BLASTP 7.6.0


Query=fugu4_573390 |jgi|Takru4|573390|e_gw2.48.257.1
        (267 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002rxu |2|NM_003128|Q01082|SPTB2_HUMAN|SPTBN1|NM_003128|...     36   0.050
hg18||uc002rxx |2|NM_178313|Q8IX99|Q8IX99_HUMAN|SPTBN1|NM_178313...     36   0.050
hg18||uc002klo |18|NM_014646|Q92539|LPIN2_HUMAN|LPIN2|NM_014646|...     30   2.752

>hg18||uc002rxu
        |2|NM_003128|Q01082|SPTB2_HUMAN|SPTBN1|NM_003128|NP_003119|spectrin,
        beta, non-erythrocytic 1 isoform 1

          Length = 2364

 Score =  36 bits (81), Expect = 0.050
 Identities = 27/111 (24%), Positives = 59/111 (53%), Gaps = 13/111 (11%)

Query:   6 EETEDQLISLIQERPVLYDVSEKYYSNRAVKADLWREIEAKL----RLSEKELRKRWDSL 61
           |. ||  . .|| |   ..  |   .|.| .  .  .|  .|      ||||.. . | |
Sbjct: 879 EKLED--LEVIQHR---FESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKL 933

Query:  62 RTQYARYKKLAPLQKTGRQQWILTQLQFLDPHTKSKESTSSLNDHSQAVES 112
            |.......|   .|      .|. |   . | .  |. | . . .. .||
Sbjct: 934 NTRWSQFRELVDRKKDA----LLSALSIQNYHLECNETKSWIREKTKVIES 980

>hg18||uc002rxx
        |2|NM_178313|Q8IX99|Q8IX99_HUMAN|SPTBN1|NM_178313|NP_842565|spectrin,
        beta, non-erythrocytic 1 isoform 2

          Length = 2155

 Score =  36 bits (81), Expect = 0.050
 Identities = 27/111 (24%), Positives = 59/111 (53%), Gaps = 13/111 (11%)

Query:   6 EETEDQLISLIQERPVLYDVSEKYYSNRAVKADLWREIEAKL----RLSEKELRKRWDSL 61
           |. ||  . .|| |   ..  |   .|.| .  .  .|  .|      ||||.. . | |
Sbjct: 866 EKLED--LEVIQHR---FESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKL 920

Query:  62 RTQYARYKKLAPLQKTGRQQWILTQLQFLDPHTKSKESTSSLNDHSQAVES 112
            |.......|   .|      .|. |   . | .  |. | . . .. .||
Sbjct: 921 NTRWSQFRELVDRKKDA----LLSALSIQNYHLECNETKSWIREKTKVIES 967

>hg18||uc002klo |18|NM_014646|Q92539|LPIN2_HUMAN|LPIN2|NM_014646|NP_055461|lipin
        2

          Length = 896

 Score =  30 bits (66), Expect = 2.752
 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%)

Query:  92 PHTKSKESTSSLNDHSQAVESDSASEEHNSETWGGFPHEDSVKSEQ 137
           | |   .| | |    .  ||   || |   ||||||    |   .
Sbjct: 236 PQTACPKSDSEL--EVKPAESLLRSESHMEWTWGGFPESTKVSKRE 279

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0