|N...     52   8e-008
hg18||uc004enz |X|NM_033380|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033380...     51   2e-007
hg18||uc004eoa |X|NM_033381|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033381...     51   2e-007
hg18||uc002von |2|NM_031362|Q01955-2|Q01955-2|COL4A3|NM_031362|N...     30   0.412
hg18||uc002voo |2|NM_031365|Q01955-3|Q01955-3|COL4A3|NM_031365|N...     29   0.918
hg18||uc003wna |7|AY927457|NA|NA|HLXB9|NM_005515|NP_005506|homeo...     26   7.773
hg18||uc003wnd |7|NM_005515|P50219|HLXB9_HUMAN|HLXB9|NM_005515|N...     26   7.773

>hg18||uc002vol |2|NM_000092|NA|NA|COL4A4|NM_000092|NP_000083|alpha 4 type IV
        collagen precursor

          Length = 1690

 Score =  129 bits (324), Expect = 5e-031
 Identities = 61/113 (53%), Positives = 79/113 (69%), Gaps = 4/113 (3%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||| . || ||   | ||.|||    | ||||||.||||.| | ||||  ||| ||.|||
Sbjct: 1579 HSQDQSIPPCPQTWRSLWIGYSF---LMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQ 1635

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNS-AAFTLTDAWQQRDSVGKCNVCMR 112
            | .||||.||| ||||||.|.     ... |  || ..  ||  . .| ||..
Sbjct: 1636 GRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVK 1688

>hg18||uc001vqx
        |13|NM_001846|P08572|CO4A2_HUMAN|COL4A2|NM_001846|NP_001837|alpha 2
        type IV collagen preproprotein

          Length = 1712

 Score =  129 bits (322), Expect = 9e-031
 Identities = 62/112 (55%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||   || ||   | ||.|||    | || |||||||||| | ||||  ||| ||.|| 
Sbjct: 1603 HSQDVSIPHCPAGWRSLWIGYSF---LMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECN 1659

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||||.|| ||||||..     . . .| ||  |   |  . .| |||.
Sbjct: 1660 GGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTL-KAGLIRTHISRCQVCMK 1710

>hg18||uc004env |X|NM_033641|Q5JYH8|Q5JYH8_HUMAN|COL4A6|NM_033641|NP_378667|type
        IV alpha 6 collagen isoform B precursor

          Length = 1690

 Score =  128 bits (320), Expect = 1e-030
 Identities = 63/112 (56%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||   || |||  | ||.|||    | || || ||||||| | ||||  ||| ||.|| 
Sbjct: 1580 HSQDITIPQCPLGWRSLWIGYSF---LMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECS 1636

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||||||| ||||||.||               | |    | .| |||.
Sbjct: 1637 GARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMK 1688

>hg18||uc004enw |X|NM_001847|Q14031|CO4A6_HUMAN|COL4A6|NM_001847|NP_001838|type
        IV alpha 6 collagen isoform A precursor

          Length = 1691

 Score =  128 bits (320), Expect = 1e-030
 Identities = 63/112 (56%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||   || |||  | ||.|||    | || || ||||||| | ||||  ||| ||.|| 
Sbjct: 1581 HSQDITIPQCPLGWRSLWIGYSF---LMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECS 1637

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||||||| ||||||.||               | |    | .| |||.
Sbjct: 1638 GARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMK 1689

>hg18||uc001vqw
        |13|NM_001845|P02462|CO4A1_HUMAN|COL4A1|NM_001845|NP_001836|alpha 1
        type IV collagen preproprotein

          Length = 1669

 Score =  115 bits (286), Expect = 1e-026
 Identities = 58/112 (51%), Positives = 69/112 (61%), Gaps = 5/112 (4%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||| ||| ||     ||.|||    . || || || ||.| | ||||  ||. ||.|| 
Sbjct: 1561 HSQTIQIPPCPSGWSSLWIGYSF---VMHTSAGAEGSGQALASPGSCLEEFRSAPFIECH 1617

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||.|.|| ||||| ..|           ||  | . |  | .| ||||
Sbjct: 1618 G-RGTCNYYANAYSFWLATIERSEMFKKPTPSTL-KAGELRTHVSRCQVCMR 1667

>hg18||uc004enz
        |X|NM_033380|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033380|NP_203699|alpha 5
        type IV collagen isoform 2, precursor

          Length = 1691

 Score =  113 bits (282), Expect = 4e-026
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 5/112 (4%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||| ||| ||     ||.|||    . || || || ||.| | ||||  ||. ||.|| 
Sbjct: 1583 HSQTIQIPHCPQGWDSLWIGYSF---MMHTSAGAEGSGQALASPGSCLEEFRSAPFIECH 1639

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||.|.|| ||||| .|..    .   . ||  |   |  . .| |||.
Sbjct: 1640 G-RGTCNYYANSYSFWLATVDVSDMFSKPQSETL-KAGDLRTRISRCQVCMK 1689

>hg18||uc004eoa
        |X|NM_033381|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033381|NP_203700|alpha 5
        type IV collagen isoform 3, precursor

          Length = 1688

 Score =  113 bits (282), Expect = 4e-026
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 5/112 (4%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||| ||| ||     ||.|||    . || || || ||.| | ||||  ||. ||.|| 
Sbjct: 1580 HSQTIQIPHCPQGWDSLWIGYSF---MMHTSAGAEGSGQALASPGSCLEEFRSAPFIECH 1636

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMR 112
            | ||||.|.|| ||||| .|..    .   . ||  |   |  . .| |||.
Sbjct: 1637 G-RGTCNYYANSYSFWLATVDVSDMFSKPQSETL-KAGDLRTRISRCQVCMK 1686

>hg18||uc002vom |2|NM_000091|Q01955|CO4A3_HUMAN|COL4A3|NM_000091|NP_000082|alpha
        3 type IV collagen isoform 1 precursor

          Length = 1670

 Score =  99 bits (244), Expect = 9e-022
 Identities = 51/113 (45%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||  || ||     || |.|    .  | || || ||.| | ||||  ||| ||.|| 
Sbjct: 1561 HSQTTDIPPCPHGWISLWKGFSF---IMFTSAGSEGTGQALASPGSCLEEFRASPFLECH 1617

Query:   61 GPRGTCHYFANIYSFWLTSVELHGAENNSAAFTLTDAWQQRDSVGKCNVCMRE 113
            | ||||.|..| ||||| |.            |.  | .    . .| |||..
Sbjct: 1618 G-RGTCNYYSNSYSFWLASLNPERMFRKPIPSTV-KAGELEKIISRCQVCMKK 1668

>hg18||uc004env |X|NM_033641|Q5JYH8|Q5JYH8_HUMAN|COL4A6|NM_033641|NP_378667|type
        IV alpha 6 collagen isoform B precursor

          Length = 1690

 Score =  62 bits (148), Expect = 1e-010
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||..|.| ||. |  |||||||          ..   | |  .||||  |   ||. | 
Sbjct: 1472 HSQSEQVPPCPIGMSQLWVGYSLLF----VEGQEKAHNQDLGFAGSCLPRFSTMPFIYC- 1526

Query:   61 GPRGTCHYF-ANIYSFWLTS 79
                 |||   |  |.||..
Sbjct: 1527 NINEVCHYARRNDKSYWLST 1546

>hg18||uc004enw |X|NM_001847|Q14031|CO4A6_HUMAN|COL4A6|NM_001847|NP_001838|type
        IV alpha 6 collagen isoform A precursor

          Length = 1691

 Score =  62 bits (148), Expect = 1e-010
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||..|.| ||. |  |||||||          ..   | |  .||||  |   ||. | 
Sbjct: 1473 HSQSEQVPPCPIGMSQLWVGYSLLF----VEGQEKAHNQDLGFAGSCLPRFSTMPFIYC- 1527

Query:   61 GPRGTCHYF-ANIYSFWLTS 79
                 |||   |  |.||..
Sbjct: 1528 NINEVCHYARRNDKSYWLST 1547

>hg18||uc001vqx
        |13|NM_001846|P08572|CO4A2_HUMAN|COL4A2|NM_001846|NP_001837|alpha 2
        type IV collagen preproprotein

          Length = 1712

 Score =  59 bits (142), Expect = 6e-010
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||| | | ||. |  || ||||     .    ..   | |  .||||  |   ||. | 
Sbjct: 1495 HSQTDQEPMCPVGMNKLWSGYSLL----YFEGQEKAHNQDLGLAGSCLARFSTMPFLYC- 1549

Query:   61 GPRGTCHYFA-NIYSFWLTS 79
             |   |.| . |  |.||..
Sbjct: 1550 NPGDVCYYASRNDKSYWLST 1569

>hg18||uc002vol |2|NM_000092|NA|NA|COL4A4|NM_000092|NP_000083|alpha 4 type IV
        collagen precursor

          Length = 1690

 Score =  57 bits (137), Expect = 2e-009
 Identities = 34/80 (42%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            |||| | |.||| |  || ||||     .    ..   | |  .||||  |   ||  | 
Sbjct: 1471 HSQTDQEPTCPLGMPRLWTGYSLL----YLEGQEKAHNQDLGLAGSCLPVFSTLPFAYC- 1525

Query:   61 GPRGTCHYF-ANIYSFWLTS 79
                 |||   |  |.|| |
Sbjct: 1526 NIHQVCHYAQRNDRSYWLAS 1545

>hg18||uc001vqw
        |13|NM_001845|P02462|CO4A1_HUMAN|COL4A1|NM_001845|NP_001836|alpha 1
        type IV collagen preproprotein

          Length = 1669

 Score =  56 bits (133), Expect = 7e-009
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||   | ||   ..|. ||||     .    .   || | ..||||  |   ||. | 
Sbjct: 1451 HSQTIDDPQCPSGTKILYHGYSLL----YVQGNERAHGQDLGTAGSCLRKFSTMPFLFC- 1505

Query:   61 GPRGTCHYFA-NIYSFWLTSVE 81
                 |.. . | ||.||.. |
Sbjct: 1506 NINNVCNFASRNDYSYWLSTPE 1527

>hg18||uc002vom |2|NM_000091|Q01955|CO4A3_HUMAN|COL4A3|NM_000091|NP_000082|alpha
        3 type IV collagen isoform 1 precursor

          Length = 1670

 Score =  52 bits (124), Expect = 8e-008
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||  |||||     |. |.| || .|         || | . ||||  |   ||. | 
Sbjct: 1451 HSQTTAIPSCPEGTVPLYSGFS-FLFVQ---GNQRAHGQDLGTLGSCLQRFTTMPFLFC- 1505

Query:   61 GPRGTCHYFA-NIYSFWLTSVEL 82
                 |.. . | ||.||..  |
Sbjct: 1506 NVNDVCNFASRNDYSYWLSTPAL 1528

>hg18||uc002von |2|NM_031362|Q01955-2|Q01955-2|COL4A3|NM_031362|NP_112730|alpha
        3 type IV collagen isoform 2 precursor

          Length = 1637

 Score =  52 bits (124), Expect = 8e-008
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||  |||||     |. |.| || .|         || | . ||||  |   ||. | 
Sbjct: 1451 HSQTTAIPSCPEGTVPLYSGFS-FLFVQ---GNQRAHGQDLGTLGSCLQRFTTMPFLFC- 1505

Query:   61 GPRGTCHYFA-NIYSFWLTSVEL 82
                 |.. . | ||.||..  |
Sbjct: 1506 NVNDVCNFASRNDYSYWLSTPAL 1528

>hg18||uc004enz
        |X|NM_033380|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033380|NP_203699|alpha 5
        type IV collagen isoform 2, precursor

          Length = 1691

 Score =  51 bits (120), Expect = 2e-007
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||   | ||     .. |.||     .        || | ..||||  |   ||. | 
Sbjct: 1473 HSQTTDAPQCPQGTLQVYEGFSLL----YVQGNKRAHGQDLGTAGSCLRRFSTMPFMFC- 1527

Query:   61 GPRGTCHYFA-NIYSFWLTSVE 81
                 |.. . | ||.||.. |
Sbjct: 1528 NINNVCNFASRNDYSYWLSTPE 1549

>hg18||uc004eoa
        |X|NM_033381|Q9NUB7|Q9NUB7_HUMAN|COL4A5|NM_033381|NP_203700|alpha 5
        type IV collagen isoform 3, precursor

          Length = 1688

 Score =  51 bits (120), Expect = 2e-007
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTSSGSCLTHFRAQPFVECQ 60
            ||||   | ||     .. |.||     .        || | ..||||  |   ||. | 
Sbjct: 1470 HSQTTDAPQCPQGTLQVYEGFSLL----YVQGNKRAHGQDLGTAGSCLRRFSTMPFMFC- 1524

Query:   61 GPRGTCHYFA-NIYSFWLTSVE 81
                 |.. . | ||.||.. |
Sbjct: 1525 NINNVCNFASRNDYSYWLSTPE 1546

>hg18||uc002von |2|NM_031362|Q01955-2|Q01955-2|COL4A3|NM_031362|NP_112730|alpha
        3 type IV collagen isoform 2 precursor

          Length = 1637

 Score =  30 bits (66), Expect = 0.412
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFL 25
            ||||  || ||     || |.|  .
Sbjct: 1561 HSQTTDIPPCPHGWISLWKGFSFIM 1585

>hg18||uc002voo |2|NM_031365|Q01955-3|Q01955-3|COL4A3|NM_031365|NP_112733|alpha
        3 type IV collagen isoform 4 precursor

          Length = 1494

 Score =  29 bits (63), Expect = 0.918
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 4/43 (9%)

Query:    1 HSQTKQIPSCPLNMRVLWVGYSLFLCLQHTGAGDEGGGQSLTS 43
            ||||  |||||     |. |.| || .|         || | |
Sbjct: 1451 HSQTTAIPSCPEGTVPLYSGFS-FLFVQ---GNQRAHGQDLES 1489

>hg18||uc003wna |7|AY927457|NA|NA|HLXB9|NM_005515|NP_005506|homeo box HB9

          Length = 248

 Score =  26 bits (55), Expect = 7.773
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 22 SLFLCLQHTGAGDEGGGQSLTSSGSC 47
          ||      || |  ||| |  .||||
Sbjct: 33 SLAAAASGTGGGGGGGGASGGTSGSC 58

>hg18||uc003wnd |7|NM_005515|P50219|HLXB9_HUMAN|HLXB9|NM_005515|NP_005506|homeo
        box HB9

          Length = 401

 Score =  26 bits (55), Expect = 7.773
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 22 SLFLCLQHTGAGDEGGGQSLTSSGSC 47
          ||      || |  ||| |  .||||
Sbjct: 33 SLAAAASGTGGGGGGGGASGGTSGSC 58

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,422,265
Number of Sequences: 45480
Number of Extensions: 193422265
Number of Successful Extensions: 11204551
Number of sequences better than 0.0: 0
BLASTP 7.6.0