BLASTP 7.6.0


Query=fugu4_573401 |jgi|Takru4|573401|e_gw2.48.354.1
        (390 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003sxm |7|BX640851|Q8N865|CG031_HUMAN|C7orf31|NM_138811|...     70   3e-012
hg18||uc003sxn |7|NM_138811|Q8N865|CG031_HUMAN|C7orf31|NM_138811...     70   3e-012
hg18||uc003sxm |7|BX640851|Q8N865|CG031_HUMAN|C7orf31|NM_138811|...     39   0.008
hg18||uc003sxn |7|NM_138811|Q8N865|CG031_HUMAN|C7orf31|NM_138811...     39   0.008

>hg18||uc003sxm
        |7|BX640851|Q8N865|CG031_HUMAN|C7orf31|NM_138811|NP_620166|hypothetical
        protein LOC136895

          Length = 432

 Score =  70 bits (171), Expect = 3e-012
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query:  29 KQVFHPTPPKAVSPNPKLYDWDLSPSLSERTCNMLRNLERSRWITSYQLQHTGSGPAAPP 88
           | ||.| |||  .||  |  ||  |  | .  |. |||||| |.|||    || ||  | 
Sbjct:  79 KPVFYPKPPKTFAPNTSLNSWD--PICSAKEANIQRNLERSHWLTSYTHDFTGLGPMDPL 136

Query:  89 KTDDFSENVI 98
           . ||. | ..
Sbjct: 137 ELDDYHEKMV 146

>hg18||uc003sxn
        |7|NM_138811|Q8N865|CG031_HUMAN|C7orf31|NM_138811|NP_620166|hypothetica
        l protein LOC136895

          Length = 590

 Score =  70 bits (171), Expect = 3e-012
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query:  29 KQVFHPTPPKAVSPNPKLYDWDLSPSLSERTCNMLRNLERSRWITSYQLQHTGSGPAAPP 88
           | ||.| |||  .||  |  ||  |  | .  |. |||||| |.|||    || ||  | 
Sbjct: 237 KPVFYPKPPKTFAPNTSLNSWD--PICSAKEANIQRNLERSHWLTSYTHDFTGLGPMDPL 294

Query:  89 KTDDFSENVI 98
           . ||. | ..
Sbjct: 295 ELDDYHEKMV 304

>hg18||uc003sxm
        |7|BX640851|Q8N865|CG031_HUMAN|C7orf31|NM_138811|NP_620166|hypothetical
        protein LOC136895

          Length = 432

 Score =  39 bits (90), Expect = 0.008
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 344 QGSFSKSAAHRSFNSSVTGAAVDLRDSVATGRKHNFFGINCCY 386
           . ||||. | . |. |.     ||||.  .| || |.| |  |
Sbjct: 387 KNSFSKTGAQKRFHKSILEDHKDLRDNEHSGMKHQFYGHNSYY 429

>hg18||uc003sxn
        |7|NM_138811|Q8N865|CG031_HUMAN|C7orf31|NM_138811|NP_620166|hypothetica
        l protein LOC136895

          Length = 590

 Score =  39 bits (90), Expect = 0.008
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 344 QGSFSKSAAHRSFNSSVTGAAVDLRDSVATGRKHNFFGINCCY 386
           . ||||. | . |. |.     ||||.  .| || |.| |  |
Sbjct: 545 KNSFSKTGAQKRFHKSILEDHKDLRDNEHSGMKHQFYGHNSYY 587

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,422,265
Number of Sequences: 45480
Number of Extensions: 193422265
Number of Successful Extensions: 11204551
Number of sequences better than 0.0: 0
BLASTP 7.6.0