BLASTP 7.6.0


Query=fugu4_573563 |jgi|Takru4|573563|e_gw2.48.167.1
        (582 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_00...    116   8e-026
hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_0010198...     91   3e-018
hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_0010198...     87   4e-017
hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_00...     87   4e-017
hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_0010198...     75   2e-013
hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_00...     75   2e-013
hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_00...     47   8e-005
hg18||uc002umx |2|EF212154|NA|NA|TTN|NA|NA|Homo sapiens cardiac ...     32   2.664

>hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_002476|nibrin
        isoform 1

          Length = 754

 Score =  116 bits (290), Expect = 8e-026
 Identities = 55/95 (57%), Positives = 70/95 (73%)

Query:  52 LILKDSSKYGTFINSQRMTENTAVNLNPGDSVTFGVFESKFIVEHVQPVVCSSCLDNNGK 111
           | |||.||||||.| ..|    .  |  || .||||| ||| .|.   | |||||| .||
Sbjct:  66 LTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGK 125

Query: 112 TLLSQSLAALGGDLVNSWSLECTHLVMTSVKVTVK 146
           | |.|..  |||  ||.|. ||||||| |||||.|
Sbjct: 126 TALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIK 160

>hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_001019859|nibrin
        isoform 2

          Length = 672

 Score =  91 bits (225), Expect = 3e-018
 Identities = 43/70 (61%), Positives = 53/70 (75%)

Query:  77 LNPGDSVTFGVFESKFIVEHVQPVVCSSCLDNNGKTLLSQSLAALGGDLVNSWSLECTHL 136
           |  || .||||| ||| .|.   | |||||| .||| |.|..  |||  ||.|. |||||
Sbjct:   9 LKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHL 68

Query: 137 VMTSVKVTVK 146
           || |||||.|
Sbjct:  69 VMVSVKVTIK 78

>hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_001019859|nibrin
        isoform 2

          Length = 672

 Score =  87 bits (215), Expect = 4e-017
 Identities = 47/120 (39%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 463 KEETKRPVKAVAIKQEVQAPIDQDLPKKLVVVEFRTLTLTEAPEVKPLRMPDTSCE-KNF 521
           ||..    | ..   ..|   .  |||||.. |||.| .  .    |  . |   . |||
Sbjct: 545 KEDSLWSAKEISNNDKLQDDSEM-LPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNF 603

Query: 522 KCFRKHFGPGARGSPHIISGSDLLVHNRGKNSDLDEWLKDVVEEERQSRRDENVGDDLFR 581
           | |.|   |||   |||| ||||. |.  ||..|.|||.  .| . |  ..|.. |||||
Sbjct: 604 KKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFR 663

>hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_002476|nibrin
        isoform 1

          Length = 754

 Score =  87 bits (215), Expect = 4e-017
 Identities = 47/120 (39%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 463 KEETKRPVKAVAIKQEVQAPIDQDLPKKLVVVEFRTLTLTEAPEVKPLRMPDTSCE-KNF 521
           ||..    | ..   ..|   .  |||||.. |||.| .  .    |  . |   . |||
Sbjct: 627 KEDSLWSAKEISNNDKLQDDSEM-LPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNF 685

Query: 522 KCFRKHFGPGARGSPHIISGSDLLVHNRGKNSDLDEWLKDVVEEERQSRRDENVGDDLFR 581
           | |.|   |||   |||| ||||. |.  ||..|.|||.  .| . |  ..|.. |||||
Sbjct: 686 KKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFR 745

>hg18||uc003yei |8|NM_001024688|NA|NA|NBN|NM_001024688|NP_001019859|nibrin
        isoform 2

          Length = 672

 Score =  75 bits (184), Expect = 2e-013
 Identities = 36/90 (40%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 148 KRLSAAVSFGGGRSQLL-EEGSLPRHLLESPQSCVIDVTTGSSQALLPPSTTEWAKSVRN 206
           |.||.|| |||| ..|. ||     .   .| .||.|    .|| |.|    .| .|. .
Sbjct: 154 KKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMD 213

Query: 207 IVHRKGLRVITESEIGLAAIYASCGQHCNP 236
           .. |.||| | |.||||| |. .   .|.|
Sbjct: 214 MLQRQGLRPIPEAEIGLAVIFMTTKNYCDP 243

>hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_002476|nibrin
        isoform 1

          Length = 754

 Score =  75 bits (184), Expect = 2e-013
 Identities = 36/90 (40%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 148 KRLSAAVSFGGGRSQLL-EEGSLPRHLLESPQSCVIDVTTGSSQALLPPSTTEWAKSVRN 206
           |.||.|| |||| ..|. ||     .   .| .||.|    .|| |.|    .| .|. .
Sbjct: 236 KKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMD 295

Query: 207 IVHRKGLRVITESEIGLAAIYASCGQHCNP 236
           .. |.||| | |.||||| |. .   .|.|
Sbjct: 296 MLQRQGLRPIPEAEIGLAVIFMTTKNYCDP 325

>hg18||uc003yej |8|NM_002485|O60934|NBN_HUMAN|NBN|NM_002485|NP_002476|nibrin
        isoform 1

          Length = 754

 Score =  47 bits (109), Expect = 8e-005
 Identities = 26/67 (38%), Positives = 34/67 (50%)

Query: 10 GQTHYLHPGKDYVVGRKNCDILLTSDQSISRAHAQLVPSAQALILKDSSKYGTFINSQRM 69
          |. . |  | .|||||||| ||. .|||||| || |  .     |  . .          
Sbjct: 13 GEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNS 72

Query: 70 TENTAVN 76
             | ||
Sbjct: 73 KYGTFVN 79

>hg18||uc002umx |2|EF212154|NA|NA|TTN|NA|NA|Homo sapiens cardiac titin N2BA
        isoform (TTN) mRNA, partial cds

          Length = 242

 Score =  32 bits (70), Expect = 2.664
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 469 PVKAVAIKQEVQAPIDQ--DLPKKLVVVEFRTLTLTEAPEVKPLRMP 513
           ||| |   .. . |  .  ..||||| |.   . .|. ||| | ..|
Sbjct:   7 PVKKVPTVKKPETPAAKVPEVPKKLVPVKKEPVPVTKKPEVLPEKVP 53

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0